КОМПОЗИЦИИ, СОДЕРЖАЩИЕ CpG-ОЛИГОНУКЛЕОТИДЫ И ВИРУСОПОДОБНЫЕ ЧАСТИЦЫ, ДЛЯ ПРИМЕНЕНИЯ В КАЧЕСТВЕ АДЪЮВАНТОВ

Настоящее изобретение относится к области вакцинологии, иммунологии и медицины. Предложены композиция, вакцина и способы усиления иммунологических реакций против антигенов, смешанных с вирусоподобными частицами (VLP), которые связаны с иммуностимулирующими веществами, представляющими собой неметилированный CpG-содержащий олигонуклеотид. Антигены в смеси с CpG-упакованными частицами VLP могут быть идеальными вакцинами для профилактической или терапевтической вакцинации против аллергий, опухолей, других аутомолекул и хронических вирусных заболеваний. 5 н. и 33 з.п. ф-лы, 18 ил.

Выбор раковых мутаций для создания персонализированной противораковой вакцины

Изобретение относится к области молекулярной биологии. Описан способ выбора опухолевых неоантигенов для применения в персонализированной вакцине. Определяют неоантигены в образце раковых клеток, взятом у индивидуума, где каждый неоантигенсодержится в кодирующей последовательности,содержит по меньшей мере одну мутацию в кодирующей последовательности, приводящую к изменению кодируемой аминокислотной последовательности, которое не присутствует в образце нераковых клеток указанного индивидуума, исостоит из от 9 до 40 смежных аминокислот кодирующей последовательности в образце раковых клеток. Определяют для каждого неоантигена частоты мутантных аллелей каждой из указанных мутаций в кодирующей последовательности. Определяют уровень экспрессии каждой кодирующей последовательности в образце раковых клеток или на основании базы данных экспрессии рака того же типа, что и образец раковых клеток. Предсказывают аффинность связывания неоантигенов с MHC класса I. Ранжируют неоантигены в соответствии со ...

ВАКЦИННАЯ КОМПОЗИЦИЯ

Изобретение относится к медицине, а именно к иммунологии, и может быть использовано для получения вакцинной композиции для введения в ротовую полость человека или животного. Вакцинная композиция содержит по меньшей мере мере один антиген, выделенный из объекта с инфекционным заболеванием, и по меньшей мере один агент, выбранный из группы, состоящей из агониста toll-подобного рецептора 4 (TLR4). Где агонист toll-подобного рецептора 4 (TLR4) включает по меньшей мере один агент, выбранный из группы, состоящей из липополисахарида или его соли, где липополисахарид или его соль выделены из. Использование агонистов TLR4 эффективно для индуцирования иммунного ответа слизистой в качестве адъюванта в вакцине при подъязычном введении, вызывая увеличенную продукцию IgG в сочетании инфекционным антигеном. 4 з.п. ф-лы, 13 ил., 7 табл., 18 пр.

ЛЕЧЕНИЕ ИНФЕКЦИИ, ВЫЗЫВАЕМОЙ ВИРУСОМ ПАПИЛЛОМЫ ЧЕЛОВЕКА

Изобретение относится к медицине, в частности к вирусологии, и может быть использовано при лечении инфекции, вызываемой различными типами вируса папилломы человека. Для этого пациенту вводят терапевтически эффективное количество композиции, содержащей слитый белок, включающий белок теплового шока или его иммуностимуляторный фрагмент и белок Е7 вируса папилломы человека или его антигенный фрагмент; или эффективное количество композиции, содержащей нуклеиновую кислоту, кодирующую слитый белок, включающий Hsp или его иммуностимуляторный фрагмент и белок HPV или его антигенный фрагмент. При этом, если заболевание вызвано инфекцией 1 типа HPV, белок Е7 HPV или его антигенный фрагмент происходит от 2 типа HPV, отличающегося от первого типа HPV. Способ позволяет повысить эффективность лечения за счет перекрестной реактивности при индукции иммунной реакции у пациента. 6 н. и 27 з.п. ф-лы, 4 табл.

