Настройки

Укажите год
-

Небесная энциклопедия

Космические корабли и станции, автоматические КА и методы их проектирования, бортовые комплексы управления, системы и средства жизнеобеспечения, особенности технологии производства ракетно-космических систем

Подробнее
-

Мониторинг СМИ

Мониторинг СМИ и социальных сетей. Сканирование интернета, новостных сайтов, специализированных контентных площадок на базе мессенджеров. Гибкие настройки фильтров и первоначальных источников.

Подробнее

Форма поиска

Поддерживает ввод нескольких поисковых фраз (по одной на строку). При поиске обеспечивает поддержку морфологии русского и английского языка
Ведите корректный номера.
Ведите корректный номера.
Ведите корректный номера.
Ведите корректный номера.
Укажите год
Укажите год
Применить Всего найдено 1853. Отображено 100.
09-02-2012 дата публикации

Influenza Vaccines, Antigens, Compositions, and Methods

Номер: US20120034253A1
Автор: Konstantin Musiychuk, Vadim Mett, Vidadi Yusibov
Принадлежит: Fraunhofer USA Inc

The present invention relates to the intersection of the fields of immunology and protein engineering, and particularly to antigens and compositions useful in inducing or enhancing an immune response agains influenza antigens. Provided are recombinant protein antigens, compositions, and methods for the production of such antigens in plants. In some embodiments, influenza antigens include hemagglutinin polypeptides, neuraminidase polypeptides, and/or combinations thereof.

Подробнее
Номер записи: 1
16-02-2012 дата публикации

Compositions and methods for vaccine and virus production

Номер: US20120039939A1
Автор: Chia Chu, Joseph Shiloach, Michael Betenbaugh, Pratik Jaluria
Принадлежит: JOHNS HOPKINS UNIVERSITY

The present invention features methods of producing immunogenic compositions and viruses, methods of treating and preventing viral infection, and methods of producing an immune response using cells that express a polypeptide selected from the group consisting of: cdk13, siat7e, Iama4, cox15, egr1, gas6, map3k9, and gap43, and a virus.

Подробнее
Номер записи: 2
19-04-2012 дата публикации

Influenza vaccines with increased amounts of h3 antigen

Номер: US20120093860A1
Автор: Klaus Stohr, Theodore Tsai
Принадлежит: NOVARTIS AG

An influenza vaccine includes an increased amount of H3N2 antigen relative to the normal dose. In a typical embodiment, the vaccine includes hemagglutinins from an A/H1N1 strain, an A/H3N2 strain, and a B strain, wherein (i) the weight ratio of H3N2:H1N1 hemagglutinin is greater than 1 and (ii) the weight ratio of H3N2:B hemagglutinin is greater than 1. In such a vaccine the weight ratio of H1N1:B hemagglutinin will normally be 1. For example, a vaccine may contain hemagglutinin at 15 μg for A/H1N1, 30 μg for A/H3N2 and 15 μg for B.

Подробнее
Номер записи: 3
02-08-2012 дата публикации

Polyanionic polymer adjuvants for haemophilus influenzae b saccharide vaccines

Номер: US20120195937A1
Автор: Dominique Lemoine, Florence Emilie Jeanne Francoise Wauters, Nathalie Marie-Josephe Garcon
Принадлежит: GLAXOSMITHKLINE BIOLOGICALS SA

The present invention relates to immunogenic compositions comprising capsular polysaccharide or oligosaccharide of H. influenzae B (PRP) and methods of making such compositions.

Подробнее
Номер записи: 4
25-10-2012 дата публикации

Reverse genetics systems

Номер: US20120270321A1
Автор: Michael Franti, Peter Mason, Philip Dormitzer
Принадлежит: NOVARTIS AG

The invention provides various reverse genetics systems for producing segmented RNA viruses, wherein the systems do not require bacteria for propagation of all of their expression constructs.

Подробнее
Номер записи: 5
03-01-2013 дата публикации

Process for manufacturing vaccines

Номер: US20130004532A1
Автор: Pierre Duvivier, Ralph Leon BIERMANS
Принадлежит: GLAXOSMITHKLINE BIOLOGICALS SA

The present application discloses an improved method for conducting saccharide—protein conjugation reactions using carbodiimide condensation chemistry. Depending on the nature of the saccharide or protein carrier involved, the quality of the conjugate may be improved by adding one of the reaction components slowly to the reaction mixture. Immunogenic compositions are further provided comprising the saccharide-protein conjugates made by the methods disclosed.

Подробнее
Номер записи: 6
04-07-2013 дата публикации

Immunogenic composition

Номер: US20130171188A1
Автор: Carine Capiau, Dominique Boutriau, Jan Poolman, Philippe Denoel, Pierre Duvivier, Ralph Leon Biemans
Принадлежит: GLAXOSMITHKLINE BIOLOGICALS SA

The present application discloses an immunogenic composition comprising a Hib saccharide conjugate, at least one additional bacterial, for example N. meningitidis, saccharide conjugate(s), and a further antigen selected from the group consisting of whole cell pertussis and hepatitis B surface antigen, wherein the saccharide dose of the Hib saccharide conjugate is less than 5 μg.

Подробнее
Номер записи: 7
18-07-2013 дата публикации

Computationally optimized broadly reactive antigens for influenza

Номер: US20130183342A1
Автор: Brendan M. Giles, Ted M. Ross
Принадлежит: Individual

Described herein is the development of a computationally optimized influenza HA protein that elicits broadly reactive immune response to all H5N1 influenza virus isolates. The optimized HA protein was developed through a series of HA protein alignments, and subsequent generation of consensus sequences, for clade 2 H5N1 influenza virus isolates. The final consensus HA amino acid sequence was reverse translated and optimized for expression in mammalian cells. It is disclosed herein that influenza virus-like particles containing the optimized HA protein are an effective vaccine against H5N1 influenza virus infection in animals.

Подробнее
Номер записи: 8
25-07-2013 дата публикации

Multi plasmid system for the production of influenza virus

Номер: US20130189762A1
Автор: George Kemble, Gregory Duke
Принадлежит: MEDIMMUNE LLC

Vectors and methods for the production of influenza viruses suitable as recombinant influenza vaccines in cell culture are provided. Bi-directional expression vectors for use in a multi-plasmid influenza virus expression system are provided. Additionally, the invention provides methods of producing influenza viruses with enhanced ability to replicate in embryonated chicken eggs and/or cells (e.g., Vero and/or MDCK) and further provides influenza viruses with enhanced replication characteristics. In addition, the present invention includes an improved method of rescue, wherein animal cells (e.g., SF Vero cells) are electroporated with plasmids and vectors of the invention.

Подробнее
Номер записи: 9
29-08-2013 дата публикации

Methods of Making Hemagglutinin Proteins

Номер: US20130224798A1
Автор: Albert E. Price, James W. Huleatt, Langzhou Song, Lynda G. Tussey, Robert K. Evans, Thomas J. Powell, Valerian Nakaar
Принадлежит: Vaxinnate Corp

Methods of making a protein that stimulates a protective immune response in a subject include separating a portion of a protein from a naturally occurring influenza viral hemagglutinin to form a protein portion. The protein portion includes at least a portion of a globular head, and at least a portion of at least one secondary structure having at least one β-sheet at a bottom of the globular head that causes the globular head to essentially retain its tertiary structure. The protein portion made by the methods of the invention lacks a transmembrane domain, a cytoplasmic domain and an HA2 subunit. A nucleic acid sequence encoding the protein portion is transformed into a prokaryotic host cell.

Подробнее
Номер записи: 10
19-09-2013 дата публикации

Peptide Sequences and Compositions

Номер: US20130243804A1
Автор: Gregory Alan Stoloff, Wilson Romero Caparros-Wanderley
Принадлежит: Peptcell Ltd

Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-6, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ ID 1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ ID 2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ ID 3 DLIFLARSALILRGSVAHKSC SEQ ID 4 PGIADIEDLTLLARSMVVVRP SEQ ID 5 LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ ID 6 IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.

Подробнее
Номер записи: 11
06-01-2022 дата публикации

METHOD

Номер: US20220003767A1
Автор: KAPANIDIS Achillefs, ROBB Nicole, Taylor Jonathan
Принадлежит:

Provided herein is a method of functionalizing a particle, as well as methods of optically tracking a particle, isolating enveloped viral particles from a sample, quantifying enveloped virus particles in a sample and assessing enveloped viral aggregation in a sample. Kits are also provided. The particle is typically a viral particle. 1. A method of functionalizing a particle with a negatively charged polymer; the particle having a negatively charged surface and a lipid coating; wherein the method comprises contacting said particle with (i) a polyvalent cation and (ii) said polymer; such that the polymer binds to the particle thereby functionalizing the particle.2. A method according to wherein the particle is a nanoparticle.3. A method according to or wherein the particle is an enveloped virus particle.4. A method according to wherein the virus is selected from herpesviridae claim 3 , poxviridae claim 3 , pneumoviridae claim 3 , hepadnaviridae claim 3 , flaviviridae claim 3 , togaviridae claim 3 , coronaviridae claim 3 , hepatitis D virus claim 3 , orthomyxoviridae claim 3 , paramyxoviridae claim 3 , rhabdoviridae claim 3 , bunyaviridae claim 3 , filoviridae claim 3 , baculoviridae and retroviridae;wherein preferably the virus is an influenza virus.5. A method according to or wherein the virus is present in a biological fluid claim 3 , wherein preferably the biological fluid is allantoic fluid or is a cell culture medium.6. A method according to any one of the preceding claims wherein the polyvalent cation is a divalent metal cation; wherein preferably the polyvalent cation is Ca; optionally wherein the Ca is provided as CaCl).7. A method according to any one of the preceding claims wherein the negatively charged polymer is a polynucleotide claim 3 , a polypeptide claim 3 , a polysaccharide or a negatively charged polyether;wherein preferably the negatively charged polymer is a polynucleotide, preferably an oligonucleotide.8. A method according to any one of the ...

Подробнее
Номер записи: 12
11-01-2018 дата публикации

INFLUENZA VIRUS VACCINATION REGIMENS

Номер: US20180008696A1
Автор: Garcia-Sastre Adolfo, Krammer Florian, Palese Peter
Принадлежит: ICAHN SCHOOL OF MEDICINE AT MOUNT SINAI

Provided herein are immunization regimens for inducing an immune response (e.g., an antibody response) against influenza virus. In specific aspects, the immunization regimens involve the administration of a chimeric hemagglutinin (HA), a headless HA or another influenza virus stem domain based construct (e.g., the HA stem domain or a fragment thereof) to a subject. In certain aspects, the immunization regimens also involve the administration of an influenza virus neuraminidase immunogen. 1. A method for immunizing against influenza virus in a human subject , comprising:(a) administering to the subject a first vaccine formulation comprising an influenza virus neuraminidase polypeptide and a live attenuated influenza virus engineered to express a first chimeric hemagglutinin (HA), wherein the first chimeric HA comprises a first influenza virus HA globular head domain and an influenza virus HA stem domain polypeptide, wherein the first influenza virus HA globular head domain is heterologous to the HA stem domain polypeptide; and(b) a certain time after the administration of the first vaccine formulation, administering to the subject a second vaccine formulation comprising an inactivated influenza virus comprising a second chimeric HA, wherein the second chimeric HA comprises a second influenza virus HA globular head domain and the HA stem domain polypeptide, wherein the second influenza virus HA globular head domain is heterologous to the HA stem domain polypeptide, and wherein the first influenza virus HA globular head domain is different than the second influenza virus HA globular head domain.2. A method for immunizing against influenza virus in a human subject , comprising:(a) administering to the subject a first vaccine formulation comprising a live attenuated influenza virus engineered to express a first chimeric hemagglutinin (HA), wherein the first chimeric HA comprises a first influenza virus HA globular head domain and an influenza virus HA stem domain ...

Подробнее
Номер записи: 13
10-01-2019 дата публикации

COMPUTATIONALLY OPTIMIZED BROADLY REACTIVE ANTIGENS FOR INFLUENZA

Номер: US20190008949A1
Автор: Giles Brendan M., Ross Ted M.
Принадлежит: University of Pittsburgh - of the Commonwealth System of Higher Education

The development of a computationally optimized influenza HA protein that elicits broadly reactive immune response to all H5N1 influenza virus isolates is described. The optimized HA protein was developed through a series of HA protein alignments, and subsequent generation of consensus sequences, for clade 2 H5N1 influenza virus isolates. The final consensus HA amino acid sequence was reverse translated and optimized for expression in mammalian cells. Influenza virus-like particles containing the optimized HA protein are an effective vaccine against H5N1 influenza virus infection in animals. 1. A method of eliciting a broadly reactive immune response against influenza virus in a subject , comprising (i) obtaining the amino acid sequences of the polypeptide from a group of influenza virus isolates, wherein the influenza virus isolates are from the same subtype;', '(ii) organizing the amino acid sequences of the polypeptide from the group of influenza virus isolates by clade or sub-clade and then by geographical region within each clade or sub-clade;', '(iii) aligning the amino acid sequences within each geographical region to generate primary consensus sequences, wherein each geographic region is represented by a primary consensus sequence;', '(iv) aligning the primary consensus sequences to generate secondary consensus sequences, wherein each clade or sub-clade is represented by a secondary consensus sequence; and', '(v) aligning the secondary consensus sequences, thereby generating the optimized influenza virus polypeptide sequence; and, 'generating an optimized influenza virus polypeptide sequence comprising the steps ofadministering the optimized influenza virus polypeptide to the subject.2. The method of claim 1 , wherein generating the optimized influenza virus polypeptide sequence further comprises:(vi) reverse translating the optimized influenza virus polypeptide sequence to generate a coding sequence; and(vii) optimizing the coding sequence for expression in ...

Подробнее
Номер записи: 14
19-01-2017 дата публикации

INACTIVATED WHOLE VIRION VACCINE-CONTAINING MICRONEEDLE ARRAY PREPARATION AND METHOD FOR ADMINISTERING THE SAME

Номер: US20170014336A1
Автор: Kida Hiroshi, Kuruma Koji, Oyamada Takayoshi, Sakoda Yoshihiro, SHIMADA Toshio
Принадлежит:

Provided is a microneedle. The microneedle array includes a needle portion, which contains an inactivated whole virion influenza vaccine, and a sheet portion. Also provided is an administration method in which the microneedle array is administered and then administered secondly after an interval of equal to or greater than 24 hours and less than 2 months. 1. A microneedle array comprising:a needle portion containing an inactivated whole virion influenza vaccine; anda sheet portion.2. The microneedle array according to claim 1 ,wherein the needle portion contains a water-soluble polymer and dissolves after being inserted into a body.3. The microneedle array according to claim 2 ,wherein the water-soluble polymer is at least one kind of polymer selected from the group consisting of hydroxyethyl starch, dextran, sodium chondroitin sulfate, sodium hyaluronate, carboxymethyl cellulose, polyvinyl pyrrolidone, polyoxyethylene polyoxypropylene glycol, and polyethylene glycol.4. The microneedle array according to claim 1 ,wherein the influenza vaccine is at least one kind of virus selected from the group consisting of an A/H1N1 type, an A/H3N2 type, an A/H5N1 type, and a B type.5. The microneedle array according to claim 2 ,wherein the influenza vaccine is at least one kind of virus selected from the group consisting of an A/H1N1 type, an A/H3N2 type, an A/H5N1 type, and a B type.6. The microneedle array according to claim 1 ,wherein 90% by mass or more of the inactivated whole virion influenza vaccine with respect to a total mass of the vaccine is contained in a region that accounts for not more than 80% of a height of the needle portion from a tip of the needle portion, and/or in a region that extends not longer than 500 μm from a tip of the needle portion.7. The microneedle array according to claim 2 ,wherein 90% by mass or more of the inactivated whole virion influenza vaccine with respect to a total mass of the vaccine is contained in a region that accounts for not more ...

Подробнее
Номер записи: 15
19-01-2017 дата публикации

Fusion Protein Comprising Diphtheria Toxin Non-Toxic Mutant CRM197 or Fragment Thereof

Номер: US20170015713A1
Автор: Chunyan Yang, Cuiling SONG, Ningshao Xia, Shaowei Li, Wenxin Luo, Ying Gu
Принадлежит: Xiamen Innovax Biotech Co Ltd, XIAMEN UNIVERSITY

Provided in the present invention are a diphtheria toxin non-toxic mutant CRM197 or a fragment thereof as an adjuvant in a fusion protein and the use thereof to enhance the immunogenicity of a target protein fused therewith, for example, an HEV capsid protein, or an influenza virus M2 protein or an immunogenic fragment thereof. Also provided is a method for enhancing the immunogenicity of a target protein, comprising the fusion expression of the CRM197 or the fragment thereof with the target protein to form a fusion protein. Further provided is a fusion protein comprising the CRM197 or the fragment thereof and a target protein, the CRM197 or the fragment thereof enhancing the immunogenicity of the target protein. The present invention also provides an isolated nucleic acid encoding the fusion protein, a construct and a vector comprising said nucleic acid, and a host cell comprising the nucleic acid.

Подробнее
Номер записи: 16
17-01-2019 дата публикации

NUCLEIC ACID VACCINES

Номер: US20190015501A1
Автор: BOUCHON Axel, Ciaramella Giuseppe, Huang Eric Yi-Chun
Принадлежит: ModernaTX, Inc.

The invention relates to compositions and methods for the preparation, manufacture and therapeutic use ribonucleic acid vaccines (NAVs) comprising polynucleotide molecules encoding one or more antigens. 1. A nucleic acid vaccine , comprising:one or more RNA polynucleotides having an open reading frame encoding a first antigenic polypeptide that is derived from an infectious agent, at least one 5′ terminal cap and at least one chemical modification, formulated within a cationic lipid nanoparticle.2. The nucleic acid vaccine of claim 1 , wherein the vaccine is one RNA polynucleotide.3. The nucleic acid vaccine of claim 1 , wherein the cationic lipid nanoparticle has a molar ratio of about 20-60% ionizable cationic lipid:about 5-25% non-cationic lipid:about 25-55% sterol; and about 0.5-15% PEG-modified lipid.4. The nucleic acid vaccine of claim 1 , wherein the RNA polynucleotide has at least two chemical modifications.5. The nucleic acid vaccine of claim 1 , wherein the open reading frame is codon-optimized.6. The nucleic acid vaccine of claim 3 , wherein the cationic lipid nanoparticle has a polydispersity value of less than 0.4.7. The nucleic acid vaccine of claim 1 , wherein the polynucleotide has a poly-A tail of 80-250 nucleotides in length.8. The nucleic acid vaccine of claim 1 , wherein the nucleic acid vaccine is multivalent.9. The nucleic acid vaccine of claim 1 , wherein the open reading frame of the one or more RNA polynucleotides encode at least 2 claim 1 , 3 claim 1 , or 4 antigenic polypeptides.10. The nucleic acid vaccine of claim 1 , wherein the open reading frame of the one or more RNA polynucleotides encode 1 antigenic polypeptide.11. The nucleic acid vaccine of claim 1 , wherein the cationic lipid nanoparticle comprises a molar ratio of about 55% ionizable cationic lipid claim 1 , about 2.5% PEG lipid claim 1 , about 32.5% cholesterol and about 10% non-cationic lipid.12. The nucleic acid vaccine of claim 1 , wherein the nanoparticle has a mean ...