КОМПОЗИЦИЯ ДЛЯ ЛЕЧЕНИЯ РАКА ПРЕДСТАТЕЛЬНОЙ ЖЕЛЕЗЫ

Настоящее изобретение относится к биотехнологии. Предложены применение четырех РНК, кодирующих четыре различных антигена для получения набора вакцин для лечения рака предстательной железы, и набор, включающий вакцины, каждая из которых содержит по меньшей мере одну РНК. Каждая РНК кодирует один из четырех различных антигенов, выбранных из: эпителиального антигена простаты с шестью трансмембранными доменами (STEAP), простатоспецифического антигена (PSA), простатоспецифического мембранного антигена (PSMA), антигена стволовых клеток предстательной железы (PSCA). Предложенный набор вакцин может быть использован в медицине для лечения рака предстательной железы, в частности, резистентного к неадъювантной и/или гормональной терапии, и связанных с ним заболеваний и нарушений. 2 н. и 43 з.п. ф-лы, 23 ил., 8 пр.

СПОСОБ АКТИВАЦИИ ХЕЛПЕРНЫХ Т-КЛЕТОК И КОМПОЗИЦИЯ ДЛЯ ПРИМЕНЕНИЯ В ДАННОМ СПОСОБЕ

Настоящее изобретение относится к области биотехнологии, конкретно к активации хелперных Т-клеток, которые специфичны к пептиду WT1, и может быть использовано в медицине для индукции иммунного ответа против WT1-экспрессирующей злокачественной опухоли. Способ активации хелперных Т-клеток включает приведение антиген-презентирующей клетки, положительной по меньшей мере по одной из HLA-DRB1*1501, HLA-DPB1*0901 и HLA-DPB1*0501, в контакт с пептидом WT1 с SEQ ID NO: 2, способным связываться с молекулой HLA-DRB1*1501, HLA-DPB1*0901 и HLA-DPB1*0501. Изобретение позволяет получить хелперные Т-клетки, экспрессирующие комплекс TCR-CD3, который распознает комплекс пептида WT1 и молекулы HLA, выбранной из HLA-DRB1*1501, HLA-DPB1*0901 и HLA-DPB1*0501. 4 н. и 15 з.п. ф-лы, 10 ил., 4 пр.

PCSK9 ВАКЦИНЫ

Изобретение относится к области биотехнологии, конкретно к вакцине против пропротеиновой конвертазы субтилизин-кексинового типа 9 (PCSK9), и может быть использовано в медицине для лечения или предотвращения заболеваний, связанных с PCSK9, выбранных из гиперлипидемии, гиперхолестеринемии, атеросклероза или неопластических болезней. Конъюгат варианта фрагмента PCSK9 с SEQ ID NO:1 с иммуногенным белковым носителем может быть использован в составе вакцины для усиленной индукции образования антител к PCSK9, по сравнению с конъюгатом фрагмента природного PCSK9. 4 н. и 3 з.п. ф-лы, 6 ил., 2 табл., 1 пр.

ЛЕКАРСТВЕННОЕ СРЕДСТВО

Изобретение относится к области медицины и фармацевтики и представляет собой лекарственное средство для противораковой иммунотерапии, включающее Поли-I:C или его соль, белок LAG-3 или LAG-3Ig, HSP70-производный пептид, имеющий аминокислотную последовательность, представленную SEQ ID No: 7, и GPC3-производный пептид, имеющий аминокислотную последовательность, представленную SEQ ID No: 16. Изобретение обеспечивает противораковую вакцинотерапию, эффективную в отношении широкого спектра различных типов рака. 4 з.п. ф-лы, 34 ил., 9 пр.

КОМПОЗИЦИЯ АДЪЮВАНТА, СОДЕРЖАЩАЯ ПОЛИ-ГАММА-ГЛУТАМИНОВУЮ КИСЛОТУ

Изобретение относится к области ветеринарии и касается композиции адъюванта, содержащей поли-гамма-глутаминовую кислоту. Сущность изобретения включает композицию иммуностимулятора (адъюванта), содержащую поли-гамма-глутаминовую кислоту с молекулярным весом от 1000 до 2000 кДа, иммуногенную композицию, содержащую композицию иммуностимулятора и антигенное вещество, а также способ повышения скорости продуцирования антител против антигена, включающий введение иммуногенной композиции животным. Преимущество изобретения заключается в том, что адъювант не токсичен, не имеет побочных эффектов и стимулирует образование антител с высоким титром даже при его применении с антигеном, обладающим низкой иммуногенностью. 3 н. и 5 з.п. ф-лы, 5 ил.