Подробнее
Номер записи: 17
21-01-2021 дата публикации

Antigen purification

Номер: US20210017502A1
Автор: Barry Bratcher, Carrie A. Simpson, Greg POGUE, Hugh A. Haydon, John W. Shepherd, Joshua Morton, Kelsi SWOPE, Leigh Burden, Nick Partain, Steven D. Hume
Принадлежит: Kentucky Bioprocessing Inc

Disclosed herein are methods and exemplary compositions associated with antigen purification, exemplary aspects of which may include harvesting viral and antigenic substances from source organisms; and a purification platform comprising chemical separation and size-difference separation for the removal of contaminants, debris and impurities from the viral and protein (e.g. antigenic, including influenza hemagglutinin antigens) substances, as well as their concentration and collection.

Подробнее
Номер записи: 18
05-02-2015 дата публикации

POLYANIONIC POLYMER ADJUVANTS FOR HAEMOPHILUS INFLUENZAE B SACCHARIDE VACCINES

Номер: US20150037368A1
Автор: GARCON Nathalie Marie-Josephe, Lemoine Dominique, Wauters Florence Emilie Jeanne Francoise
Принадлежит:

The present invention relates to methods of reducing flocculation in an immunogenic composition, where said immunogenic composition comprises (a) B capsular polysaccharide or oligosaccharide (PRP) and (b) at least one non-PRP antigen. The invention further relates to kits comprising (i) a first composition comprising a B capsular polysaccharide or oligosaccharide (PRP) and a polyanionic polymer, and (ii) a second composition comprising a non-PRP antigen adsorbed onto an adjuvant with a zero point charge greater than 8. 1Haemophilus influenzae. A method of reducing flocculation in an immunogenic composition , where said immunogenic composition comprises (a) B capsular polysaccharide or oligosaccharide (PRP) and (b) at least one non-PRP antigen , said method comprising the steps of:(i) providing a first composition comprising a non-PRP antigen adsorbed onto an adjuvant with a zero point charge greater than 8;(ii) adding to said first composition a polyanionic polymer or a salt thereof, wherein said polymer is an oligopeptide or polypeptide consisting of, on average, 8-117 residues and consisting of anionic constitutional repeating units selected from a group consisting of L-aspartic acid and L-glutamic acid, to provide a second composition; and{'i': 'Haemophilus influenzae', '(iii) adding B capsular polysaccharide or oligosaccharide (PRP) to said second composition to provide a final immunogenic composition.'}2. The method of claim 1 , where said PRP is conjugated to a carrier protein.3. The method of claim 2 , where said carrier protein is a source of T-helper cell epitopes.4. The method of claim 2 , where said carrier protein is selected from the group consisting of tetanus toxoid claim 2 , diphtheria toxoid claim 2 , CRM197 claim 2 , and protein D.5. The method of claim 1 , where said adjuvant is aluminum hydroxide.6. The method of claim 1 , where said oligopeptide or polypeptide consists of claim 1 , on average claim 1 , 15-18 residues.7. The method of claim 1 , ...

Подробнее
Номер записи: 19
11-02-2016 дата публикации

INFLUENZA VIRUS REASSORTMENT

Номер: US20160038585A1
Автор: Dormitzer Philip, GOMILA Raul, Mason Peter, Suphaphiphat Pirada
Принадлежит:

New influenza donor strains for the production of reassortant influenza B viruses are provided. 1. A method of preparing a reassortant influenza B virus comprising steps of:(i) introducing into a culture host one or more expression construct(s) which encode(s) the viral segments required to produce an influenza B virus wherein the expression construct(s) encode the HA segment from a first influenza B virus and at least one segment from a second influenza virus comprising (a) the NP and/or PB2 segment from the second influenza B virus which is a B/Victoria/2/87 like strain (optionally B/Brisbane/60/08), or (b) the NP segment from the second influenza B virus which is not B/Lee/40 or B/Ann Arbor/1/66 or B/Panama/45/90; and(ii) culturing the culture host in order to produce a reassortant influenza B virus.2. (canceled)3. The method of claim 1 , wherein the at least one segment from a second influenza virus comprises (b) and the NP and PB2 segments are from the second influenza B virus.4. The method of claim 1 , wherein the at least one segment from a second influenza virus comprises (b) and the second influenza B virus is a B/Victoria/2/87 like strain (optionally B/Brisbane/60/08).5. The method of claim 1 , wherein the PA claim 1 , PB1 claim 1 , PB2 claim 1 , NP claim 1 , NS and M segments are from the second influenza B virus.6. The method of claim 1 , wherein the reassortant influenza B virus comprises backbone segments from two or more influenza B strains.7. The method of claim 6 , wherein at least one backbone segment is from a B/Yamagata/16/88 like strain (optionally B/Panama/45/90).8. A method of preparing a reassortant influenza B virus comprising steps of(i) introducing into a culture host one or more expression construct(s) which encode(s) the viral segments required to produce an influenza B virus comprising (a) the HA segment from a B/Yamagata/16/88 like strain (optionally B/Panama/45/90) and at least one backbone segment from a B/Victoria/2/87 like strain ( ...

Подробнее
Номер записи: 20
12-02-2015 дата публикации

COMPUTATIONALLY OPTIMIZED BROADLY REACTIVE ANTIGENS FOR H3N2, H2N2, AND B INFLUENZA VIRUSES

Номер: US20150044247A1
Автор: Carter Donald M., Crevar Corey J., Ross Ted M.
Принадлежит:

Described herein is the generation of optimized H3N2, H2N2 and B influenza HA polypeptides for eliciting a broadly reactive immune response to influenza virus isolates. The optimized HA polypeptides were developed through a series of HA protein alignments, and subsequent generation of consensus sequences, based on H3N2, H2N2 and B influenza isolates. Provided herein are optimized H3N2, H2N2 and B influenza HA polypeptides, and compositions, fusion proteins and VLPs comprising the HA polypeptides. Further provided are codon-optimized nucleic acid sequences encoding the HA polypeptides. Methods of eliciting an immune response against influenza virus in a subject are also provided by the present disclosure. 1. A recombinant influenza hemagglutinin (HA) polypeptide , comprising:(i) an amino acid sequence at least 97.7% identical to residues 2-566 of SEQ ID NO: 8;(ii) an amino acid sequence at least 99.6% identical to residues 2-562 of SEQ ID NO: 1;(iii) an amino acid sequence at least 99.4% identical to residues 2-562 of SEQ ID NO: 2;(iv) an amino acid sequence comprising residues 2-562 of SEQ ID NO: 3;(v) an amino acid sequence at least 99.7% identical to residues 2-562 of SEQ ID NO: 4;(vi) an amino acid sequence at least 99.6% identical to residues 2-584 of SEQ ID NO: 5;(vii) an amino acid sequence at least 98.8% identical to residues 2-585 of SEQ ID NO: 6;(viii) an amino acid sequence comprising residues 2-585 of SEQ ID NO: 7;(ix) an amino acid sequence at least 98.4% identical to residues 2-566 of SEQ ID NO: 9;(x) an amino acid sequence at least 97.8% identical to residues 2-566 of SEQ ID NO: 10; or(xi) an amino acid sequence at least 98.9% identical to residues 2-566 of SEQ ID NO: 11.2. The influenza HA polypeptide of claim 1 , comprising:(i) an amino acid sequence at least 97.7% identical to SEQ ID NO: 8;(ii) an amino acid sequence at least 99.6% identical to SEQ ID NO: 1;(iii) an amino acid sequence at least 99.4% identical to SEQ ID NO: 2;(iv) the amino acid ...

Подробнее
Номер записи: 21
16-02-2017 дата публикации

COMPOSITIONS AND METHODS TO INCREASE PRODUCTION

Номер: US20170044216A1
Автор: De Souza Ivna, Fekkes Peter, Ho Samuel, Mason Peter, Parker David, Suphaphiphat Pirada
Принадлежит:

Disclosed herein are methods for increasing protein yield and cellular productivity. Chemical agents facilitate host cell production of biological molecules to increase product yield. 1. A method for producing therapeutic , prophylactic or diagnostic biological molecules from a host cell system comprising contacting a host cell system with at least one chemical agent selected from Table 1.2. The method according to wherein the host cell system is a cell culture or an embryonated egg.3. The method according to claim 2 , wherein the cell culture is selected from the group consisting of MDCK claim 2 , Vero claim 2 , BHK or CHO cells.4. The method according to wherein the chemical agent is a statin or analog thereof having a final concentration of 0.001 μM to 10 μM.6. The method according to claim 1 , wherein the host cell system is infected with a virus.7. The method according to wherein the chemical agent is added concurrently with virus inoculation of a host cell.8. The method according to claim 7 , wherein the virus used for inoculation is influenza.9. The method according to wherein the biological molecule produced by the host cell system is selected from an influenza virus particle claim 8 , a split influenza virion or an influenza virus glycoprotein.10. The method according to wherein the influenza virus glycoprotein is hemagglutinin.11. The method according to claim 1 , wherein the yield of the biological molecule produced is increased at least 1.5-fold compared to a control claim 1 , as measured by ELISA.12. The method according to claim 1 , wherein an analog is selected from the group consisting of fluvastatin claim 1 , pitavastatin claim 1 , atorvastatin claim 1 , cerivastatin claim 1 , lovastatin claim 1 , mevastatin claim 1 , pravastatin or isomers thereof.13. The method according to claim 1 , wherein the chemical agent is fluvastatin or pitavastatin or isomers thereof.14. A method for producing a therapeutic claim 1 , prophylactic or diagnostic influenza ...

Подробнее
Номер записи: 22
25-02-2016 дата публикации

METHODS OF PRODUCING INFLUENZA VACCINE COMPOSITIONS

Номер: US20160051660A1
Автор: Berry John Michael, Cui Weidong, Schwartz Richard M., TRAGER George Robert, Truong-Le Vu, Yee Luisa
Принадлежит:

Methods and compositions for the optimization of production of influenza viruses suitable as influenza vaccines are provided. 1. (canceled)3. The method of claim 2 , wherein the eggs are rocked during passage in (a) by a rocking process.4. The method of claim 3 , wherein the rocking process comprises tilting the eggs at a rate of about 1 cycle per minute or less claim 3 , about 5 cycles per minute or less claim 3 , or about 10 cycles per minute or less.5. The method of claim 3 , wherein the eggs are rocked for about 12 hours.6. The method of claim 3 , wherein the eggs are rocked for about 24 to 48 hours.7. The method of claim 2 , further comprising a secondary incubation claim 2 , wherein the eggs are rocked during the secondary incubation.8. The method of claim 3 , wherein a TCIDof the rocked eggs is at least 0.4 log greater than a TCIDof the same influenza virus passaged through non-rocked eggs.9. The method of claim 2 , wherein at least one influenza virus is selected from: an attenuated influenza virus claim 2 , a cold-adapted influenza virus claim 2 , a temperature-sensitive influenza virus claim 2 , an attenuated cold-adapted influenza virus claim 2 , a temperature-sensitive cold-adapted influenza virus claim 2 , an attenuated temperature-sensitive influenza virus claim 2 , and an attenuated cold-adapted temperature-sensitive influenza virus.10. The method of claim 2 , wherein the influenza virus comprises one or more influenza A viruses and/or one or more influenza B viruses.11. The method of claim 2 , wherein the influenza virus comprises at least two influenza virus strains.12. The method of claim 11 , wherein the influenza virus comprises three influenza virus strains.13. The method of claim 2 , wherein the vaccine composition comprises from 1% (w/v) to 5% (w/v) arginine and from 1% (w/v) to 4% (w/v) gelatin.14. The method of claim 2 , wherein the vaccine composition comprises from 1% to 2% (w/v) arginine claim 2 , 1% (w/v) gelatin and from 7% (w/v) to 10% ...

Подробнее
Номер записи: 23
15-05-2014 дата публикации

Multi plasmid system for the production of influenza virus

Номер: US20140134208A1
Автор: Erich Hoffmann, George Kemble, HONG Jin, Zhongying Chen
Принадлежит: MEDIMMUNE LLC

Vectors and methods for the production of influenza viruses suitable as recombinant influenza vaccines in cell culture are provided. Bi-directional expression vectors for use in a multi-plasmid influenza virus expression system are provided. Additionally, the invention provides methods of producing influenza viruses with enhanced ability to replicate in embryonated chicken eggs and/or cells (e.g., Vero and/or MDCK) and further provides influenza viruses with enhanced replication characteristics. A method of producing a cold adapted (ca) influenza virus that replicates efficiently at, e.g., 25° C. (and immunogenic compositions comprising the same) is also provided.

Подробнее
Номер записи: 24
21-02-2019 дата публикации

INFLUENZA VACCINE

Номер: US20190054162A1
Автор: HANON Emmanuel Jules, STEPHENNE Jean
Принадлежит: GLAXOSMITHKLINE BIOLOGICALS S.A.

The present invention relates to monovalent influenza vaccine formulations and vaccination regimes for immunising against influenza disease, their use in medicine, in particular their use in augmenting immune responses to various antigens, and to methods of preparation. In particular, the invention relates to monovalent influenza immunogenic compositions comprising an influenza antigen or antigenic preparation thereof from an influenza virus strain being associated with a pandemic outbreak or having the potential to be associated with a pandemic outbreak, in combination with an oil-in-water emulsion adjuvant comprising a metabolisable oil, a sterol and/or a tocopherol such as alpha tocopherol, and an emulsifying agent. 146.-. (canceled)47. A method for immunizing a human against influenza virus infection , the method comprising:selecting a human who was previously vaccinated with a monovalent first vaccine composition comprising a low amount of an influenza virus antigen or antigenic preparation from an influenza virus of subtype H2, H5, H6, H7 or H9, in combination with an adjuvant, wherein the low antigen amount does not exceed 15 μg of haemagglutinin (HA) per dose, and wherein said adjuvant is an oil-in-water emulsion comprising squalene and an emulsifying agent; andadministering to the selected human a monovalent second vaccine composition comprising a low amount of an influenza virus haemagglutinin (HA) antigen from a variant of the same influenza virus subtype, in combination with an adjuvant, wherein the low HA antigen amount does not exceed 15 μg of HA antigen per dose, wherein said adjuvant is an oil-in-water emulsion comprising squalene and an emulsifying agent; and wherein the variant comprises an antigenically distinct HA.48. The method as claimed in claim 47 , wherein the emulsifying agent of the first or second vaccine composition is polyoxyethylene sorbitan monooleate.49. The method as claimed in claim 47 , wherein the emulsifying agent of the first ...

Подробнее
Номер записи: 25
20-02-2020 дата публикации

Immunomodulatory compositions and methods of use thereof

Номер: US20200054731A1
Автор: Babita Agrawal, Rakesh Kumar
Принадлежит: Individual

The present disclosure provides immunomodulatory compositions comprising heat-killed Caulobacter crescentus (HKCC). Immunomodulatory compositions of the present disclosure are useful for modulating an immune response in an individual. The present disclosure thus provides methods of modulating an immune response in an individual, involving administering an immunomodulatory composition comprising HKCC to the individual.

Подробнее
Номер записи: 26
28-02-2019 дата публикации

Influenza virus mutants and uses therefor

Номер: US20190060441A1
Автор: Pamuk Bilsel, Yasuko Hatta
Принадлежит: FluGen Inc

Disclosed herein are compositions and methods related to mutant viruses, and in particular, mutant influenza viruses. The mutant viruses disclosed herein include a mutant M2 sequence, and are useful in immunogenic compositions, e.g., as vaccines. Also disclosed herein are methods, compositions and cells for propagating the viral mutants, and methods, devices and compositions related to vaccination.

Подробнее
Номер записи: 27
27-02-2020 дата публикации

INFLUENZA VIRUS MUTANTS AND USES THEREFOR

Номер: US20200061182A1
Автор: BILSEL Pamuk, HATTA Yasuko
Принадлежит:

Disclosed herein are compositions and methods related to mutant viruses, and in particular, mutant influenza viruses. The mutant viruses disclosed herein include a mutant M2 sequence, and are useful in immunogenic compositions, e.g., as vaccines. Also disclosed herein are methods, compositions and cells for propagating the viral mutants, and methods, devices and compositions related to vaccination. 155-. (canceled)56. A recombinant influenza A virus comprising a mutant M gene , wherein the mutant M gene comprises two stop codons at nucleotides 786-791 of SEQ ID NO: 28 or at a position corresponding to nucleotides 786-791 of SEQ ID NO: 28 with respect to the M gene coding sequence , and a deletion of nucleotides 792-842 of SEQ ID NO: 28 or at a position corresponding to nucleotides 792-842 of SEQ ID NO: 28 with respect to the M gene coding sequence.57. A recombinant influenza A virus comprising a mutant M gene , wherein the mutant M gene comprises two stop codons at nucleotides 786-791 of SEQ ID NO: 28 or at a position corresponding to nucleotides 786-791 of SEQ ID NO: 28 with respect to the M gene coding sequence , and a G to C substitution at nucleotide 52 of SEQ ID NO: 28 , or at a position corresponding to nucleotide 52 of SEQ ID NO: 28 with respect to the M gene coding sequence.58. A recombinant influenza A virus comprising a mutant M gene , wherein the mutant M gene comprises two stop codons at nucleotides 786-791 of SEQ ID NO: 28 or at a position corresponding to nucleotides 786-791 of SEQ ID NO: 28 with respect to the M gene coding sequence , and a deletion of nucleotides 792-842 of SEQ ID NO: 28 or at a position corresponding to nucleotides 792-842 of SEQ ID NO: 28 , and a G to C substitution at nucleotide 52 of SEQ ID NO: 28 or at a position corresponding to nucleotide 52 of SEQ ID NO: 28 with respect to the M gene coding sequence.59. The recombinant influenza virus of claim 56 , wherein mutation of the M gene results in failure of the virus to express the ...

Подробнее
Номер записи: 28
09-03-2017 дата публикации

Immunogenic composition

Номер: US20170065714A1
Автор: Carine Capiau, Dominique Boutriau, Jan Poolman, Philippe Denoel, Pierre Duvivier, Ralph Leon Biemans
Принадлежит: GLAXOSMITHKLINE BIOLOGICALS SA

The present application discloses an immunogenic composition comprising at least 2 different N. meningitidis capsular saccharides, wherein one or more is/are selected from a first group consisting of MenA, MenC, MenY and MenW which is/are conjugated through a linker to a carrier protein(s), and one or more different saccharides is/are selected from a second group consisting of MenA, MenC, MenY and MenW which is/are directly conjugated to a carrier protein(s).