АКТИВНАЯ ИММУНОТЕРАПИЯ ПРОТИВ АНГИОГЕНЕЗА

... 1. Иммуногенная композиция, содержащая полипептиды VEGFR1 и их фрагменты или кодирующие их олигонуклеотиды, которую вводят в присутствии или в отсутствие фармацевтически приемлемого адъюванта. 2. Композиция по п.1, в которой антиген является аутологичным, гетерологичным или химерным. 3. Композиция по п.1, в которой антиген является мутантом указанной молекулы. 4. Композиция по п.1, в которой иммуноген получен из синтетических, рекомбинантных или естественных источников. 5. Композиция по пп.1-4, в которой иммуноген вводят в виде части плазмидных или вирусных векторов. 6. Композиция по п. 5, в которой адъювант выбирают из группы, состоящей из рекомбинантной частицы ядерного антигена гепатита В, рекомбинантной частицы ядерного антигена гепатита С, белка ОРС, белка KLH, адъюванта Фрейнда или его производных и монтанида ISA 51. 7. Иммуногенная композиция, содержащая полипептиды VEGFR1 и их фрагменты или кодирующие их олигонуклеотиды, которую вводят ковалентно или нековалентно связанной с препаратами ...

УПАКОВАННЫЕ ВИРУСОПОДОБНЫЕ ЧАСТИЦЫ, ПРЕДНАЗНАЧЕННЫЕ ДЛЯ ИСПОЛЬЗОВАНИЯ В КАЧЕСТВЕ АДЪЮВАНТОВ, СПОСОБЫ ПОЛУЧЕНИЯ УКАЗАННЫХ ЧАСТИЦ И ИХ ПРИМЕНЕНИЕ

... 1. Композиция для усиления иммунной реакции у животного, которая включает в себя (а) вирусоподобную частицу; (b) иммуностимулирующее вещество; причем указанное иммуностимулирующее вещество (b) связано с указанной вирусоподобной частицей (а); и (с) антиген, смешанный с указанной вирусоподобной частицей (а). 2. Композиция по п.1, в которой указанное иммуностимулирующее вещество является веществом, активирующим toll-подобный рецептор, или веществом, индуцирующим секрецию цитокина, причем вещество, активирующее указанный toll-подобный рецептор, предпочтительно выбирают из группы, состоящей из (а) иммуностимулирующих нуклеиновых кислот; (b) пептидогликанов; (с) липополисахаридов; (d) липотейхоновых кислот; (е) соединений имидазохинолина; (f) флагеллинов; (g) липопротеинов; (h) иммуностимулирующих органических молекул; (i) олигонуклеотидов, содержащих неметилированный CpG; (j) любых смесей по меньшей мере одного вещества по пп. (а), (b), (c), (d), (e), (f), (g), (h) и/или (i). 3. Композиция по ...

ПОЛУЧЕНИЕ КОМПЛЕКСОВ НУКЛЕИНОВЫХ КИСЛОТ И ПОПЕРЕЧНО СШИТЫХ ДИСУЛЬФИДНЫМИ СВЯЗЯМИ КАТИОННЫХ КОМПОНЕНТОВ, ПРЕДНАЗНАЧЕННЫХ ДЛЯ ТРАНСФЕКЦИИ И ИММУНОСТИМУЛЯЦИИ

... 1. Комплекс, содержащий полимерный носитель и карго-молекулу, который включает:а) в качестве носителя полимерный носитель, образованный из поперечно сшитых дисульфидными связями катионных компонентов, иб) в качестве карго-молекулы по меньшей мере одну молекулу нуклеиновой кислоты,предназначенный для применения в качестве иммуностимулирующего агента или адъюванта.2. Комплекс, содержащий полимерный носитель и карго-молекулу, предназначенный для применения в качестве иммуностимулирующего агента или адъюванта, по п.1, в котором по меньшей мере одна молекула нуклеиновой кислоты представляет собой РНК.3. Комплекс, содержащий полимерный носитель и карго-молекулу, предназначенный для применения в качестве иммуностимулирующего агента или адъюванта, по п.1 или п.2, в котором по меньшей мере одна молекула нуклеиновой кислоты представляет собой иммуностимулирующую нуклеиновую кислоту.4. Комплекс, содержащий полимерный носитель и карго-молекулу, предназначенный для применения в качестве иммуностимулирующего ...

КАНИНИЗИРОВАННЫЕ МЫШИНЫЕ АНТИТЕЛА К ЧЕЛОВЕЧЕСКОМУ PD-1

Изобретение относится к биотехнологии. Описано выделенное канинизированное антитело или его антигенсвязывающий фрагмент, которое специфично связывается с Рецептором 1 Программируемой Клеточной Смерти (PD-1), отличающееся тем, что указанное антитело содержит тяжелую цепь собачьего IgG и собачью легкую цепь; отличающуюся тем, что собачья легкая цепьсодержит три области, определяющие комплементарность (CDR): CDR 1 легкой цепи (CDRL1), CDR 2 легкой цепи (CDRL2) и CDR 3 легкой цепи (CDRL3); и тяжелая цепь собачьего IgG содержит три CDR тяжелой цепи: CDR 1 тяжелой цепи (CDRH1), CDR 2 тяжелой цепи (CDRH2) и CDR 3 тяжелой цепи (CDRH3); где CDRL1 содержит аминокислотную последовательность SEQ ID NO:20; CDRL2 содержит аминокислотную последовательность SEQ ID NO:22; CDRL3 содержит аминокислотную последовательность SEQ ID NO:24; CDRH1 содержит аминокислотную последовательность SEQ ID NO:14; CDRH2 содержит аминокислотную последовательность SEQ ID NO:16 и CDRH3 содержит аминокислотную последовательность ...

СОБАЧЬИ АНТИТЕЛА С МОДИФИЦИРОВАННЫМИ ПОСЛЕДОВАТЕЛЬНОСТЯМИ CH2-CH3

ВАКЦИННАЯ КОМПОЗИЦИЯ

... 1. Вакцина, отличающаяся тем, что она включает, по меньшей мере, один антиген и пептид, содержащий последовательность R1-XZXZNXZX-R2, ! где N означает целое число от 3 до 7, предпочтительно 5, ! Х означает остаток положительно заряженной природной и/или неприродной аминокислоты, ! Z означает остаток аминокислоты, выбранной из группы, состоящей из L, V, I, F и/или W, ! R1 и R2 выбраны независимо друг от друга из группы, состоящей из -Н, -NH2, -СОСН3, -СОН, пептидов, состоящих из 20 и меньше аминокислотных остатков, реагирующих с пептидами групп, пептидных линкеров с пептидом или без него; X-R2 также может представлять собой амид, эфир или тиоэфир остатка С-концевой аминокислоты. ! 2. Вакцина по п.1, отличающаяся тем, что Х в последовательности пептида означает остаток аминокислоты, выбранной из группы, состоящей из K, R, орнитина и/или гомоаргинина. ! 3. Вакцина по п.2, отличающаяся тем, что Х в последовательности пептида представляет собой К. ! 4. Вакцина по п.1, отличающаяся тем, что Z ...

АНТИТЕЛА К PD-1 СОБАК

КОМБИНИРОВАННАЯ ТЕРАПИЯ ДЛЯ ЛЕЧЕНИЯ РАКА ПУТЕМ ВНУТРИВЕННОГО ВВЕДЕНИЯ РЕКОМБИНАНТНОГО MVA И АНТИТЕЛА

ВАКЦИНА, НАПРАВЛЕННАЯ ПРОТИВ АКТИНОБАЦИЛЛЕЗНОЙ ПЛЕВРОПНЕВМОНИИ, И СПОСОБ ПОЛУЧЕНИЯ ТАКОЙ ВАКЦИНЫ

... 1. Вакцина, направленная против актинобациллезной плевропневмонии, включающая липополисахарид, отличающаяся тем, что вакцина включает полимиксин для уменьшения симптомов эндотоксического шока, вызываемого липополисахаридом.2. Вакцина по п.1, отличающаяся тем, что вакцина включает липополисахарид, выделенный из бактериальной культуры, в комплексе с одним или более повторов токсинов.3. Вакцина по п.2, отличающаяся тем, что повторы токсинов представляют собой ApxI, ApxII и ApxIII.4. Вакцина по п.1, отличающаяся тем, что вакцина включает менее 2000 МЕ полимиксина на дозу.5. Вакцина по п.4, отличающаяся тем, что вакцина включает менее 1000 МЕ полимиксина на дозу.6. Вакцина по п.5, отличающаяся тем, что вакцина включает менее 500 МЕ полимиксина на дозу.7. Вакцина по п.1, отличающаяся тем, что полимиксин представляет собой полимиксин В.8. Вакцина по п.1, отличающаяся тем, что липополисахарид получают из Actinobacillus pleuropneumoniae.9. Вакцина по п.1, отличающаяся тем, что вакцина включает 42 ...