Подробнее
Номер записи: 29
05-03-2020 дата публикации

MEDIA ELABORATED WITH NEWLY SYNTHESIZED ANTIBODIES (MENSA) AND USES THEREOF

Номер: US20200072836A1
Автор: Daiss John L., Lee Frances Eun-Hyung
Принадлежит:

Disclosed are methods and kits for early detection of antigen exposure through the presence or absence of antigen-specific antibodies. 111-. (canceled)12. A method of assessing the efficacy of a vaccine against a disease or toxin in a subject comprising obtaining PBMC or whole blood from the subject between 3 and 45 days following administration of a vaccine; separating plasma from the whole blood or PBMC to produce separated cells; isolating the newly proliferated ASC from the separated cells; washing the newly proliferated ASC; culturing the newly proliferated ASC in media conducive to antibody production and expression (MENSA) , measuring the number of vaccine specific antibody secreting cells (ASC) or antibodies in the MENSA , and comparing the number of ASC or antibodies to a standard or control , wherein the washed ASC comprise at least a 10or 10-fold reduction of contaminating pre-existing plasma antibodies relative to whole blood , plasma , or PBMC , and wherein an increase of vaccine specific ASC or antibodies in the MENSA relative to a standard or control indicates an efficacious vaccine.13. The method of claim 12 , wherein the control is the number of pre-existing vaccine specific antibodies and/or pre-existing ASC.1417-. (canceled)18. The method of claim 12 , wherein the disease is a viral disease selected from the group of viruses consisting of Herpes Simplex virus-1 claim 12 , Herpes Simplex virus-2 claim 12 , Varicella-Zoster virus claim 12 , Epstein-Barr virus claim 12 , Cytomegalovirus claim 12 , Human Herpes virus-6 claim 12 , Variola virus claim 12 , Vesicular stomatitis virus claim 12 , Hepatitis A virus claim 12 , Hepatitis B virus claim 12 , Hepatitis C virus claim 12 , Hepatitis D virus claim 12 , Hepatitis E virus claim 12 , Rhinovirus claim 12 , Coronavirus claim 12 , Influenza virus A claim 12 , Influenza virus B claim 12 , Measles virus claim 12 , Polyomavirus claim 12 , Human Papilomavirus claim 12 , Respiratory syncytial virus claim 12 , ...

Подробнее
Номер записи: 30
14-03-2019 дата публикации

Method for culturing mdck cells

Номер: US20190078056A1
Автор: Soichiro Kuwabara, Tae Uotani
Принадлежит: Research Foundation for Microbial Diseases of Osaka University BIKEN

The present invention relates to a cloned MDCK cell showing an expansion factor of 4.5 or more when cultured using a microcarrier and a method of culturing the MDCK cell, a method of growing a virus using the method of culturing the MDCK cell, and a cloned MDCK cell showing an expansion factor of 4.5 or more when cultured using a microcarrier.

Подробнее
Номер записи: 31
14-03-2019 дата публикации

DECREASING POTENTIAL IATROGENIC RISKS ASSOCIATED WITH INFLUENZA VACCINES

Номер: US20190078060A1
Автор: GREGERSEN Jens-Peter
Принадлежит: NOVARTIS AG

Influenza viruses for use in preparing human vaccines have traditionally been grown on embryonated hen eggs, although more modern techniques grow the virus in mammalian cell culture e.g. on Vero, MDCK or PER.C6 cell lines. The inventor has realised that the conditions used for influenza virus culture can increase the risk that pathogens other than influenza virus may grow in the cell lines and have identified specific contamination risks. Suitable tests can thus be performed during manufacture in order to ensure safety and avoid iatrogenic infections. 1: A process for preparing an influenza vaccine from influenza virus that has been grown in a culture of a mammalian cell line , comprising a step in which the vaccine and/or the culture is tested for the presence of an infectious agent that can grow in said cell line but that does not grow in embryonated hen eggs.2: A process for preparing an influenza vaccine from influenza virus that has been grown in a culture of a mammalian cell line , comprising a step in which the vaccine and/or the culture is treated to remove and/or inactivate an infectious agent that can grow in the cell line but does not grow in embryonated hen eggs.3: The process of or , wherein the mammalian cell line is a MDCK cell line , a Vero cell line , or a PER. C6 cell line.4: The process of any preceding claim , wherein the infectious agent is selected from the group consisting of: Pneumovirinae; Morbilliviruses of the Paramyxoviridae family; Enteroviruses of the Picornaviridae family; mammalian Reoviridae; and Birnaviridae.5: The process of claim 4 , wherein the infectious agent is selected from the group consisting of: respiratory syncytial virus; measles virus; Coxsackie viruses; echoviruses; enteroviruses; orthoreoviruses; rotaviruses; and infectious bursal disease virus.6Chlamydia: The process of any preceding claim claim 4 , wherein the mammalian cell line is a Vero cell line claim 4 , and wherein the infectious agent is selected from the ...

Подробнее
Номер записи: 32
26-03-2015 дата публикации

Virus-like particles comprising a matrix protein from a plant enveloped virus and uses thereof

Номер: US20150086589A1
Автор: Alexei PROKHNEVSKY, Vidadi Yusibov
Принадлежит: Fraunhofer USA Inc

The present invention relates to novel virus-like particles (VLPs) comprising a matrix protein derived from a first plant enveloped virus and a surface polypeptide. The surface polypeptide comprises (a) a surface exposed portion derived from a target polypeptide (b) a transmembrane domain, and (c) a cytosolic tail derived from a transmembrane (e.g., glycoprotein) of a second plant enveloped virus. The target polypeptide may be antigenic or therapeutic. The first and the second plant enveloped viruses may be the same. Either plant enveloped virus may be a plant rhabdovirus. Also provided are methods of making and using the VLPs.

Подробнее
Номер записи: 33
09-04-2015 дата публикации

Influenza vaccines

Номер: US20150098966A1
Автор: Jianhua Guo, Yawei Ni
Принадлежит: KJ Biosciences LLC

An influenza vaccine comprising an influenza hemagglutinin-containing antigen which is subjected to a treatment at a suitable low pH or other suitable conditions to obtain a suitable degree of loss of potency, and the method of making it are provided. The vaccine not only induces an increased cross-reactive immune response and cross protection, but can also induce a strain-specific immune response and protection like current inactivated vaccines. A method of administering influenza vaccines is also provided to induce an increased cross-reactive immune response and cross protection, which is especially suitable for use in emergency situations such as a pandemic.

Подробнее
Номер записи: 34
28-03-2019 дата публикации

NASAL INFLUENZA VACCINE COMPOSITION

Номер: US20190091324A1
Автор: Ainai Akira, Hasegawa Hideki, KAMISHITA Taizou, Miyazaki Takashi, Suzuki Tadaki
Принадлежит:

The invention relates to an influenza vaccine composition for spray-administration to nasal mucosa, which comprises an inactivated whole influenza virion and a gel base material comprising carboxy vinyl polymer, which is characterized by not comprising an adjuvant. 110-. (canceled)12. The method of claim 11 , wherein the influenza vaccine composition contains the inactivated whole influenza virion in an amount of 1-500 μg HA/mL per type of vaccine virus strain.13. The method of claim 11 , wherein the influenza vaccine composition comprises 0.1 w/v % to 1.0 w/v % carboxy vinyl polymer.14. The method of claim 11 , wherein the gel base material comprises 0.5 w/v % to 2.0 w/v % carboxy vinyl polymer.15. The method of claim 11 , wherein(1) a the particle-size-distribution of the sprayed composition has a mean particle size is in a range of 30 μm to 80 μm, and a particle distribution between 10 μm and 100 μm is 80% or more,(2) a spray density is uniform to form a homogeneous full-corn shape, and(3) a spray angle is in a range of 30° to 70°.16. The method of claim 15 , wherein(1) the mean particle size is in a range of 40 μm to 70 μm, and the particle distribution between 10 μm and 100 μm is 90% or more,(2) the spray density is uniform to form a homogeneous full-corn shape, and(3) the spray angle is adjusted in a range of 40° to 60°.17. The method of claim 11 , wherein the spray device sprays the influenza vaccine composition without a pumping function. The present invention relates to an influenza vaccine composition for spray-administration to nasal mucosa.Influenza is an acute respiratory tract infection caused by the influenza virus, in particular, influenza becomes epidemic in winter year after year. In addition, influenza sometimes results in a pandemic, and many people become severe to result in death. For influenza, it is known that the vaccination with influenza vaccine can bring in some preventive effects, thus people are broadly vaccinated before the epidemic ...

Подробнее
Номер записи: 35
28-03-2019 дата публикации

COMPUTATIONALLY OPTIMIZED BROADLY REACTIVE ANTIGENS FOR HUMAN AND AVIAN H5N1 INFLUENZA

Номер: US20190092820A1
Автор: Crevar Corey J., Giles Brendan M., Ross Ted M.
Принадлежит: University of Pittsburgh - of the Commonwealth System of Higher Education

Described herein is the generation of optimized H5N1 influenza HA polypeptides for eliciting a broadly reactive immune response to H5N1 influenza virus isolates. The optimized HA polypeptides were developed through a series of HA protein alignments, and subsequent generation of consensus sequences, based on human and avian H5N1 isolates. Provided herein are optimized H5N1 HA polypeptides, and compositions, fusion proteins and VLPs comprising the HA polypeptides. Further provided are codon-optimized nucleic acid sequences encoding the HA polypeptides. Methods of eliciting an immune response against influenza virus in a subject are also provided by the present disclosure. 1. A recombinant influenza hemagglutinin (HA) polypeptide , comprising an amino acid sequence at least 99.8% identical to SEQ ID NO: 1 , or at least 99.8% identical to residues 2-566 of SEQ ID NO: 1.2. The influenza HA polypeptide of claim 1 , wherein the amino acid sequence of the polypeptide comprises no more than 1 amino acid substitution relative to SEQ ID NO: 1.3. The influenza HA polypeptide of claim 1 , comprising the amino acid sequence of SEQ ID NO: 1 or residues 2-566 of SEQ ID NO: 1.4. An influenza virus-like particle (VLP) comprising the influenza HA polypeptide of .5. The influenza VLP of claim 4 , further comprising an influenza neuraminidase (NA) protein claim 4 , an influenza matrix (M1) protein claim 4 , or both.6. An influenza VLP comprising the influenza HA polypeptide of claim 1 , produced by transfecting a host cell with a vector encoding the HA polypeptide claim 1 , a vector encoding an influenza NA protein and a vector encoding an influenza M1 protein under conditions sufficient to allow for expression of the HA claim 1 , M1 and NA proteins.7. A fusion protein comprising the influenza HA polypeptide of .8. A composition comprising the influenza HA polypeptide of and a pharmaceutically acceptable carrier.9. A method of eliciting an immune response to influenza virus in a subject ...

Подробнее
Номер записи: 36
26-06-2014 дата публикации

Immuno-Adjuvant Emulsion

Номер: US20140178478A1
Автор: Francois Dalencon, Marie-Françoise Klucker, Patricia Probeck-Quellec
Принадлежит: Sanofi Pasteur Inc

The invention relates to an oil-in-water adjuvant emulsion which comprises at least: squalene, an aqueous solvent, a polyoxyethylene alkyl ether nonionic surfactant, a hydrophobic nonionic surfactant, which emulsion is thermoreversible, and wherein 90% of the population by volume of the oil drops has a size less than 200 nm. The invention also relates to a process for preparing an immunogenic composition according to which at least one vaccine antigen is mixed with an oil-in-water emulsion, wherein the oil-in-water emulsion is obtained by means of a temperature-variation phase-inversion process.

Подробнее
Номер записи: 37
16-04-2015 дата публикации

INCREASING VIRUS-LIKE PARTICLE YIELD IN PLANTS

Номер: US20150104480A1
Автор: "DAoust Marc-Andre", Couture Manon, Vezina Louis-Philippe
Принадлежит:

A method of producing a virus like particle (VLP) in a plant is provided. The method comprises introducing a first nucleic acid and a second nucleic acid into the plant, or portion of the plant. The first nucleic acid comprises a first regulatory region active in the plant and operatively linked to a nucleotide sequence encoding a structural virus protein. The second nucleic acid comprises a second regulatory region active in the plant and operatively linked to a nucleotide sequence encoding a channel protein, for example but not limited to a proton channel protein. The plant or portion of the plant is incubated under conditions that permit the expression of the nucleic acids, thereby producing the VLP. 1. A method of producing a virus like particle (VLP) in a plant comprising ,a) introducing a first nucleic acid comprising a first regulatory region active in the plant and operatively linked to a nucleotide sequence encoding a structural virus protein into the plant, or portion of the plant,b) introducing a second nucleic acid comprising a second regulatory region active in the plant and operatively linked to a nucleotide sequence encoding a channel proteinc) incubating the plant or portion of the plant under conditions that permit the expression of the nucleic acids, thereby producing the VLP.2. The method of claim 1 , wherein the channel protein is a proton channel protein.3. The method of claim 2 , wherein the proton channel protein is selected from M2 or BM2.4. The method of claim 2 , wherein the proton channel protein comprises the proton channel signature sequence HXXXW.5. The method of claim 1 , wherein the structural virus protein comprises a trimerization domain.6. The method of claim 1 , wherein the nucleotide sequence encoding the structural virus protein encodes an influenza HA protein.7. The method of claim 6 , wherein one or more proteolytic loop of the influenza HA protein has been deleted.8. The method of claim 1 , wherein the nucleotide sequence ...

Подробнее
Номер записи: 38
04-04-2019 дата публикации

INFLUENZA VIRUS VACCINES AND USES THEREOF

Номер: US20190099484A1
Автор: Garcia-Sastre Adolfo, Krammer Florian, Palese Peter
Принадлежит: ICAHN SCHOOL OF MEDICINE AT MOUNT SINAI

Provided herein are chimeric influenza hemagglutinin (HA) polypeptides, compositions comprising the same, vaccines comprising the same, and methods of their use. 1. A chimeric influenza virus hemagglutinin (HA) polypeptide comprising a stem domain of an HA from influenza virus A/California/4/2009 (H1N1) or A/California/4/2009 (H1N1)-like influenza virus HA and a globular head domain of an HA from an HA from influenza virus A/Vietnam/1203/2004 (H5) or an A/Vietnam/1203/2004 (H5)-like influenza virus HA.251.-. (canceled)52. The chimeric influenza virus HA polypeptide of claim 1 , wherein the stem domain of the HA maintains cysteine residues Aand A claim 1 , wherein Ais a Cys that corresponds to amino acid position 52 of an HA1 domain using H3 numbering claim 1 , and wherein Ais a Cys that corresponds to amino acid position 277 of an HA1 domain using H3 numbering.53. The chimeric influenza virus HA polypeptide of claim 1 , wherein:{'sub': N-term', 'p', 'q', 'C-term, '(a) the HA stem domain comprises (i) an HA1 N-terminal stem segment, wherein the HA1 N-terminal stem segment consists of amino acid residues HA1through A; (ii) an HA1 C-terminal stem segment, wherein the HA1 C-terminal stem segment consists of amino acid residues Athrough HA1; and (iii) an HA2 stem domain; and'}{'sub': p', 'q, '(b) the HA globular head domain comprises the amino acid residues between Aand Aof an HA1 domain;'}{'sub': N-term', 'C-term', 'p', 'q, 'wherein HA1is the N-terminal amino acid of a mature HA0 protein lacking a signal peptide; wherein HA1is the C-terminal amino acid of an HA1 domain; and wherein Ais the Cys that corresponds to amino acid position 52 of an HA1 domain using H3 numbering; and wherein Ais the Cys that corresponds to amino acid position 277 of an HA1 domain using H3 numbering.'}54. The chimeric influenza virus HA polypeptide of claim 1 , wherein:{'sub': N-term', 'p−10', 'p−9', 'p−8', 'p−7', 'p−6', 'p−5', 'p−4', 'p−3', 'p−2', 'p−1', 'p+1', 'p+2', 'p+3', 'p+4', 'p+5', 'p+6 ...

Подробнее
Номер записи: 39
02-06-2022 дата публикации

Adjuvanted multivalent influenza vaccines

Номер: US20220168413A1
Автор: Andrea FELLER, Brett LEAV, Christian Mandl, Gillis Otten, Max CIARLET
Принадлежит: Seqirus UK Ltd

The present disclosure relates to vaccine compositions comprising a) antigens from at least three different strains of influenza vims, preferably at least four different strains of influenza vims, and b) an oil-in-water emulsion adjuvant, wherein the amount of the oil-in-water emulsion adjuvant is greater than an amount of an oil-in-water emulsion adjuvant in a standard-dose adjuvanted multivalent influenza vaccine. Additionally, the total amount of the antigens in the vaccine compositions may be greater than a total amount of antigens in a standard-dose adjuvanted multivalent influenza vaccine. In preferred aspects, the present disclosure further describes uses of these vaccine compositions for safe and effective induction of immune responses in adults at least 65 years of age.

Подробнее
Номер записи: 40
23-04-2015 дата публикации

FUSION PROTEINS AND METHODS OF USE

Номер: US20150110827A1
Автор: Kavita Uma, LI HONG, Liu Ge, LIU Xiangyu, Song Langzhou, Tussey Lynda, Umlauf Scott, Weaver Bruce
Принадлежит:

Compositions that include at least three fusion proteins comprising flagellin and influenza antigens. In embodiments, the influenza antigens can include influenza A and influenza B antigens. The composition can further include at least one adjuvant. 1. A composition comprising at least three fusion proteins that each activate a Toll-like Receptor 5 , wherein:(a) a first fusion protein includes a first flagellin and a first influenza A viral hemagglutinin antigen that has an isoelectric point greater than about 6.0 fused to a portion of the first flagellin;(b) a second fusion protein includes a second flagellin and a second influenza A viral hemagglutinin antigen that is distinct from the first influenza A viral hemagglutinin antigen and that has an isoelectric point greater than about 7.0 fused to a portion of the second flagellin; and(c) a third fusion protein includes a third flagellin and a first influenza B viral hemagglutinin antigen that has an isolectric point greater than about 8.0 and is fused to at least one loop of domain 3 of the third flagellin.2. The composition of claim 1 , further including at least one adjuvant.3. The composition of claim 1 , wherein:(a) the first influenza A viral hemagglutinin antigen includes at least a portion or the entirety of an HA1 subunit that has at least a portion of a globular head that includes at least one β-sheet at a bottom of the globular head;(b) the second influenza A viral hemagglutinin antigen includes at least a portion or the entirety of an HA1 subunit having at least a portion of a globular head that includes at least one β-sheet, at least one β-sandwich and at least two β-strands at the bottom of the portion of the globular head; and(c) the first influenza B viral hemagglutinin antigen includes at least a portion or the entirety of an HA1 subunit that has at least a portion of a globular head that includes at least one β-sheet at a bottom of the globular head.4. The composition of claim 1 , further including ...

Подробнее
Номер записи: 41
21-04-2016 дата публикации

MDCK-DERIVED CELL STRAIN SUSPENSION-CULTURED IN PROTEIN-FREE MEDIUM AND METHOD FOR PROLIFERATING VIRUS USING CELL STRAIN

Номер: US20160108367A1
Автор: AHN Dong Ho, Cho EunYoung, Hwang Mihee, Kim MiSuk, KIM Sooin, LEE Hyeon, PARK Kukjin, SHIN Duckhyang
Принадлежит: MOGAM BIOTECHNOLOGY INSTITUTE

The present invention relates to a novel MDCK-derived cell line capable of being suspension-cultured in a protein-free medium and a method for proliferating a virus using the MDCK-derived cell line to produce a vaccine. The novel MDCK-derived cell line exhibits high and uniform productivity for various viruses, while causing less viral antigenic variations with low tumorigenicity, and thus can be useful in producing viruses used for vaccines. 1. A Madin-Darby canine kidney (MDCK)-derived MDCKS-MG cell line capable of being suspension-cultured in a protein-free medium (Accession No. KCLRF-BP-00297).2. The MDCK-derived MDCKS-MG cell line of claim 1 , wherein the protein-free medium is ProCHO5.3. The MDCK-derived MDCKS-MG cell line of claim 1 , wherein the cell line proliferates a virus.4. The MDCK-derived MDCKS-MG cell line of claim 3 , wherein the virus is selected from the group consisting of:an influenza virus, a Japanese encephalitis virus, a mumps virus, a rubella virus, a polio virus, herpes simplex virus type 1 (Herpes simplex virus-1, HSV-1), herpes virus type 2 (Herpes virus-2, HV-2), a measles virus, reovirus type 2 and type 3, a respiratory syncytial (RS) virus, a rabies virus, a yellow fever virus, adenovirus type 4, a Lassa virus, a vaccinia virus, a parvovirus, coxsackie virus type B3, B4 and B5, and a vesicular stomatitis virus.5. The MDCK-derived MDCKS-MG cell line of claim 4 , wherein the influenza virus is A/WS/33 claim 4 , Initiative for Vaccine Research (IVR)-116 claim 4 , IVR-148 claim 4 , IVR-145 claim 4 , New York Medical College (NYMC) X-181 claim 4 , A/Hongkong/8/68 claim 4 , NYMC X-161B claim 4 , NYMC X-187 claim 4 , NYMC X-157 claim 4 , IVR-147 claim 4 , B/Lee/40 claim 4 , B/Malaysia/2506/2004 claim 4 , B/Florida/4/2006 or B/Brisbane/60/2008.6. A method for proliferating a virus to produce a vaccine claim 4 , which comprises the steps of:1) infecting a MDCK-derived MDCKS-MG cell line (Accession No. KCLRF-BP-00297) with the virus;2) culturing ...

Подробнее
Номер записи: 42
05-05-2016 дата публикации

INFLUENZA VIRUS-LIKE PARTICLE PRODUCTION IN PLANTS

Номер: US20160122777A1
Автор: "DAoust Marc-Andre", Couture Manon, Vezina Louis-Philippe
Принадлежит:

A method of producing a virus like particle (VLP) in a plant comprising modified hemagglutinin is provided. The method comprises introducing a nucleic acid comprising a regulatory region active in the plant and operatively linked to a nucleotide sequence encoding a modified influenza hemagglutinin (HA) protein into the plant, or portion of the plant, the modified HA protein comprises a modified proteolytic loop. Followed by incubating the plant or portion of the plant under conditions that permit the expression of the nucleic acids, thereby producing the VLP. The modified proteolytic loop may comprise one or more protease cleavage sites exhibiting reduced or abolished cleavage by a protease. The nucleotide sequence encoding the HA may be selected from the group consisting of B HA, C, H1, H2, H3, H4, H5, H6, H7, H8, H9, H10, H11, H12, H13, H14, H15, and H16. Also described is a virus like particle (VLP) produced by the method, and plants expressing the VLP. The virus like particle (VLP) may comprise plant-specific N-glycans, or modified N-glycans. 1. A nucleic acid comprising a regulatory region active in a plant and an expression enhancer active in a plant , the regulatory region and the expression enhancer operatively linked to a nucleotide sequence encoding a modified influenza hemagglutinin (HA) comprising a modified proteolytic loop.2. The nucleotide acid of claim 1 , wherein the expression enhancer is selected from the group consisting of CPMVX claim 1 , CPMVX+ claim 1 , CPMV-HT+ CPMV HT+[WT115] and CPMV HT+[511].3. (canceled)4. (canceled)5. The nucleotide acid of claim 1 , wherein the modified proteolytic loop comprises one or more protease cleavage sites exhibiting reduced or abolished cleavage by a protease claim 1 , when compared to the cleave of one or more cleavage sites of a native HA.6. (canceled)7. The nucleotide acid of claim 1 , wherein the modified proteolytic loop comprises a linker sequence.8. (canceled)9. The nucleotide acid of claim 1 , wherein ...

Подробнее
Номер записи: 43
04-05-2017 дата публикации

SOLUBLE NEEDLE ARRAYS FOR DELIVERY OF INFLUENZA VACCINES

Номер: US20170119872A1
Автор: "OHagan Derek", Kwon Sung-Yun, Singh Manmohan
Принадлежит:

Influenza vaccines are administered using solid biodegradable microneedles. The microneedles are fabricated from the influenza vaccine in combination with solid excipient(s) and, after penetrating the skin, they dissolve in situ and release the vaccine to the immune system. The influenza vaccine is (i) a purified influenza virus surface antigen vaccine, rather than a live vaccine or a whole-virus or split inactivated vaccine (ii) an influenza vaccine prepared from viruses grown in cell culture, not eggs, (iii) a monovalent influenza vaccine e.g. for immunising against a pandemic strain, (iv) a bivalent vaccine, (v) a tetravalent or >4-valent vaccine, (vi) a mercury-free vaccine, or (vii) a gelatin-free vaccine. 125-. (canceled)26. A method of raising an immune response in a subject , comprising the step of applying a skin patch comprising a plurality of solid biodegradable microneedles to the subject's skin , wherein the microneedles comprise a mixture of (i) a biosoluble and biodegradable matrix material and (ii) an influenza vaccine selected from the group consisting of a purified influenza virus surface antigen vaccine , an influenza vaccine prepared from viruses grown in cell culture , a monovalent influenza vaccine , a bivalent vaccine , a tetravalent or >4-valent vaccine , a mercury-free vaccine , and a gelatin-free vaccine , further wherein the vaccine comprises hemagglutinin and 5-30 μg of detergent per μg of hemagglutinin and the microneedles penetrate the skin's dermis.27. The method of claim 26 , wherein the influenza vaccine is a purified influenza virus surface antigen vaccine.28. A method of raising an immune response in a subject claim 26 , comprising the step of applying a skin patch comprising a plurality of solid biodegradable microneedles to the subject's skin claim 26 , wherein the microneedles comprise a mixture of (i) a biosoluble and biodegradable matrix material and (ii) an influenza virus hemagglutinin claim 26 , wherein the amount of ...

Подробнее
Номер записи: 44
24-07-2014 дата публикации

Systems and Methods for Identifying Replikin Scaffolds and Uses of Said Replikin Scaffolds

Номер: US20140206556A1
Автор: Ann-Elenore Bogoch Borsanyi, Elenore S. Bogoch, Samuel Bogoch, Samuel Winston Bogoch
Принадлежит: Individual

The present invention provides a new class of peptides related to rapid replication and high human mortality, and their use in diagnosing, preventing and treating disease including vaccines and therapeutics for emerging viral diseases and methods of identifying the new class of peptides and related structures.

Подробнее
Номер записи: 45
12-05-2016 дата публикации

Method for preparing virosomes

Номер: US20160129106A1
Автор: Mike Ugwoke, Pieter Rijken, Wenyu DONG
Принадлежит: Crucell Holand BV

This disclosure relates to methods for preparing a virosome preparation comprising viral envelope protein of at least two, preferably at least three, more preferably at least four, different enveloped viruses, as well as to virosomal preparations obtained thereby. The disclosure also relates to the use of the virosomal preparations, e.g., as a vaccine.

Подробнее
Номер записи: 46
11-05-2017 дата публикации

POLYVALENT INFLUENZA VIRUS-LIKE PARTICLES (VLPS) AND USE AS VACCINES

Номер: US20170128562A1
Автор: Taubenberger Jeffery K.
Принадлежит: The United States of America, as represented by the Secretary, Department of Health and Human Serv

This disclosure provides compositions that include a mixture of viral like particles (VLPs), expressing different individual influenza hemagglutinin (HA) proteins that elicit broadly reactive immune responses to a wide variety of influenza viruses. For example, the composition can include at least two different influenza VLPs, a first VLP comprising a first HA polypeptide and a second VLP comprising a second influenza HA polypeptide, wherein the first and the second HA polypeptide are different subtypes and/or are from different influenza viruses, and a pharmaceutically acceptable carrier and/or an adjuvant. Methods of using the disclosed polymeric influenza VLP compositions to stimulate an immune response against influenza viruses, for example as a pre-pandemic or a seasonal vaccine, are provided. 1. A composition comprising:at least two different influenza virus-like particles (VLPs), a first VLP comprising a first influenza hemagglutinin (HA) polypeptide and a second VLP comprising a second influenza HA polypeptide, wherein the first and the second HA polypeptide are different subtypes and/or are from different influenza viruses; anda pharmaceutically acceptable carrier.2. The composition of claim 1 , wherein:the first influenza HA polypeptide comprises influenza A HA subtype H1, H2, H3, H4, H5, H6, H7, H8, H9, H10, H11, H12, H13, H14, H15 or H16; andthe second influenza HA polypeptide comprises influenza A HA subtype H1, H2, H3, H4, H5, H6, H7, H8, H9, H10, H11, H12, H13, H14, H15 or H16, wherein the first and the second influenza A HA polypeptide are different subtypes.3. The composition of claim 1 , wherein:the first influenza HA polypeptide comprises influenza A HA subtype H1, H2, H5, H6, H8, H9, H11, H12, H13, or H16;the second influenza HA polypeptide comprises influenza A HA subtype H3, H4, H7, H10, H14, or H15.4. The composition of claim 1 , wherein:(i) the first influenza HA polypeptide comprises influenza A HA subtype H1, H2 or H5; andthe second ...

Подробнее
Номер записи: 47
10-06-2021 дата публикации

ADJUVANTED VACCINES WITH NON-VIRION ANTIGENS PREPARED FROM INFLUENZA VIRUSES GROWN IN CELL CULTURE

Номер: US20210170021A1
Автор: "OHagan Derek", Del Giudice Giuseppe, Rappuoli Rino
Принадлежит:

An immunogenic composition comprising: (i) a non-virion influenza virus antigen, prepared from a virus grown in cell culture; and (ii) an adjuvant. Preferred adjuvants comprise oil-in-water emulsions. 119.-. (canceled)20. A method of raising an immune response in a human comprising administering an effective amount of a composition to the human , wherein the composition comprises:(i) a non-virion influenza virus antigen, prepared from a cell culture-grown human influenza virus, and(ii) an adjuvant comprising an oil-in-water emulsion.21. The method of claim 20 , wherein the non-virion influenza virus antigen comprises one or more purified surface antigens.22. The method of claim 20 , wherein the non-virion influenza virus antigen comprises one or more split virions.23. The method of claim 20 , wherein the composition comprises non-virion influenza virus antigens from more than one human influenza virus strain.24. The method of claim 23 , wherein the non-virion antigens are prepared from human influenza A virus and human influenza B virus.25. The method of claim 20 , wherein the non-virion influenza virus antigen is from an H1 claim 20 , H2 claim 20 , H3 claim 20 , H5 claim 20 , H7 claim 20 , or H9 influenza A virus subtype.26. The method of claim 20 , wherein the composition contains from 0.1 to 20 μg of haemagglutinin per viral strain.27. The method of claim 20 , wherein the composition is free of chicken DNA claim 20 , ovalbumin claim 20 , and ovomucoid.28. The method of claim 20 , wherein the composition contains less than 10 ng of cellular DNA from cell culture host.29. The method of claim 20 , wherein the oil-in-water emulsion has sub-micron droplets.30. The method of claim 20 , wherein the oil-in-water emulsion comprises a terpenoid.31. The method of claim 20 , wherein the oil-in-water emulsion comprises a tocopherol.32. The method of claim 20 , wherein the oil-in-water emulsion comprises a polyoxyethylene sorbitan esters surfactant claim 20 , an octoxynol ...

Подробнее
Номер записи: 48
31-05-2018 дата публикации

Peptide Sequences and Compositions

Номер: US20180147277A1
Автор: CAPARROS-WANDERLEY Wilson Romero, Stoloff Gregory A.
Принадлежит: PEPTCELL LIMITED

The present specification discloses recombinant nucleic acid constructs encoding an immunogenic multiepitope polypeptide comprising two or more polypeptides, recombinant nucleic acid constructs encoding at least two epitopes from two or more internal proteins of influenza virus, compositions comprising such recombinant nucleic acid constructs and methods of eliciting a T cell immune response against an influenza virus in a vertebrate using such recombinant nucleic acid constructs and compositions. 1. A recombinant nucleic acid construct encoding an immunogenic multiepitope polypeptide , the immunogenic multiepitope polypeptide comprising two or more polypeptides ,wherein the two or more polypeptides include a matrix 1 protein (M1) of SEQ ID NO: 7, or a sequence having 95% or more identity to SEQ ID NO: 7, and a nucleoprotein (NP) of SEQ ID NO: 9, or a sequence having 95% or more identity to SEQ ID NO: 9.2. The construct according to claim 1 , wherein the M1 is SEQ ID NO: 7 claim 1 , the NP is SEQ ID NO: 9 claim 1 , or the M1 is SEQ ID NO: 7 and NP is SEQ ID NO: 9.3. The construct according to claim 1 , wherein the sequence having 95% or more identity to SEQ ID NO: 7 includes SEQ ID NO: 1.4. The construct according to claim 1 , wherein the sequence having 95% or more identity to SEQ ID NO: 9 includes SEQ ID NO: 3.5. The construct according to claim 1 , wherein the two or more polypeptides are arranged in the order N-terminus-NP-M1-C-terminus.6. The construct according to further comprising a linker sequence claim 1 , wherein the NP and M1 are separated by the linker sequence.7. The construct according to further comprising an adjuvant.8. A composition for inducing a T cell mediated immune response against an influenza virus in a vertebrate claim 1 , the composition comprising a recombinant nucleic acid construct encoding an immunogenic multiepitope polypeptide claim 1 , the immunogenic multiepitope polypeptide comprising two or more units claim 1 ,wherein one unit of ...

Подробнее
Номер записи: 49
21-08-2014 дата публикации

Nanoparticles, process for preparation and use thereof as carrier for amphipatic and hydrophobic molecules in fields of medicine including cancer treatment and food related compounds

Номер: US20140234349A1
Автор: Bror Morein, Kafei Hu, Saideh Berenjian
Принадлежит: Moreinx AB

The present invention regards nanoparticles comprising a sterol and a component derived from Quillaja saponaria Molina selected from quillaja acid and quillaja saponin, which nanoparticles do not comprise a phospholipid. It also relates to a composition comprising the nanoparticles, and the use thereof as adjuvant, especially in vaccines, as carriers for amphipathic or hydrophobic molecules and as agents for treatment of cancer. Further, it regards a method for producing the phospholipid-free nanoparticles, a method for the treatment of cancer and a method for assessing the applicability of the cancer treating method.

Подробнее
Номер записи: 50
14-05-2020 дата публикации

VACCINATION OF IMMUNOCOMPROMISED SUBJECTS

Номер: US20200147203A1
Автор: BLACK Steven, Del Giudice Giuseppe, NICOLAY Uwe, Rappuoli Rino
Принадлежит:

Disclosed herein are methods for enhancing immune responses to a vaccine in immunocompromised individuals, including those receiving a statin therapy. Related products are also provided. 114-. (canceled)15: A method for enhancing an immune response in a subject comprising parenterally administering a tetravalent vaccine , wherein the vaccine comprises a high-dose antigen which is between three-fold and ten-fold an amount of a standard dose antigen and wherein the subject is under the age of 65 anda) currently on a statin therapy;b) not currently on a statin therapy but was on a statin therapy which terminated within the last 3 months; orc) not currently on a statin therapy but is scheduled to be on a statin therapy in the next 3 months.16: The method of claim 15 , wherein the vaccine is an influenza vaccine.17: The method of claim 16 , wherein the influenza vaccine comprises an H1N1 strain claim 16 , an H3N2 strain claim 16 , a B strain claim 16 , or any combination thereof.18: The method of claim 15 , wherein the subject is currently on a statin therapy.19: The method of claim 15 , wherein the subject is between the age of 60 and 64.20: The method of claim 15 , wherein the subject has a disease or disorder associated with impaired immunity.21: The method of claim 15 , wherein the statin therapy comprises a synthetic statin claim 15 , a non-synthetic statin claim 15 , or a combination thereof.22: The method of claim 21 , wherein the statin therapy comprises a synthetic statin selected from the group consisting of: Fluvastatin claim 21 , Atorvastatin claim 21 , Cerivastatin claim 21 , Rosuvastatin and Pitavastatin.23: The method of claim 17 , wherein the influenza vaccine comprises between about 45 μg and about 150 μg of antigen per strain.24: The method of claim 23 , wherein the influenza vaccine comprises about 60 μg of antigen per strain.25: The method of claim 18 , wherein the subject has been on the statin therapy for at least 1 week.26: The method of claim 25 , ...

Подробнее
Номер записи: 51
28-08-2014 дата публикации

Influenza hemagglutinin and neuraminidase variants

Номер: US20140242102A1
Автор: Chin-Fen Yang, Chongguang Liu, George Kemble
Принадлежит: MEDIMMUNE LLC

Polypeptides, polynucleotides, methods, compositions, and vaccines comprising influenza hemagglutinin and neuraminidase variants are provided.

Подробнее
Номер записи: 52
14-06-2018 дата публикации

METHODS OF OPTIMIZING NUCLEOTIDE SEQUENCES ENCODING ENGINEERED INFLUENZA PROTEINS

Номер: US20180162914A1
Автор: Alefantis Tim, Cortes-Garcia Guadalupe, Strugnell Tod Dwayne
Принадлежит:

The disclosure provides methods for generating an optimized nucleotide sequence encoding an engineered influenza structural protein and the optimized nucleotide sequences obtained therefrom. The optimized nucleotide sequences can be used in a reverse genetics system to facilitate the rescue of infectious influenza virus containing the engineered structural proteins and/or enhance viral titers. Also provided are methods of preparing an influenza vaccine composition using the optimized nucleotide sequences, as well as methods of inducing an immune response using the influenza vaccine composition. 1. A method of generating an optimized nucleotide sequence encoding an engineered influenza structural protein , the method comprising:a) providing an amino acid sequence of the engineered influenza structural protein;b) reverse-translating the amino acid sequence to generate a first nucleotide sequence;c) identifying a second nucleotide sequence that encodes an influenza structural protein that shares a high degree of sequence identity with the engineered influenza structural protein;d) at every position where the codons in the first and second nucleotide sequences code for the same amino acid, changing codons in the first nucleotide sequence to match codons from the second nucleotide sequence; ande) at every position where the codons in the first and second nucleotide sequences code for a different amino acid, changing codons in the first nucleotide sequence to match codons that are based on structural protein-specific influenza codon usage preferences, thereby generating the optimized nucleotide sequence.2. The method of claim 1 , wherein the influenza structural protein that shares a high degree of sequence identity with the engineered influenza structural protein is a wild-type influenza structural protein.3. The method of claim 1 , further comprising adding the 5′ and 3′ non-coding sequences from a high titer rescued strain to the optimized nucleotide sequence.4. The ...

Подробнее
Номер записи: 53
21-05-2020 дата публикации

VACCINE COMPOSITIONS

Номер: US20200155665A1
Автор: Drew Jeffrey
Принадлежит:

The invention relates to an immunogenic composition comprising influenza virus antigens derived from at least 5 influenza virus strains and one or more compounds of formula (I) or physiologically acceptable salts or esters thereof: wherein: Rrepresents hydrogen or Calkyl; Rrepresents Calkyl; and Rrepresents Calkyl. The invention also relates to methods of preparing the immunogenic composition, to pharmaceutical and vaccine compositions comprising the immunogenic composition and to use of the immunogenic, pharmaceutical and vaccine compositions for preventing influenza virus infection. 2. The immunogenic composition according to claim 1 , comprising influenza virus antigens derived from 20 or less influenza virus strains.3. The immunogenic composition according to or claim 1 , comprising influenza virus antigens derived from at least 6 influenza virus strains.4. The immunogenic composition according to any one of the preceding claims claim 1 , comprising influenza virus antigens derived from 8 to 18 influenza virus strains.5. The immunogenic composition according to any one of the preceding claims claim 1 , comprising influenza virus antigens derived from 14 to 18 influenza virus strains.6. The immunogenic composition according to any one of the preceding claims claim 1 , comprising influenza virus antigens derived from 15 influenza virus strains.7. The immunogenic composition according to any one of the preceding claims claim 1 , comprising influenza virus antigens derived from at least 2 influenza virus types.8. The immunogenic composition according to any one of the preceding claims claim 1 , comprising at least one influenza virus antigen derived from a type A influenza virus strain and at least one influenza virus antigen derived a type B influenza virus strain.9. The immunogenic composition according to any one of the preceding claims claim 1 , comprising influenza virus antigens derived from at least 2 subtypes of influenza virus type A.10. The immunogenic ...

Подробнее
Номер записи: 54
11-09-2014 дата публикации

Fusion proteins and methods of use

Номер: US20140255438A9
Автор: Bruce WEAVER, Ge Liu, Hong Li, Langzhou Song, Lynda Tussey, Scott Umlauf, Uma KAVITA, Xiangyu Liu
Принадлежит: Vaxinnate Corp

Compositions that include a fusion protein comprising flagellin and at least one antigen that has an isoelectric point greater than about 7.0 and that is fused to at least one domain 3 of the flagellin activate Toll-like Receptor 5. Methods of stimulating an immune response, in particular, a protective immune response include administering a composition that includes an antigen fused to a loop of domain 3 of flagellin.

Подробнее
Номер записи: 55
23-06-2016 дата публикации

Use of Immune Suppressive Domains as Medicaments

Номер: US20160175387A1
Автор: Christian KANSTRUP HOLM, Magdalena Janina Laska, Mogens Ryttergård DUCH, Shervin Bahrami
Принадлежит: AARHUS UNIVERSITET, Isd Immunotech Aps, SKAU APS

The present invention concerns uses of immune suppressive domains. In particular, the present invention concerns a use of an immune suppressive domain (ISD) for immune suppression and for reduction of inflammation.

Подробнее
Номер записи: 56
30-06-2016 дата публикации

Intranasal vaccination dosage regimen

Номер: US20160184424A1
Автор: Anna-Karin Maltais, Hans Arwidsson
Принадлежит: EUROCINE VACCINES AB

The present invention relates in a first aspect to a vaccine kit comprising a) a first vaccine component comprising i) a first set of one or more containers, each container containing a vaccine composition for intranasal administration, b) optionally a second vaccine component comprising a second set of one or more containers, each container containing a vaccine composition for intranasal administration, and c) optionally instructions for use, wherein each container of the first and second set of containers contains a volume of the vaccine composition from about 5 microliter to about 400 microliter. The present invention also relates to: An administration regimen for intranasal administration of a vaccine composition for use in immunizing a human. A device for use in administration of vaccine compositions. The use of: a) a first vaccine component comprising i) a first set of one or more containers, each container containing a vaccine composition for intranasal administration, b) optionally a second vaccine component comprising a second set of one or more containers, each container containing a vaccine composition for intranasal administration, wherein each container of the first and second set of containers contains a total volume of the vaccine composition from about 5 microliter to about 400 microliter for immunizing a human. The use of: a) a first vaccine component comprising i) a first set of one or more containers, each container containing a vaccine composition for intranasal administration, b) optionally a second vaccine component comprising a second set of one or more containers, each container containing a vaccine composition for intranasal administration, wherein each container of the first and second set of containers contains a total volume of the vaccine composition from about 5 microliter to about 400 microliter for the preparation of a vaccine for intranasally immunizing a human. The method of treating a person in need of a vaccination. The vaccine ...

Подробнее
Номер записи: 57
08-07-2021 дата публикации

Identification and Attenuation of the Immunosuppressive Domains in Fusion Proteins of Enveloped RNA Viruses

Номер: US20210206812A1
Автор: Bahrami Shervin, RYTTERGAARD DUCH Mogens
Принадлежит:

The present invention relates to enveloped RNA viruses. The invention in particular relates to the generation of superior antigens for mounting an immune response by first identifying then mutating the immunosuppressive domains in fusion proteins of enveloped RNA viruses resulting in decreased immunosuppressive properties of viral envelope proteins from the viruses. 1. A synthetic peptide comprising the amino acid sequence of SEQ ID NO:4 , optionally harboring 1 or 2 or 3 or 4 or 5 or 6 or 7 or 8 or 9 or 10 or 11 point mutation(s) , and further comprising a cysteine residue at an N-terminal or C-terminal position.2. The synthetic peptide according to claim 1 , wherein the amino acid sequence of SEQ ID NO:4 harbors 1 or 2 or 3 point mutation(s).3. The synthetic peptide according to claim 1 , wherein said point mutation(s) are selected from the group consisting of at least one exchange of an amino acid with another amino acid claim 1 , at least one insertion claim 1 , at least one deletion claim 1 , or a combination of one or more of these.4. The synthetic peptide according to claim 1 , wherein said synthetic peptide comprises the amino acid sequence of SEQ ID NO:214 claim 1 , optionally harboring 1 or 2 or 3 or 4 or 5 or 6 or 7 or 8 or 9 or 10 or 11 point mutation(s).5. The synthetic peptide according to claim 4 , wherein the amino acid sequence of SEQ ID NO:214 harbors 1 or 2 or 3 point mutation(s).6. The synthetic peptide according to claim 1 , wherein said synthetic peptide is a dimeric form of said synthetic peptide and wherein said synthetic peptide is dimerized through said cysteine residue.7. The synthetic peptide according to claim 6 , wherein said dimerization is through a disulfide bond involving said cysteine residue.8. The synthetic peptide according to claim 4 , wherein said synthetic peptide is a dimeric form of said synthetic peptide and wherein said synthetic peptide is dimerized through said cysteine residue.9. The synthetic peptide according to ...

Подробнее
Номер записи: 58
09-07-2015 дата публикации

PRODUCTION OF INFECTIOUS INFLUENZA VIRUSES

Номер: US20150191703A1
Автор: Legastelois Isabelle, MEDINA Julie, Moste Catherine
Принадлежит:

The invention relates to a method for producing influenza infectious viruses wherein CHO cells are infected with a seed of infectious influenza virus which has been generated by transfecting cells with an appropriate set of expression vectors. The invention also relates to a recombination cassette, and to a vector comprising said recombination cassette, that may be used in methods for producing infectious viruses, and particularly in the method according to the invention. 1. A method for producing infectious influenza viruses , wherein said method comprises the steps consisting of:a) transfecting cells with a set of expression vectors to generate a seed of infectious influenza virus,b) infecting CHO cells with said seed of infectious influenza virus.2. The method according to claim 1 , wherein the cells at step a) are cells of primate origin claim 1 , a mixture of cells of primate origin and CHO cells or consist of CHO cells.3. The method according to claim 2 , wherein the cells of primate origin are Vero cells.4. The method according to claim 2 , wherein said CHO cells are CHO-K1 cells.6. The method according to claim 5 , wherein:(i) said expression vectors allowing the expression of mRNAs encoding influenza PB1, PB2, PA and NP proteins comprise four different uni directional plasmids, each plasmid containing a cDNA complementary to a mRNA encoding one of the four distinct proteins selected from PB1, PB2, PA and NP influenza proteins under the control of a promoter that binds to RNA polymerase II, and(ii) said expression vectors allowing the expression of influenza PB1, PB2, PA, NP, M, NS, HA and NA vRNAs, or the corresponding cRNAs, comprise eight different uni directional plasmids, each plasmid containing a cDNA complementary to one of the eight distinct vRNAs selected from said PB1, PB2, PA, NP, M, NS, HA and NA influenza vRNAs, or to the corresponding cRNAs, under the control of a promoter that binds to RNA polymerase I.7. The method according to claim 6 , ...

Подробнее
Номер записи: 59
07-07-2016 дата публикации

Making influenza virus vaccines without using eggs

Номер: US20160193321A1
Автор: Heidi Trusheim, Theodore F. Tsai
Принадлежит: NOVARTIS AG

Currently, the steps performed prior to release of influenza strains to vaccine manufacturers involve passaging influenza virus through eggs. The invention aims to provide procedures useful in manufacturing influenza vaccines, in which the use of eggs is reduced, and preferably is avoided altogether. For instance, rather than use chicken eggs for influenza vaccine isolation, MDCK cells (Madin Darby canine kidney cells) may be used e.g. growing in suspension, growing in a serum-free medium, growing in a protein-free medium, being non-tumorigenic, grown in the absence of an overlay medium, etc.

Подробнее
Номер записи: 60
05-07-2018 дата публикации

Peptide Sequences and Compositions

Номер: US20180185470A1
Автор: CAPARROS-WANDERLEY Wilson Romero, Stoloff Gregory A.
Принадлежит: PEPTCELL LIMITED

The present specification discloses recombinant nucleic acid constructs encoding an immunogenic multiepitope polypeptide comprising two or more polypeptides, recombinant nucleic acid constructs encoding at least two epitopes from two or more internal proteins of influenza virus, compositions comprising such recombinant nucleic acid constructs and methods of eliciting a T cell immune response against an influenza virus in a vertebrate using such recombinant nucleic acid constructs and compositions. 1. A multi-epitope immunogenic polypeptide comprising two or more copies of two or more different influenza virus epitopes , wherein the two or more different influenza virus epitopes includes an epitope of a M1 protein from an influenza virus strain A , the epitope of the M1 protein being 8-40 amino acids in length , and a first epitope of a nucleoprotein (NP) from an influenza virus strain A , the first epitope of the NP being 8-40 amino acids in length.2. The multi-epitope immunogenic polypeptide of claim 1 , wherein the M1 protein is SEQ ID NO: 7.3. The multi-epitope immunogenic polypeptide of claim 1 , wherein the NP is SEQ ID NO: 9.4. The multi-epitope immunogenic polypeptide of claim 1 , wherein the epitope of the M1 protein is 11 or more amino acids in length.5. The multi-epitope immunogenic polypeptide of claim 4 , wherein the epitope of the M1 protein is 15-35 amino acids in length.6. The multi-epitope immunogenic polypeptide of claim 5 , wherein the epitope of the M1 protein is SEQ ID NO: 1.7. The multi-epitope immunogenic polypeptide of claim 1 , wherein the first epitope of NP is 11 or more amino acids in length.8. The multi-epitope immunogenic polypeptide of claim 7 , wherein the first epitope of NP is 15-35 amino acids in length.9. The multi-epitope immunogenic polypeptide of claim 8 , wherein the first epitope of NP is SEQ ID NO: 3.10. The multi-epitope immunogenic polypeptide of claim 1 , wherein the two or more different influenza virus epitopes further ...

Подробнее
Номер записи: 61
06-07-2017 дата публикации

Lipidated immune response modifier compound compositions, formulations, and methods

Номер: US20170189521A1
Автор: Paul D. Wightman
Принадлежит: 3M Innovative Properties Co

The compound N-(4-{[4-amino-2-butyl-1H-imidazo[4,5-c]quinolin-1-yl]oxy}butyl) octadecanamide is a useful drug compound for enhancing immune response and can be used, for example, as a vaccine adjuvant and a cancer treatment.

Подробнее
Номер записи: 62
14-07-2016 дата публикации

Method for preparing virosomes

Номер: US20160199480A1
Автор: Mike Ugwoke, Pieter Rijken, Wenyu DONG
Принадлежит: Janssen Vaccines and Prevention BV

Described are methods for preparing virosomes comprising the steps of: (a) providing an enveloped virus, and optionally inactivating the virus; (b) solubilizing the viral envelopes in a first solubilizing agent; (c) pre-solubilizing exogenous components in a second solubilizing agent; (d) adding the pre-solubilized exogenous components to the solubilized viral envelopes; and (e) reconstituting virosomal membranes by removing the solubilizing agent. According to the disclosure, the viral envelopes and the exogenous components are (pre-)solubilized at a temperature below 33° C.

Подробнее
Номер записи: 63
13-07-2017 дата публикации

Vaccine Containing Virus-Like Particles

Номер: US20170196965A1
Автор: Abe Motoharu, Asano Issay, Ikeda Kazuyuki, Ikeno Daisuke, Kimachi Kazuhiko, Kitano Ryoichi, Nishiyama Kiyoto, Onchi Tatsufumi, Onuma Hiroto, Ooyama Yusuke, Tsurudome Yukari
Принадлежит: THE CHEMO-SERO-THERAPEUTIC RESEARCH INSTITUTE

The present invention provides a vaccine containing virus-like particles derived from virus particles having an envelope, in which a lipid-component content of the virus-like particles is reduced relative to a lipid-component content of the virus particles. 1. A vaccine comprising:virus-like particles derived from virus particles having an envelope,wherein a lipid-component content of the virus-like particles is reduced relative to a lipid-component content of the virus particles.2. The vaccine according to claim 1 , wherein the lipid-component content of the virus-like particles is less than 50% by mass based on the lipid-component content of the virus particles.3. The vaccine according to claim 1 , wherein the lipid-component content of the virus-like particles is less than 20% by mass based on the lipid-component content of the virus particles.4. The vaccine according to claim 1 , wherein the lipid component is cholesterol.5. The vaccine according to claim 1 , wherein the virus-like particles contain a surface antigen of the virus particles claim 1 , a matrix protein or a membrane protein of the virus particles claim 1 , and a nucleoprotein of the virus particles.6. The vaccine according to claim 1 , wherein the virus-like particles contain a genomic nucleic acid derived from the virus particles.7. The vaccine according to claim 1 , wherein the virus particles are orthomyxovirus particles claim 1 , flavivirus particles claim 1 , or hepatitis B virus particles.8. The vaccine according to claim 7 , wherein the virus particles are influenza virus particles claim 7 , Japanese encephalitis virus particles claim 7 , or hepatitis B virus surface antigen (HBs) particles.9. The vaccine according to claim 8 , wherein the virus particles are influenza virus particles.10. The vaccine according to claim 9 , wherein the influenza virus particles are influenza A virus particles or influenza B virus particles.11. The vaccine according to claim 9 , wherein the influenza virus ...

Подробнее
Номер записи: 64
13-07-2017 дата публикации

Microneedle compositions and methods of using same

Номер: US20170196966A1
Автор: Daniel R. Henderson
Принадлежит: Verndari Inc

Described herein, are microneedle devices comprising a recombinant alphavirus replicon encoding an exogenous polypeptide, wherein the recombinant alphavirus replicon is coated onto or embedded into a plurality of microneedles. Also described herein are methods of preparing a microneedle device comprising a recombinant alphavirus replicon encoding an exogenous polypeptide. Also disclosed herein are methods of inducing an immune response in an individual comprising contacting the individual with a microneedle device comprising a recombinant alphavirus replicon encoding an exogenous polypeptide.

Подробнее
Номер записи: 65
25-09-2014 дата публикации

Multimeric multiepitope influenza vaccines

Номер: US20140286982A1
Автор: Tamar Ben-Yedidia, Yossi Singer
Принадлежит: Biondvax Pharmaceuticals Ltd

An isolated polynucleotide encoding an influenza multi-epitope polypeptide, wherein the multi-epitope polypeptide comprises multiple copies of a plurality of influenza virus peptide epitopes wherein the polypeptide is B(X 1 ZX 2 Z . . . X m ) n B or B(X 1 ) n Z(X 2 ) n Z . . . (X m ) n B; wherein B is an optional sequence of 1-4 amino acid residues; n is at each occurrence independently an integer of 2-50; m is an integer of 3-15; each of X 1 , X 2 . . . X m is an influenza peptide epitope of 4-24 amino acid residues; and Z at each occurrence is a bond or a spacer of 1-4 amino acid residues.

Подробнее
Номер записи: 66
27-06-2019 дата публикации

Vaccines For Human Papilloma Virus And Methods For Using The Same

Номер: US20190192650A1
Автор: David Weiner, Jian Yan
Принадлежит: Inovio Pharmaceuticals Inc, University of Pennsylvania Penn

Improved anti-HPV immunogens and nucleic acid molecules that encode them are disclosed. Immunogens disclosed include those having consensus HPV39 E6E7 and HPV45 E6E7. Pharmaceutical composition, recombinant vaccines comprising DNA plasmid and live attenuated vaccines are disclosed as well methods of inducing an immune response in an individual against HPV are disclosed.

Подробнее
Номер записи: 67
19-07-2018 дата публикации

Recombinant multiple domain fusion protein mitogens and use thereof for inducing enhancement or repression of antigen-specific immunity

Номер: US20180200349A1
Автор: Atsuo Ochi
Принадлежит: Individual

The invention relates to cell stimulatory fusion proteins and DNA sequences, vectors comprising at least two agonists of TNF/TNFR super family, immunoglobulin super family, cytokine family proteins and optional antigen combination. Instructions for use of these proteins and DNA constructs as immune adjuvants and vaccines for treatment of various chronic diseases such as viral infection are also provided. Additionally, the use of these protein and DNA constructs as immune suppressant for treatment of various chronic diseases, such as autoimmunity and organ transplant rejection, is also illustrated.

Подробнее
Номер записи: 68
19-07-2018 дата публикации

Recombinant multiple domain fusion protein mitogens and use thereof for inducing enhancement or repression of antigen-specific immunity

Номер: US20180200350A1
Автор: Ochi Atsuo
Принадлежит:

The invention relates to cell stimulatory fusion proteins and DNA sequences, vectors comprising at least two agonists of TNF/TNFR super family, immunoglobulin super family, cytokine family proteins and optional antigen combination. Instructions for use of these proteins and DNA constructs as immune adjuvants and vaccines for treatment of various chronic diseases such as viral infection are also provided. Additionally, the use of these protein and DNA constructs as immune suppressant for treatment of various chronic diseases, such as autoimmunity and organ transplant rejection, is also illustrated. 1. An immunostimulatory fusion polypeptide comprising in N-terminal to C-terminal direction a polypeptide comprising the receptor binding domain of CD40 ligand , a polypeptide comprising the receptor binding domain of ICOS , and a polypeptide comprising the human immunoglobulin Fc domain.2. A recombinant nucleic acid (cDNA) comprising a polynucleotide sequence that encodes the fusion polypeptide of .3. A cDNA expression vector containing a fusion polynucleotide sequence according to .4. A cDNA expression vector of claim 3 , which is selected from a plasmid claim 3 , recombinant virus claim 3 , and episomal vector.5. A cell line that comprises the cDNA expression vector of .6. The immunostimulatory fusion polypeptide of claim 1 , which is substantially pure. This application is a continuation of application Ser. No. 12/483,876, filed Jun. 12, 2009, which claims priority to U.S. Provisional Patent Application No. 61/073,010, filed Jun. 16, 2008.The invention generally relates to methods and compositions, which promote or repress antigen-specific immunity. The described polypeptide and DNA constructs are used as either immune adjuvants or suppressants for treating various chronic diseases including cancer, infectious diseases, autoimmune diseases, allergies and inflammatory diseases.Affording to Current Understanding of Molecular Mechanisms of Diseases, Reagents that Modulate ...

Подробнее
Номер записи: 69
19-07-2018 дата публикации

Recombinant multiple domain fusion protein mitogens and use thereof for inducing enhancement or repression of antigen-specific immunity.

Номер: US20180200351A1
Автор: Ochi Atsuo
Принадлежит:

The invention relates to cell stimulatory fusion proteins and DNA sequences, vectors comprising at least two agonists of TNF/TNFR super family, immunoglobulin super family, cytokine family proteins and optional antigen combination. Instructions for use of these proteins and DNA constructs as immune adjuvants and vaccines for treatment of various chronic diseases such as viral infection are also provided. Additionally, the use of these protein and DNA constructs as immune suppressant for treatment of various chronic diseases, such as autoimmunity and organ transplant rejection, is also illustrated. 1. An immunostimulatory fusion polypeptide comprising in N-terminal to C-terminal direction a polypeptide comprising the receptor binding domain of Interleukin-2 , a polypeptide comprising the receptor binding domain of Fas ligand , and a polypeptide comprising the human immunoglobulin Fc domain.2. A recombinant nucleic acid (cDNA) comprising a polynucleotide sequence that encodes the fusion polypeptide of .3. A cDNA expression vector containing a fusion polynucleotide sequence according to .4. A cDNA expression vector of claim 3 , which is selected from a plasmid claim 3 , recombinant virus claim 3 , and episomal vector.5. A cell line that comprises the cDNA expression vector of .6. The immunostimulatory fusion polypeptide of claim 1 , which is substantially pure. This application is a continuation of application Ser. No. 12/483,876, filed Jun. 12, 2009, which claims priority to U.S. Provisional Patent Application No. 61/073,010, filed Jun. 16, 2008.WO/2007/103048 Feb. 28, 2007WO/2007/022273 Aug. 15, 2006WO/2006/050949 Nov. 10, 2005WO/2003/063899 Jan. 28, 2003WO/1997/033617 Nov. 3, 1997WO/1995/013293 May 18, 1995The invention generally relates to methods and compositions, which promote or repress antigen-specific immunity. The described polypeptide and DNA constructs are used as either immune adjuvants or suppressants for treating various chronic diseases including cancer ...

Подробнее
Номер записи: 70
19-07-2018 дата публикации

Recombinant multiple domain fusion protein mitogens and use thereof for inducing enhancement or repression of antigen-specific immunity.

Номер: US20180200352A1
Автор: Ochi Atsuo
Принадлежит:

The invention relates to cell stimulatory fusion proteins and DNA sequences, vectors comprising at least two agonists of TNF/TNFR super family, immunoglobulin super family, cytokine family proteins and optional antigen combination. Instructions for use of these proteins and DNA constructs as immune adjuvants and vaccines for treatment of various chronic diseases such as viral infection are also provided. Additionally, the use of these protein and DNA constructs as immune suppressant for treatment of various chronic diseases, such as autoimmunity and organ transplant rejection, is also illustrated. 1. An immunostimulatory fusion polypeptide comprising in N-terminal to C-terminal direction a polypeptide comprising the receptor binding domain of nerve growth factor beta , a polypeptide comprising the receptor binding domain of Fas ligand , and a polypeptide comprising the human immunoglobulin Fc domain.2. A recombinant nucleic acid (cDNA) comprising a polynucleotide sequence that encodes the fusion polypeptide of .3. A cDNA expression vector containing a fusion polynucleotide sequence according to .4. A cDNA expression vector of claim 3 , which is selected from a plasmid claim 3 , recombinant virus claim 3 , and episomal vector.5. A cell line that comprises the cDNA expression vector of .6. The immunostimulatory fusion polypeptide of claim 1 , which is substantially pure. This application is a continuation of application Ser. No. 12/483,876, filed Jun. 12, 2009, which claims priority to U.S. Provisional Patent Application No. 61/073,010, filed Jun. 16, 2008.The invention generally relates to methods and compositions, which promote or repress antigen-specific immunity. The described polypeptide and DNA constructs are used as either immune adjuvants or suppressants for treating various chronic diseases including cancer, infectious diseases, autoimmune diseases, allergies and inflammatory diseases.Affording to Current Understanding of Molecular Mechanisms of Diseases, ...

Подробнее
Номер записи: 71
19-07-2018 дата публикации

Recombinant multiple domain fusion protein mitogens and use thereof for inducing enhancement or repression of antigen-specific immunity

Номер: US20180200353A1
Автор: Ochi Atsuo
Принадлежит:

The invention relates to cell stimulatory fusion proteins and DNA sequences, vectors comprising at least two agonists of TNF/TNFR super family, immunoglobulin super family, cytokine family proteins and optional antigen combination. Instructions for use of these proteins and DNA constructs as immune adjuvants and vaccines for treatment of various chronic diseases such as viral infection are also provided. Additionally, the use of these protein and DNA constructs as immune suppressant for treatment of various chronic diseases, such as autoimmunity and organ transplant rejection, is also illustrated. 1. An immunostimulatory fusion polypeptide comprising in N-terminal to C-terminal direction a polypeptide comprising the receptor binding domain of OX40 ligand , a polypeptide comprising the receptor binding domain of 4-1BB ligand , and a polypeptide comprising the human immunoglobulin Fc domain.2. A recombinant nucleic acid (cDNA) comprising a polynucleotide sequence that encodes the fusion polypeptide of .3. A cDNA expression vector containing a fusion polynucleotide sequence according to .4. A cDNA expression vector of claim 3 , which is selected from a plasmid claim 3 , recombinant virus claim 3 , and episomal vector.5. A cell line that comprises the cDNA expression vector of .6. The immunostimulatory fusion polypeptide of claim 1 , which is substantially pure. This application is a continuation of application Ser. No. 12/483,876, filed Jun. 12, 2009, which claims priority to US Provisional Patent Application No. 61/073,010, filed Jun. 16, 2008.The invention generally relates to methods and compositions, which promote or repress antigen-specific immunity. The described polypeptide and DNA constructs are used as either immune adjuvants or suppressants for treating various chronic diseases including cancer, infectious diseases, autoimmune diseases, allergies and inflammatory diseases.Affording to Current Understanding of Molecular Mechanisms of Diseases, Reagents that ...

Подробнее
Номер записи: 72
20-07-2017 дата публикации

Adjuvanted Influenza Vaccines for Pediatric Use

Номер: US20170202955A1
Автор: Groth Nicola, PELLEGRINI Michele, PODDA Audino
Принадлежит:

An influenza vaccine adjuvanted with a sub-micron oil-in-water emulsion elicits significantly higher immune responses in human pediatric populations. Compared to an existing unadjuvanted pediatric influenza vaccine, the adjuvanted vaccines provided herein can induce in children a longer persistence of high serum antibody titers and also longer seroconversion and seroprotection. The improvement in immune responses is seen for both influenza A virus and influenza B virus strains, but it is particularly marked for influenza B virus. Moreover, while the existing vaccine provides poor immunity in children after a single dose, the adjuvanted vaccine provides high seroprotection rates against the influenza A virus H3N2 subtype even after a single dose. Furthermore, the adjuvanted vaccine offers significantly better seroprotection against mismatched strains of influenza A virus. 12-. (canceled)3: A composition in unit dosage form , wherein: the composition comprises (i) an influenza B virus strain antigen; (ii) an influenza A virus strain antigen; and (iii) an adjuvant; and the unit dosage has a volume of less than 0.5 mL and contains between 6-9 μg of hemagglutinin per influenza virus strain , wherein the adjuvant comprises an oil-in-water emulsion in which the majority of oil droplets have a diameter of less than 1 μm and the oil droplets comprise squalene; and wherein the composition is immunogenic in that when administered to a pediatric population of at least 50 children between 6 and 36 months of age , the composition will elicit efficacy that satisfies one or more of the following criteria: (a) ≧70% seroprotection; (b) ≧40% seroconversion or significant increase; and/or (c) a geometric mean titer increase of ≧2.5-fold.4: A kit for preparing an immunogenic composition for use in immunizing a child between 6 and 36 months of age , wherein the kit comprises (i) a first kit component comprising an influenza B virus strain antigen and an influenza A virus strain antigen ...

Подробнее
Номер записи: 73
26-07-2018 дата публикации

Methods and compositions for enhancing immune response to vaccination

Номер: US20180207149A1
Автор: Fan Ngai HUNG, Jinxia Zhang, Johnson Yiu-Nam Lau, Kai Wang Kelvin TO
Принадлежит: Emv Enhance (hk) Ltd

Compositions and methods are described in which the topical application of a toll-like receptor 7 agonist or a toll-like receptor 9 agonist at or near a subdermal vaccination site provides an enhanced response to the vaccination. The enhanced response can be an elevated antibody titer relative to an untreated but vaccinated subject, and/or development of cross-species immunity to species not present in the vaccinating composition.

Подробнее
Номер записи: 74
26-07-2018 дата публикации

ADJUVANTED INFLUENZA VACCINES FOR PEDIATRIC USE

Номер: US20180207258A1
Автор: Groth Nicola, PELLEGRINI Michele, PODDA Audino
Принадлежит:

An influenza vaccine adjuvanted with a sub-micron oil-in-water emulsion elicits significantly higher immune responses in human pediatric populations. Compared to an existing unadjuvanted pediatric influenza vaccine, the adjuvanted vaccines provided herein can induce in children a longer persistence of high serum antibody titers and also longer seroconversion and seroprotection. The improvement in immune responses is seen for both influenza A virus and influenza B virus strains, but it is particularly marked for influenza B virus. Moreover, while the existing vaccine provides poor immunity in children after a single dose, the adjuvanted vaccine provides high seroprotection rates against the influenza A virus H3N2 subtype even after a single dose. Furthermore, the adjuvanted vaccine offers significantly better seroprotection against mismatched strains of influenza A virus. 115-. (canceled)16. A composition in unit dosage form , wherein:the composition comprises (i) an influenza virus antigen and (ii) an adjuvant; andthe unit dosage has a volume of between 0.2 mL and 0.45 mL.17. The composition of claim 16 , which includes hemagglutinin from four influenza virus strains.18. A split or subunit influenza vaccine having a vaccine efficacy in children of at least 50%.19. A composition in unit dosage form claim 16 , wherein:the composition comprises (i) an antigen from at least one influenza virus strain and (ii) an adjuvant; and the unit dosage contains between 6-9 μg of hemagglutinin per influenza virus strain. This application is a continuation-in-part of U.S. patent application Ser. No. 12/378,929 filed Feb. 20, 2009, which claims priority from provisional application 61/066,791, filed Feb. 22, 2008, the complete contents of both of which are incorporated in full herein by reference.This invention is in the field of adjuvanted vaccines for protecting against influenza virus infection.The content of the following submission on ASCII text file is incorporated herein by ...

Подробнее
Номер записи: 75
09-10-2014 дата публикации

Use of gk-1 peptide expressed on m13 filamentous phage as pharmaceutical ingredient to enhance the efficiency of the immune response induced by vaccine or pathogen antigens

Номер: US20140302085A1
Автор: Abel Blanca Cabrera, Edda Lydia Sciutto Conde, Gladis del Carmen Fragoso Gonzalez, Jacquelynne Brenda Cervantes Torres, Karen Manucharyan, René Alvaro Segura Velázquez, Rutilia Marisela Hernandez Gonzalez
Принадлежит: Universidad Nacional Autonoma De México

The present invention is directed to the use of FGK-1 immunopotentiator, composed by the peptide named GK-1, characterized by the sequence G-Y-Y-Y-P-S-D-P-N-T-F-Y-A-P-P-Y-S-A and linked to the pVIII surface protein of M13 filamentous phage, to prepare pharmaceutical products potentiating the protective immune response of vaccine antigens when used by itself or conjointly with these antigens administered either intranasally, subcutaneously, or intramuscularly, yielding an increase in the level of specific antibodies against vaccine antigens in serum and in bronchoalveolar lavages.

Подробнее
Номер записи: 76
04-07-2019 дата публикации

PRODUCTION OF VIRUSES IN AVIAN EGGS

Номер: US20190203186A1
Автор: Bean Andrew, Lowenthal John William, Malaver-Ortega Luis Fernando, Tripp Ralph A.
Принадлежит:

The present invention relates to modified avian eggs which can be used to produce increased levels of virus. The present invention also relates to methods of producing viruses in avian eggs of the invention, as well as the use of the viruses obtained to prepare vaccine compositions. 134.-. (canceled)35. A method of replicating a virus , the method comprising;1) inoculating an avian egg with a virus, wherein the avian egg comprises a genetic modification which reduces expression of an antiviral gene in the Type I interferon pathway in the egg when compared to an isogenic egg lacking the genetic modification, wherein the egg is capable of producing more virus than the isogenic egg; and2) incubating the egg for a predetermined period of time to replicate the virus.36. The method of claim 35 , wherein the antiviral gene is selected from: one claim 35 , two claim 35 , three claim 35 , four or more of: IFNAR1 claim 35 , IL-6 claim 35 , CNOT4 claim 35 , MDA5 claim 35 , IFNα claim 35 , IFNβ claim 35 , IFNγ claim 35 , IFNλ claim 35 , BACE2 claim 35 , UBA5 claim 35 , ZFPM2 claim 35 , TRIM50 claim 35 , DDI2 claim 35 , NPR2 claim 35 , CAPN13 claim 35 , DNASE1L2 claim 35 , PHF21A claim 35 , PCGF5 claim 35 , IL28RA claim 35 , IFIH1 claim 35 , IL-1RA claim 35 , LAMP1 claim 35 , EFR3A claim 35 , ABI1 claim 35 , GADL1 claim 35 , PLVAP claim 35 , CYYR1 claim 35 , ASAP1 claim 35 , NXF1 claim 35 , NSUN6 claim 35 , ANGPTL7 claim 35 , SIL1 claim 35 , BCAR3 claim 35 , GOLPH3L claim 35 , HN1 claim 35 , ADCY7 claim 35 , CBLN4 claim 35 , CXORF56 claim 35 , DDX10 claim 35 , EIF2S3 claim 35 , ESF1 claim 35 , GCOM1 claim 35 , GTPBP4 claim 35 , IFT43 claim 35 , KPNA3 claim 35 , LRRIQ1 claim 35 , LUC7L claim 35 , MRPL12 claim 35 , POLR3E claim 35 , PWP2 claim 35 , RPL7A claim 35 , SMYD2 claim 35 , XPO1 and ZKSCAN7.37. The method of claim 35 , wherein the antiviral gene is selected from one claim 35 , two claim 35 , three claim 35 , four or all of: IFNAR1 claim 35 , IL-6 claim 35 , CNOT4 claim 35 ...

Подробнее
Номер записи: 77
04-08-2016 дата публикации

Thermally Stable Vaccine Formulations and Microneedles

Номер: US20160220483A1
Автор: Bommarius Andreas Sebastian, EDENS William Christopher, MISTILIS Matthew Joseph, PRAUSNITZ Mark
Принадлежит: GEORGIA TECH RESEARCH CORPORATION

Formulations and methods are provided for stabilizing antigens in dry solid vaccines. One aspect relates to dry solid formulations of influenza vaccines including one or more excipients identified as imparting stability to influenza antigens. Another aspect relates to dry solid formulations of measles vaccines including one or more excipients identified as imparting stability to a measles antigen. The formulations may be in a form suitable for reconstitution in a physiologically acceptable liquid vehicle to form an injectable solution or suspension for administration to a patient or in the form of dissolvable microneedles or coated microneedles. 1. A vaccine composition comprising:an influenza antigen, andan excipient selected from the group consisting of maltodextrin 17, maltodextrin 4, arginine, maltose, histidine, calcium heptagluconate, maltodextrin 13, heparin, raffinose, myo-inositol, sucrose, sorbitol, arabitol, fructose, potassium gluconate, adonitol, xylitol, sodium thio sulfate, asparigine, 2-hydroxypropyl-β-cyclodextrin, TRIS, sodium citrate, dulcitol, and combinations thereof,wherein the composition is in a dry solid form.2. The vaccine composition of claim 1 , wherein the excipient is present in the composition in an amount from about 1% to about 90% by weight.3. The vaccine composition of claim 1 , wherein the influenza antigen is selected from the group consisting of influenza A claim 1 , influenza B claim 1 , influenza C claim 1 , and combinations thereof.4. The vaccine composition of claim 1 , wherein the influenza antigen comprises a whole inactivated influenza virus claim 1 , a split inactivated influenza virus claim 1 , a subunit inactivated influenza virus claim 1 , an influenza virus-like particle claim 1 , or a combination thereof.5. The vaccine composition of claim 1 , further comprising one or more adjuvants.6. The vaccine composition of claim 1 , wherein the influenza antigen is characterized as having improved stability over six months in ...

Подробнее
Номер записи: 78
11-08-2016 дата публикации

Use of EGFR Pathway Inhibitors to Increase Immune Responses to Antigens

Номер: US20160228533A1
Автор: Brian P. Pollack, Ioanna Skountzou, Joanna A. Pulit-Penaloza, Richard W. Compans
Принадлежит: EMORY UNIVERSITY

This disclosure relates to using EGFR pathway inhibitors in combination with compositions comprising an antigen to increase, elicit, or improve an antigen or vaccine-induced immune response. In certain embodiments, the EGFR pathway inhibitor is administered under conditions such that memory cells to the antigen are formed in a subject. In certain embodiments, the composition is a vaccine. In certain embodiments, the EGFR pathway inhibitor and vaccine are administered to the skin epidermis or dermis.

Подробнее
Номер записи: 79
20-08-2015 дата публикации

Flagellin Fusion Proteins

Номер: US20150232516A1
Автор: Evans Robert K., Huleatt James W., Nakaar Valerian, Powell Thomas J., Price Albert E., Song Langzhou, Tussey Lynda G.
Принадлежит:

Methods of making a protein that stimulates a protective immune response in a subject include separating a portion of a protein from a naturally occurring influenza viral hemagglutinin to form a protein portion. The protein portion includes at least a portion of a globular head, and at least a portion of at least one secondary structure having at least one β-sheet at a bottom of the globular head that causes the globular head to essentially retain its tertiary structure. The protein portion made by the methods of the invention lacks a transmembrane domain, a cytoplasmic domain and an HA2 subunit. A nucleic acid sequence encoding the protein portion is transformed into a prokaryotic host cell. 1. (canceled)2. A fusion protein comprising at least a portion of a flagellin protein that initiates an intracellular signal transduction pathway for a Toll-like Receptor and at least a portion of at least one an influenza viral antigen inserted into a loop of a domain 3 of the flagellin protein.3. The fusion protein of claim 2 , wherein the fusion protein is incorporated into a liposome.4. The fusion protein of claim 2 , wherein the fusion protein is attached to a support.5. The fusion protein of claim 4 , wherein the support is a polymer bead.6. The fusion protein of claim 4 , wherein the support is a virus.7. The fusion protein of claim 4 , wherein the support is a nucleic acid.8. The fusion protein of claim 4 , wherein the support is an adjuvant.9Salmonella typhimuriumE. coliSalmonella muenchenYersiniaP. aeruginosaListeria monocytogenes. The fusion protein of claim 2 , wherein the flagellin protein includes at least one member selected from the group consisting of a flagellin protein claim 2 , an flagellin protein claim 2 , a flagellin protein claim 2 , a flagellin protein claim 2 , a flagellin protein and a flagellin protein.10Salmonella typhimurium. The fusion protein of claim 9 , wherein the flagellin protein is the flagellin protein.11Salmonella typhimurium. The fusion ...

Подробнее
Номер записи: 80
09-07-2020 дата публикации

Influenza virus reassortment

Номер: US20200215184A1
Автор: Peter Mason, Philip Dormitzer, Pirada Suphaphiphat, Raul Gomila
Принадлежит: Seqirus UK Ltd, Synthetic Genomics Inc

New influenza donor strains for the production of reassortant influenza B viruses are provided.

Подробнее
Номер записи: 81
18-08-2016 дата публикации

Process For Stabilizing An Adjuvant Containing Vaccine Composition

Номер: US20160235831A1
Автор: Chouvenc Pierre, Françon Alain
Принадлежит: Sanofi Pasteur SA

The present invention relates to a process for stabilizing an adjuvant containing vaccine composition, an adjuvanted vaccine composition in dry form and in particular a process for stabilizing an influenza vaccine composition, particularly an adjuvanted influenza vaccine composition in dry form. 1C. difficile. A stabilized dry vaccine composition comprising micropellets or particles , wherein the micropellets or particles are prilled micropellets or particles with a diameter from about 200 μm to about 1500 μm , wherein the micropellets or particles are obtained by a process comprising ,{'i': 'C. difficile', 'a) diluting a liquid bulk antigen composition comprising a protein antigen or an antigenic preparation from with an aqueous solution comprising a carbohydrate, a sugar alcohol, or a mixture thereof in order to obtain a diluted vaccine composition solution wherein the concentration of the carbohydrate, sugar alcohol, or mixture thereof is from 2% (w/v) to the limit of solubility,'}b) prilling the diluted vaccine composition solution to form calibrated droplets of the vaccine having a diameter of approximately from about 200 μm to about 1500 μm,c) subjecting the droplets of the vaccine to freezing to form frozen spherical micropellets or particles of the vaccine, andd) drying the frozen spherical micropellets or particles of the vaccine to form dry spherical micropellets or particles of the vaccine having a diameter from about 200 μm to about 1500 μm.2. The composition as claimed in claim 1 , wherein each micropellet or particle comprises one or more antigens from only one pathogen.3. The composition as claimed in claim 1 , wherein each micropellet or particle comprises one or more antigens from one or more different pathogens.4. The composition as claimed in further comprising an adjuvant.5. The composition of claim 4 , wherein the adjuvant is contained in separate dry spherical micropellets or particles.6. A vaccine kit comprising a first container containing a ...

Подробнее
Номер записи: 82
18-08-2016 дата публикации

INFLUENZA VACCINES WITH REDUCED AMOUNTS OF SQUALENE

Номер: US20160235835A1
Автор: "OHagan Derek", CONTORNI Mario, Groth Nicola
Принадлежит: Seqirus UK Limited

Influenza vaccines include hemagglutinin from at least one influenza A virus strain and at least one influenza B virus strain. They also include an oil-in-water emulsion adjuvant with submicron oil droplets, comprising squalene. In some embodiments the hemagglutinin concentration is >12 μg/ml per strain. In some embodiments the squalene concentration is <19 mg/ml. In some embodiments the vaccine is mercury-free. In some embodiments the vaccine has a unit dose volume between 0.2-0.3 mL. In some embodiments the squalene concentration is 9.75 mg/mL or 4.88 mg/mL. In some embodiments the vaccine includes antigens from two influenza A virus strains and two influenza B virus strains. 123-. (canceled)24. An influenza virus vaccine composition in unit dosage form wherein the unit dose volume is between 0.2-0.3 mL , wherein the vaccine composition comprises: (i) at least one influenza A virus strain hemagglutinin and at least one influenza B virus strain hemagglutinin; and (ii) an oil-in-water emulsion adjuvant with submicron oil droplets , comprising squalene , where the concentration of squalene in the vaccine is ≦19 mg/ml.25. The vaccine composition of which includes at least two influenza A virus strain hemagglutinins.26. The vaccine composition of claim 25 , wherein the influenza A virus strain hemagglutinins are an H1 subtype and an H3 subtype.27. The vaccine composition of which includes a single influenza B virus strain hemagglutinin claim 24 , which B virus strain is a B/Victoria/2/87-like strain or a B/Yamagata/16/88-like strain.28. The vaccine composition of which includes two influenza A virus strain hemagglutinins and two influenza B virus strain hemagglutinins.29. The vaccine composition of comprising: (i) a H1N1 influenza A virus strain hemagglutinin; (ii) a H3N2 influenza A virus strain hemagglutinin; (iii) a B/Victoria/2/87-like influenza B virus strain hemagglutinin; and (iv) B/Yamagata/16/88-like influenza B virus strain hemagglutinin.30. The vaccine ...

Подробнее
Номер записи: 83
03-09-2015 дата публикации

MDCK-DERIVED CELL LINES ADAPTED TO SERUM-FREE CULTURE AND SUSPENSION CULTURE AND METHOD FOR PREPARING VACCINE VIRUS USING THE CELLS

Номер: US20150247128A1
Автор: Kim Hun, Kim Yun-Hee, Lee Bong-Yong, Lee Kun Se, Lee Su-Jeen, Park Mahnhoon, Park Yong Wook
Принадлежит:

Disclosed is a Madin-Darby canine kidney (MDCK)-derived cell line. The MDCK-derived cell line is derived from MDCK cells deposited under accession number ATCC CCL-34. The MDCK-derived cell line can be prepared by serum-free culture and suspension culture. Preferably, the MDCK-derived cell line has low or no tumorigenicity. The MDCK-derived cell line is preferably selected from MDCK Sky1023, MDCK Sky10234 and MDCK Sky3851. Further disclosed are a culture method for growing the MDCK-derived cells and a method for producing a vaccine virus using the MDCK-derived cells. 1. A Madin-Darby canine kidney (MDCK)-derived cell line that is derived from MDCK cells deposited under accession number ATCC CCL-34 , does not require serum for cell growth and is prepared by suspension culture without the need to be attached to carriers.24-. (canceled)5. The MDCK-derived cell line according to claim 1 , wherein the MDCK-derived cell line has low or no tumorigenicity as compared to the original MDCK cell line.68-. (canceled)9. The MDCK-derived cell line according to claim 1 , wherein the MDCK-derived cell line is MDCK Sky1023 (DSM ACC3112) claim 1 , MDCK Sky1234 (DSM ACC3114) or MDCK Sky3851 (DSM ACC3113).10. A method for producing a vaccine virus using the MDCK-derived cell line according to .11. The method according to claim 10 , wherein the virus is selected from the group consisting of influenza viruses claim 10 , measles viruses claim 10 , Japanese encephalitis viruses claim 10 , mumps viruses claim 10 , rubella viruses claim 10 , polio viruses claim 10 , HSV-1 claim 10 , HSV-2 claim 10 , rabies viruses claim 10 , RS viruses claim 10 , reovirus type 3 claim 10 , yellow fever virus claim 10 , parvoviruses claim 10 , coxsackie viruses claim 10 , adenovirus types 1 to 47 claim 10 , Lassa viruses and vacciniaviruses.12. The method according to claim 11 , wherein the virus is an influenza virus.13. A method for producing an influenza virus from a cell culture claim 11 , the method ...

Подробнее
Номер записи: 84
13-11-2014 дата публикации

Identification and Attenuation of the Immunosuppressive Domains in Fusion Proteins of Enveloped RNA Viruses

Номер: US20140335117A1
Автор: Bahrami Shervin, RYTTERGAARD DUCH Mogens
Принадлежит:

The present invention relates to enveloped RNA viruses. The invention in particular relates to the generation of superior antigens for mounting an immune response by first identifying then mutating the immunosuppressive domains in fusion proteins of enveloped RNA viruses resulting in decreased immunosuppressive properties of viral envelope proteins from the viruses. 166.-. (canceled)67. A peptide providing immunosuppressive properties , said peptide comprising an amino acid sequence selected from the sequences shown in Table 1 or selected from SEQ ID NOS:1-200.681. The peptide according to claim comprising the amino acid sequence of an immunosuppressive domain.69. A peptide having the amino acid sequence of an immunosuppressive domain , said peptide identified by a method for identifying an immunosuppressive domain in a fusion protein of an enveloped RNA virus having a lipid membrane , said method comprising:a) identifying at least one well-conserved domain among the group consisting of the membrane-associated domains of the fusion protein and the surface-associated domains of the fusion protein;b) providing at least one peptide with the sequence of said identified at least one well-conserved domain;c) optionally dimerizing or multimerizing said at least one peptide; andd) testing said at least one peptide or said at least one optionally dimerized or multimerized peptide for immunosuppressive activity.70. The peptide according to claim 69 , wherein said at least one peptide is dimerized or multimerized.713. The peptide according to claim claim 69 , wherein the identification of said at least one well-conserved domain is performed using the group consisting of the surface-associated domains of the fusion protein in one or more different conformations of the fusion protein undergoing fusion.72. A mutated peptide providing reduced immunosuppressive properties claim 69 , said mutated peptide comprising a mutated sequence selected from SEQ ID NOS:201-203 or a variant of ...

Подробнее
Номер записи: 85
20-11-2014 дата публикации

Attenuated negative strand viruses with altered interferon antagonist activity for use as vaccines and pharmaceuticals

Номер: US20140341948A1
Автор: Adolfo Garcia-Sastre, Peter Palese, Thomas Muster
Принадлежит: ICAHN SCHOOL OF MEDICINE AT MOUNT SINAI

The present invention relates, in general, to attenuated negative-strand RNA viruses having an impaired ability to antagonize the cellular interferon (IFN) response, and the use of such attenuated viruses in vaccine and pharmaceutical formulations. The invention also relates to the development and use of IFN-deficient systems for selection of such attenuated viruses. In particular, the invention relates to attenuated influenza viruses having modifications to the NS1 gene that diminish or eliminate the ability of the NS1 gene product to antagonize the cellular IFN response. The mutant viruses replicate in vivo but demonstrate reduced pathogenicity, and therefore are well suited for live virus vaccines, and pharmaceutical formulations.

Подробнее
Номер записи: 86
30-09-2021 дата публикации

Stimulator of interferon genes (sting) ligands and uses thereof

Номер: US20210299250A1
Автор: Carlo Pietrasanta, David J. Dowling, Francesco Borriello, Ofer Levy
Принадлежит: Childrens Medical Center Corp

Provided herein are Stimulator of Interferon Genes (STING) ligand for use in enhancing immune response and/or as adjuvants in vaccines. In some embodiments, STING ligand is used alone or in combination with Alum in an adjuventation system for early life immunization.

Подробнее
Номер записи: 87
15-08-2019 дата публикации

NOVEL SYNTHETIC ANTICANCER, ANTIFUNGAL, AND ANTIBACTERIAL VACCINES

Номер: US20190247495A1
Автор: Burgula Srinivas, Guo Zhongwu, Liao Guochao, Mondal Mohabul, ZHOU Zhifang
Принадлежит:

Described herein are compounds for use in vaccine compositions which contain natural or synthetic carbohydrate antigens. Such vaccines may be highly immunologically active due to the conjugation with an immune-stimulating protein or with a monophosphorylated lipid A derivative, and may be self-adjuvanting due to the presence of a monophosphorylated lipid A derivative. Treatments for cancer and fungal and bacterial infections are described herein. 140-. (canceled)42. The compound of claim 41 , wherein the oligosialic acid chain comprises α-2 claim 41 ,9-oligosialic acid.43. The compound of claim 41 , wherein the oligosialic acid chain comprises α-2 claim 41 ,9-disialic acid.44. The compound of claim 41 , wherein the oligosialic acid chain comprises α-2 claim 41 ,9-trisialic acid.45. The compound of claim 41 , wherein the oligosialic acid chain comprises α-2 claim 41 ,9-tetrasialic acid.46. The compound of claim 41 , wherein the oligosialic acid chain comprises α-2 claim 41 ,9-pentasialic acid.47. The compound of claim 41 , wherein M comprises one molecule of a monophosphorylated lipid A.48. The compound of claim 41 , wherein M comprises two molecules of a monophosphorylated lipid A.49. The compound of claim 41 , wherein the monophosphorylated lipid A is synthetic.50. The compound of claim 41 , wherein M is a carrier protein selected from the group consisting of keyhole limpet hemocyanin claim 41 , human serum albumin claim 41 , tetanus toxoid claim 41 , diphtheria toxin cross-reacting material 197 claim 41 , and diphtheria toxin.52. The compound of claim 41 , wherein X and G are each amide and Y and F are each carbonyl.53. A vaccine comprising a compound of claim 41 , wherein the vaccine is an antibacterial vaccine.54. The vaccine of claim 53 , wherein the vaccine is self-adjuvanting.55. The vaccine of claim 53 , wherein the vaccine is synthetic.56. The vaccine of claim 53 , wherein the vaccine prevents or treats meningitis.57. A method of using a compound of in a ...

Подробнее
Номер записи: 88
14-09-2017 дата публикации

INFLUENZA B VIRUS REPLICATION FOR VACCINE DEVELOPMENT

Номер: US20170258888A1
Автор: Kawaoka Yoshihiro, Neumann Gabriele, Ping Jihui
Принадлежит:

The invention provides a composition useful to prepare high titer influenza B viruses, e.g., in the absence of helper virus, which includes internal genes from an influenza B virus vaccine strain or isolate, e.g., one that is safe in humans, for instance, one that does not result in significant disease, that confer enhanced growth in cells in culture, such as MDCK cells, or in eggs. 1. An isolated recombinant influenza B virus having PA , PB1 , PB2 , NP , NS , and M viral segments , a heterologous or chimeric influenza virus NA viral segment , and a heterologous or chimeric HA viral segment , wherein the NS viral segment encodes a NS1 polypeptide having a residue other than Y at position 42 , other than M at position 117 , other than K at position 176 , and/or other than S at position 252 , and/or has a nucleotide other than a at nucleotide position 39 or a nucleotide insertion after position 38 , or any combination thereof; or wherein the M viral segment encodes a M1 polypeptide having a residue other than G at position 34 , other than D at position 54 , other than R at position 77 , other than M at position 86 , or other than I at position 97 , or any combination thereof; or wherein the M viral segment encodes a BM2 polypeptide having a residue other than H at position 58 , other than R at position 80 , other than H at position 27 , or other than G at position 26 , or any combination thereof; or wherein the NP viral segment encodes a NP polypeptide having a residue other than A at position 28 , other than P at position 40 , other than P at position 51 , other than E at position 52 , other than S at position 57 , other than M at position 204 , and/or other than P at position 343 , and/or has a nucleotide other than g at nucleotide position 1795 or has a nucleotide other than c at nucleotide position 500 , or any combination thereof; or the PA viral segment has a residue other than Y at position 387 , other than V at position 434 , other than D at position 494 , and ...

Подробнее
Номер записи: 89
06-08-2020 дата публикации

HEADLESS HEMAGGLUTIN INFLUENZA VACCINE

Номер: US20200247852A1
Автор: DENG Lei, Wang Baozhong
Принадлежит:

Disclosed are universal influenza based on a truncated influenza hemagglutin (HA) protein lacking a head domain (hrHA). Also disclosed is a composition comprising a nanoparticle coated with a disclosed hrHA polypeptide. Also disclosed is a composition comprising a virus like particle (VLP) expressing on its surface a disclosed hrHA polypeptide. 13-. (canceled)4. A composition comprising a virus like particle (VLP) expressing on its surface a polypeptide comprising a truncated influenza hemagglutin (HA) protein lacking a head domain , wherein the polypeptide lacks the HA transmembrane and/or cytoplasmic domains of HA , and wherein the polypeptide comprises a heterologous membrane-anchoring sequence.56-. (canceled)7. The composition of claim 4 , wherein the heterologous membrane-anchoring sequence comprises a glycosylphosphatidylinositol (GPI) membrane-anchoring sequence.8. The composition of claim 4 , where the polypeptide lacks at least the amino acids corresponding to residues 65 to 320 of amino acid sequence SEQ ID NO:15.9. The composition of claim 8 , wherein the polypeptide lacks at least the amino acids corresponding to residues 62 to 322 of SEQ ID NO:15.10. The composition of claim 4 , wherein the head domain is replaced by a linker 3 to 5 amino acids in length that cannot form a fixed secondary structure.11. The composition of claim 10 , wherein the linker comprises 3 to 5 amino acids selected from glycine claim 10 , alanine claim 10 , and serine.12. The composition of claim 11 , wherein the linker is selected from the group consisting of GGGG (SEQ ID NO:16) claim 11 , GGGGG (SEQ ID NO:17) claim 11 , and GGGGC (SEQ ID NO:18) claim 11 , and GGGSS (SEQ ID NO:19).1314-. (canceled)15. A nanoparticle formed by crosslinking a fusion protein with a crosslinking agent and/or desolvating the fusion protein with a desolvating agent claim 11 , wherein the fusion protein comprises a series of 2 to 8 influenza virus matrix protein 2 extracellular (M2e) domains linked to a ...

Подробнее
Номер записи: 90
22-09-2016 дата публикации

GENERIC ASSAYS FOR DETECTION OF INFLUENZA VIRUSES

Номер: US20160273057A1
Автор: Roth Bernhard
Принадлежит: NOVARTIS AG

The invention relates to generic methods for the detection and quantification of influenza viruses. These may use a reverse transcription (RT-PCR) real time (q-PCR) assay which amplifies a conserved region within influenza A or B strains The assays allow the quantification of influenza virus RNA molecules or whole virus particles, irrespective of the particular virus strain (e.g. human, avian, swine flu). The methods are particularly applicable as diagnostic assays or in the monitoring of vaccine production processes. 1. (canceled)2. The method according to claim 7 , wherein the conserved region codes partly or completely for the M protein.3. The method according to claim 7 , wherein the method provides an amplicon comprising SEQ ID NO 3 or SEQ ID NO 9.4. The method according to wherein the amplification comprises a one-step RT-qPCR.5. The method according to claim 4 , wherein at least one primer or probe used in the one-step RT-qPCR is selected from SEQ ID NOs 1-11.6. (canceled)7. A method for quantifying the amount of intact virus particles in a sample comprising the following steps:a) the free virus RNA is removed from the sampleb) a method for detecting remaining influenza virus RNA in the sample is applied comprising amplification of a conserved region within the influenza genome,c) the signal generated in part (b) is compared to the signal generated by a standard RNA, andd) the amount of intact virus particles is quantified.89- (canceled)10. A method for production of influenza virus comprising a fermentation step of a cell culture based influenza virus production process claim 7 , wherein the amount of influenza virus particle is quantified during the fermentation step using the method of to determine the optimal time for harvesting the influenza viruses.11. A method for the cell culture-based production of an influenza vaccine claim 7 , comprising the following steps:propagating cells in a fermentation vessel;adding seed influenza viruses;{'claim-ref': {'@ ...

Подробнее
Номер записи: 91
13-08-2020 дата публикации

IMMUNOGENIC COMPOSITIONS AGAINST INFLUENZA

Номер: US20200254085A1
Автор: BILSEL Pamuk, HATTA Yasuko, Moser Michael J.
Принадлежит: FluGen, Inc.

Disclosed herein are compositions and methods related to mutant viruses, and in particular, mutant influenza viruses. The mutant viruses disclosed herein include mutant M2 sequences, mutant BM2 sequences, and are useful in immunogenic compositions, e.g., as a quadrivalent vaccines. Also disclosed herein are methods, compositions and cells for propagating the viral mutants, and methods, devices and compositions related to vaccination. 1. An immunogenic composition , wherein the composition is a multivalent composition comprising recombinant viruses from at least two influenza strains.2. The immunogenic composition of claim 1 , wherein the multivalent composition comprises:a) at least one engineered attenuated influenza A M2-deficient recombinant virus, wherein the engineered influenza A virus comprises a mutant M2 gene comprising SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3; andb) at least one engineered attenuated influenza BM2-deficient recombinant virus, wherein the engineered influenza B virus comprises a mutant BM2 gene comprising SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, or SEQ ID NO: 11.3. The immunogenic composition of claim 2 , wherein the at least one influenza A virus is chosen from the group of H1N1 and H3N2 subtypes claim 2 , and the at least one influenza B virus is chosen from the group of B/Yamagata and B/Victoria lineages.4. The immunogenic composition of claim 1 , wherein the multivalent composition comprises recombinant viruses selected from the group consisting of:a) two engineered attenuated influenza A M2-deficient viruses chosen from the group of H1N1 and H3N2 subtypes, wherein the A M2-deficient viruses comprise a mutant M2 gene comprising SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3, and two engineered attenuated influenza BM2-deficient viruses chosen from the group of B/Yamagata and B/Victoria lineages, wherein the BM2-deficient viruses comprise a mutant BM2 gene comprising SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, ...

Подробнее
Номер записи: 92
29-09-2016 дата публикации

ATTENUATED NEGATIVE STRAND VIRUSES WITH ALTERED INTERFERON ANTAGONIST ACTIVITY FOR USE AS VACCINES AND PHARMACEUTICALS

Номер: US20160279227A1
Автор: Garcia-Sastre Adolfo, Muster Thomas, Palese Peter
Принадлежит: ICAHN SCHOOL OF MEDICINE AT MOUNT SINAI

The present invention relates, in general, to attenuated negative-strand RNA viruses having an impaired ability to antagonize the cellular interferon (IFN) response, and the use of such attenuated viruses in vaccine and pharmaceutical formulations. The invention also relates to the development and use of IFN-deficient systems for selection of such attenuated viruses. 1. A vaccine formulation , comprising: an attenuated negative strand RNA virus having an interferon antagonist phenotype that (a) is responsible for attenuation , and (b) permits the attenuated virus to grow to higher titers in interferon-deficient host systems as compared to interferon-competent host systems , when propagated under the same conditions; and a physiologically acceptable excipient.2. The vaccine formulation of in which the attenuated virus is selected from naturally occurring viruses claim 1 , mutagenized viruses or reassortants.3. The vaccine formulation of in which the attenuated virus is selected from genetically engineered mutants.4. The vaccine formulation of in which the attenuated virus is a chimeric virus that expresses an epitope of a foreign pathogen.5. The vaccine formulation of claim 3 , claim 3 , or in which the attenuated virus is an influenza virus.6. A vaccine formulation comprising an attenuated influenza virus that has a mutation in the NS1 gene responsible for the attenuated phenotype claim 3 , and a physiologically acceptable excipient.7. The vaccine formulation of claim 3 , claim 3 , or in which the attenuated virus is a respiratory syncytial virus.8. The vaccine formulation of claim 3 , claim 3 , or in which the attenuated virus is a parainfluenza virus.9. The vaccine formulation of claim 3 , claim 3 , or in which the attenuated virus is a vesicular stomatitis virus.10. The vaccine formulation of claim 3 , claim 3 , or in which the attenuated virus is Newcastle disease virus.11. The vaccine formulation of in which the interferon-deficient host system is STAT1 ...

Подробнее
Номер записи: 93
20-08-2020 дата публикации

GENERATION OF INFECTIOUS INFLUENZA VIRUSES FROM VIRUS-LIKE PARTICLES

Номер: US20200263142A1
Автор: Kawaoka Yoshihiro, Neumann Gabriele
Принадлежит:

Compositions and methods to prepare influenza virus-like particles (VLPs) are provided. 1. A set of isolated host cells , comprising:a first host cell for producing a first VLP with at least one and up to eight influenza A or B virus segments comprising:one or more vectors which include at least one and up to eight transcription cassettes for production of at least one and up to eight viral segments from the genome of influenza A virus selected from:a transcription cassette comprising a promoter operably linked to an influenza virus PA DNA;a transcription cassette comprising a promoter operably linked to an influenza virus PB1 DNA;a transcription cassette comprising a promoter operably linked to an influenza virus PB2 DNA;a transcription cassette comprising a promoter operably linked to an influenza virus NP DNA;a transcription cassette comprising a promoter operably linked to an influenza virus M DNA;a transcription cassette comprising a promoter operably linked to an influenza virus NS DNA;a transcription cassette comprising a promoter operably linked to an influenza virus NA DNA; ora transcription cassette comprising a promoter operably linked to an influenza virus HA DNA or a non-influenza host cell binding protein DNA; orone or more vectors which include at least one and up to eight transcription cassettes for production of at least one and up to eight viral segments from the genome of influenza B virus selected from:a transcription cassette comprising a promoter operably linked to an influenza virus PA DNA;a transcription cassette comprising a promoter operably linked to an influenza virus PB1 DNA;a transcription cassette comprising a promoter operably linked to an influenza virus PB2 DNA;a transcription cassette comprising a promoter operably linked to an influenza virus NP DNA;a transcription cassette comprising a promoter operably linked to an influenza virus M DNA;a transcription cassette comprising a promoter operably linked to an influenza virus NS DNA;a ...

Подробнее
Номер записи: 94
18-12-2014 дата публикации

COMPOSITIONS AND METHODS FOR TREATING INFLUENZA

Номер: US20140370041A1
Автор: Anderson David E., Diaz-Mitoma Francisco, Ogrel Andrei, Torres Jose V.
Принадлежит: VARIATION BIOTECHNOLOGIES, INC.

The present application provides compositions and methods useful for treating influenza. As described herein, the compositions and methods are based on the development of peptides and peptide combinations which exhibit immunogenic properties against influenza. In some embodiments, the peptide combinations induce a protective response against multiple strains of influenza, e.g., seasonal strains of influenza or even the new pandemic influenza A (H1N1) virus of swine origin. 1. An immunogenic composition comprising:a first peptide comprising a region having at least 80% homology with 20-100 contiguous amino acids of SEQ ID NO. 16, wherein the first peptide includes fewer than 100 contiguous amino acids from a type A influenza hemagglutinin protein;a second peptide comprising an amino acid sequence of SEQ ID NO. 17; anda third peptide comprising a region having at least 80% homology with at least 20 contiguous amino acids from positions 2-49 or 68-121 of SEQ ID NO. 18, wherein the third peptide includes fewer than 100 contiguous amino acids from a type B influenza hemagglutinin protein.2. (canceled)3. (canceled)4. (canceled)5. (canceled)6. (canceled)7. (canceled)8. (canceled)9. (canceled)10. (canceled)11. (canceled)12. (canceled)13. (canceled)14. The composition of claim 1 , wherein the first peptide comprises at least 40 contiguous amino acids of SEQ ID NO. 6.15. (canceled)16. (canceled)17. (canceled)18. (canceled)19. The composition of claim 1 , wherein the first peptide comprises amino acids 1-88 of SEQ ID NO. 6.20. The composition of claim 1 , wherein the first peptide comprises fewer than 100 amino acids.21. (canceled)22. (canceled)23. The composition of claim 1 , wherein the second peptide comprises an amino acid sequence of SEQ ID NO. 11.24. (canceled)25. (canceled)26. The composition of claim 1 , wherein the composition comprises 2different second peptides each comprising a different amino acid sequence of SEQ ID NO. 11 claim 1 , where n=1-4.2726. The ...

Подробнее
Номер записи: 95
19-09-2019 дата публикации

REVERSE GENETICS USING NON-ENDOGENOUS POL I PROMOTERS

Номер: US20190284575A1
Автор: Crotta Stefania, Dormitzer Philip, Franti Michael, Keiner Bjoern, Mason Peter, Suphaphiphat Pirada
Принадлежит:

Expression of a transgene is driven in a host cell using a pol I promoter which is not endogenous to an organism from the same taxonomic order from which the host cell is derived. 1. A host cell comprising at least one expression construct encoding a viral RNA molecule , wherein expression of the viral RNA molecule from the construct is controlled by a pol I promoter which is not endogenous to the host cell's taxonomic order.2. A cell having at least one endogenous pol I promoter which control(s) expression of endogenous rRNA and at least one non-endogenous pol I promoter which control(s) expression of a viral RNA or the complement thereof.3. A method for producing a recombinant virus claim 1 , comprising a step of growing the cell of under conditions where the viral RNA molecule is expressed in order to produce virus.4. A method of preparing a virus claim 3 , comprising steps of: (i) producing a recombinant virus by the method of ; (ii) infecting a culture host with the virus obtained in step (i); (iii) culturing the host from step (ii) to produce further virus; and (iv) purifying virus obtained in step (iii).5. A method for preparing a vaccine claim 4 , comprising steps of (a) preparing virus by the method of and (b) preparing vaccine from the virus.6. The cell of claim 1 , wherein the pol I promoter is a primate pol I promoter and the cell is a non-primate cell.7. The cell of claim 1 , wherein the pol I promoter is a non-canine pol I promoter and the cell is a canine cell.8. The cell of wherein the pol I promoter is a human pol I promoter and the cell is a canine cell.9. The cell of wherein the cell is an MDCK cell.10. The cell of wherein the MDCK cell is cell line MDCK 33016 (DSM ACC2219).11. The cell of claim 1 , wherein the cell includes at least one bidirectional expression construct12. The cell of claim 1 , wherein the expression construct is an expression vector or a linear expression construct.13. The cell of claim 1 , wherein the virus is a segmented ...

Подробнее
Номер записи: 96
10-09-2020 дата публикации

H5 AVIAN INFLUENZA VACCINE STRAIN WHICH DIFFERENTIATES INFECTED FROM VACCINATED ANIMALS, PREPARATION METHOD THEREFOR, AND APPLICATION

Номер: US20200282044A1
Автор: Song Jiasheng
Принадлежит:

Provided are an H5 avian influenza vaccine strain which differentiates infected from vaccinated animals, a preparation method therefor, and an application. The vaccine strain uses an NA protein of influenza B as a label, and has application value and public health significance for the prevention, control and decontamination of H5 avian influenza. 1. An application of a label gene sequence in the preparation of an H5 avian influenza vaccine strain which differentiates influenza A virus infection from vaccination , the label gene sequence comprising a DNA sequence coding an influenza B virus NA protein extracellular region amino acid sequence , or comprising a DNA sequence coding an amino acid sequence having at least 90% homology , at least 92% homology , at least 95% homology , or at least 98% homology with the extracellular region amino acid sequence;alternatively, the label gene sequence comprising a DNA sequence coding the extracellular region amino acid sequence in influenza B virus NA gene, or comprising a sequence having at least 90% homology, at least 92% homology, at least 95% homology, or at least 98% homology with the DNA sequence;alternatively, the label gene sequence is a DNA sequence coding influenza B virus NA protein, or a DNA sequence coding an amino acid sequence having at least 90% homology, at least 92% homology, at least 95% homology, or at least 98% homology with the NA protein amino acid sequence;alternatively, the label gene sequence is a DNA sequence of influenza B virus NA gene, or a sequence having at least 90% homology, at least 92% homology, at least 95% homology, or at least 98% homology with the DNA sequence.2. The application of claim 1 , wherein the H5 avian influenza vaccine strain further comprises an H5 subtype HA gene or a mutated H5 subtype HA gene; the mutated H5 subtype HA gene is capable of mutating the amino acid sequence RERRRKRGLF in the wild type HA protein into RETRGLF.3. The application of claim 1 , wherein the influenza ...

Подробнее
Номер записи: 97
10-09-2020 дата публикации

INFLUENZA B VIRUS MUTANTS AND USES THEREFOR

Номер: US20200282045A1
Автор: BILSEL Pamuk, HATTA Yasuko, Moser Michael J.
Принадлежит: FluGen, Inc.

Disclosed herein are compositions and methods related to mutant viruses, and in particular, mutant influenza viruses. The mutant viruses disclosed herein include a mutant BM2 sequence, and are useful in immunogenic compositions, e.g., as vaccines. Also disclosed herein are methods, compositions and cells for propagating the viral mutants, and methods, devices and compositions related to vaccination. 1. A recombinant influenza B virus having a mutant BM2 gene comprising SEQ ID NO: 1 , SEQ ID NO: 2 , SEQ ID NO: 3 , SEQ ID NO: 4 , or SEQ ID NO: 5.2. The recombinant influenza B virus of claim 1 , wherein the mutation in the BM2 gene results in failure of the virus to express the BM2 protein claim 1 , or causes the virus to express a truncated BM2 protein.3. The recombinant influenza B virus of or claim 1 , wherein the mutant BM2 gene does not revert to wild-type or to a non-wild-type sequence encoding a functional BM2 protein for at least 10 passages in an in vitro host cell system claim 1 , wherein the host cell is modified to produce a functional version of the mutant gene claim 1 , thereby providing the gene product to the virus in trans.4. The recombinant virus of any one of - claim 1 , wherein the virus elicits an immune response in a mammal infected with the virus.5. The recombinant virus of any one of - claim 1 , wherein the virus is non-pathogenic to a mammal infected with the virus.6. The recombinant virus of claim 3 , wherein the in vitro cell system comprises Madin-Darby Canine Kidney (MDCK) cells or Vero cells.7. A composition comprising: a recombinant influenza B virus having a mutant BM2 gene comprising SEQ ID NO: 1 claim 3 , SEQ ID NO: 2 claim 3 , SEQ ID NO: 3 claim 3 , SEQ ID NO: 4 claim 3 , or SEQ ID NO: 5.8. The composition of claim 7 , wherein the mutation of the BM2 gene results in failure of the virus to express the BM2 protein claim 7 , or causes the virus to express a truncated BM2 protein.9. The composition of or claim 7 , wherein the virus ...

Подробнее
Номер записи: 98
20-10-2016 дата публикации

PROCESS FOR PREPARING INFLUENZA VACCINES

Номер: US20160304586A1
Автор: PAGANY Maria Anna Rosalie, VAN OOIJ Martinus J.M., WALRAVEN-BERKHOFF Eufemia G.M.
Принадлежит: Crucell Holland B.V.

This disclosure provides a novel process for testing an influenza virus preparation for the presence of extraneous agents. The disclosure further provides a process for preparing an influenza vaccine. 1. A method for testing for the presence of extraneous agent(s) in a composition comprising influenza virus , the method comprising:neutralizing the influenza virus in said composition utilizing one or more influenza virus-neutralizing monoclonal antibodies, and/or antigen-binding fragments thereof that neutralize influenza virus.2. The method according to claim 1 , wherein the one or more influenza virus-neutralizing antibodies are selected from the group consisting of:(i) an antibody comprising a heavy chain CDR1 region comprising SEQ ID NO: 1, a heavy chain CDR2 region comprising SEQ ID NO: 2 and a heavy chain CDR3 region comprising SEQ ID NO: 3; and a light chain CDR1 region comprising SEQ ID NO:4, a light chain CDR2 region comprising SEQ ID NO: 5 and a light chain CDR3 region comprising SEQ ID NO: 6;(ii) an antibody comprising a heavy chain CDR1 region comprising SEQ ID NO:7, a heavy chain CDR2 region comprising SEQ ID NO: 8 and a heavy chain CDR3 region comprising SEQ ID NO: 9; and a light chain CDR1 region comprising SEQ ID NO:10, a light chain CDR2 region comprising SEQ ID NO: 11 and a light chain CDR3 region comprising SEQ ID NO: 12; and(iii) an antibody comprising a heavy chain CDR1 region comprising SEQ ID NO:13, a heavy chain CDR2 region comprising SEQ ID NO: 14 and a heavy chain CDR3 region comprising SEQ ID NO: 15; and a light chain CDR1 region comprising SEQ ID NO:16, a light chain CDR2 region comprising SEQ ID NO: 17 and a light chain CDR3 region comprising SEQ ID NO: 18.3. The method according to claim 1 , wherein the one or more influenza virus-neutralizing antibodies are selected from the group consisting of:(i) an antibody comprising a heavy chain variable region comprising the amino acids 1-120 of SEQ ID NO: 20 and a light chain variable region ...

Подробнее
Номер записи: 99
26-10-2017 дата публикации

VACCINATION OF IMMUNOCOMPROMISED SUBJECTS

Номер: US20170304429A1
Автор: BLACK Steven, Del Giudice Giuseppe, NICOLAY Uwe, Rappuoli Rino
Принадлежит:

Disclosed herein are methods for enhancing immune responses to a vaccine in immunocompromised individuals, including those receiving a statin therapy. Related products are also provided. 1: A method for enhancing an immune response in a subject comprising administering a vaccine , wherein the vaccine comprises:(a) an adjuvant;(b) a high-dose antigen; ora combination of (a) and (b); andwherein the subject is under the age of 65 and on a statin therapy.2: The method of claim 1 , wherein the adjuvant is an aluminum salt adjuvant or an oil-in-water emulsion adjuvant.3: The method of claim 2 , wherein the oil-in-water emulsion adjuvant comprises squalene.4: The method of claim 2 , wherein the oil-in-water adjuvant comprises squalene claim 2 , polysorbate 80 claim 2 , and sorbitan trioleate.5: The method of claim 1 , wherein the vaccine comprises between a ⅛ and a ten-fold the amount of a standard dose antigen.6: The method of claim 1 , wherein the vaccine is an influenza vaccine.7: The method of claim 5 , wherein the influenza vaccine comprises between about 30 μg and about 150 μg of antigen per strain.8: The method of claim 6 , wherein the influenza vaccine comprises an H1N1 strain claim 6 , an H3N2 strain claim 6 , a B strain claim 6 , or any combination thereof.9: The method of claim 1 , wherein the vaccine does not contain an oil-in-water emulsion adjuvant.10: The method of claim 1 , wherein the subject is:a) currently on a statin therapy;b) not currently on a statin therapy but was on a statin therapy which terminated within the last 3 months; orc) not currently on a statin therapy but is scheduled to be on a statin therapy in the next 3 months.11: The method of claim 1 , wherein the subject isbetween the age of 60 and 64.12: The method of claim 1 , wherein the subject has a disease or disorder associated with impaired immunity.13: The method of claim 1 , wherein the statin therapy comprises a synthetic statin claim 1 , a non-synthetic statin claim 1 , or a ...

Подробнее
Номер записи: 100