Векторы для экспрессии простатоассоциированных антигенов

СПОСОБЫ И КОМПОЗИЦИИ ДЛЯ ЛЕЧЕНИЯ ПЕРСИСТИРУЮЩИХ ИНФЕКЦИЙ

... 1. Композиция для смягчения или предотвращения персистирующей инфекции, ангиоиммунобластической лимфомы или нодулярной с лимфоидным преобладанием лимфомы Ходжкина, содержащая ингибитор активности или экспрессии PD-1.2. Композиция по п.1, где указанный ингибитор активности или экспрессии PD-1 понижает экспрессию или активность PD-L1.3. Композиция по п.2, где указанный ингибитор активности или экспрессии PD-1 представляет собой антитело к PD-L1.4. Композиция по п.3, где указанная персистирующая инфекция представляет собой вирус иммунодефицита человека, Т-лимфотрофический вирус человека, вирус герпеса, вирус Эпштейна-Барр или вирус папилломы человека.5. Композиция по п.3, где указанная персистирующая инфекция представляет собой инфекцию вирусом иммунодефицита человека.6. Композиция по п.5, дополнительно содержащая вакцину.7. Композиция по п.6, где указанная вакцина вызывает иммунный ответ в отношении вируса иммунодефицита человека.8. Композиция по п.1, приготовленная для имплантации.9. Композиция ...

КОМБИНАЦИИ ЛЕКАРСТВЕННЫХ СРЕДСТВ

БЕЛКИ СЛИЯНИЯ НА ОСНОВЕ OX40L И ПУТИ ИХ ПРИМЕНЕНИЯ

ВАКЦИННАЯ КОМПОЗИЦИЯ

... 1. Вакцинная композиция для введения в ротовую полость человека или животного, причем вакцинная композиция включает:по меньшей мере один антиген, выделенный из объекта с инфекционным заболеванием, ипо меньшей мере один агент, выбранный из группы, состоящей из:агониста toll-подобного рецептора 4 (TLR4),агониста toll-подобного рецептора 2/6 (TLR2/6) ициклического динуклеотида или их производного или соли.2. Вакцинная композиция по п.1, где антиген, выделенный из объекта с инфекционным заболеванием, представляет собой антиген, выделенный из вируса гриппа.3. Вакцинная композиция по п.2, где антиген, выделенный из вируса гриппа, представляет собой белок гемагглютинин.4. Вакцинная композиция по п.2, где антиген, выделенный из вируса гриппа, представляет собой инактивированный цельный вирус.5. Вакцинная композиция по п.1, где агонист toll-подобного рецептора 4 (TLR4) включает по меньшей мере один агент, выбранный из группы, состоящей из:липополисахарида или его соли имонофосфориллипида или его ...

ПРОТИВОРАКОВЫЕ ВАКЦИНЫ, НАЦЕЛЕННЫЕ НА BORIS, И СПОСОБЫ ИХ ПРИМЕНЕНИЯ

ИММУНОСТИМУЛИРУЮЩИЕ КОМПОЗИЦИИ

КОМПОЗИЦИЯ ВАКЦИНЫ ДЛЯ ТРАНСДЕРМАЛЬНОГО ИЛИ ТРАНСМУКОЗАЛЬНОГО ВВЕДЕНИЯ

... 1. Композиция вакцины для трансдермального или трансмукозального введения для применения при индукции клеточного иммунитета, причем вакцина содержит:(i) антиген и(ii) фармакологически приемлемую кислоту или ее фармакологически приемлемую соль в качестве первого стимулятора индукции клеточного иммунитета.2. Композиция вакцины по п.1, отличающаяся тем, что композиция предназначена для применения при лечении рака.3. Композиция вакцины по п.1, отличающаяся тем, что композиция предназначена для применения при лечении вирусного заболевания.4. Композиция вакцины по любому из пп.1-3, отличающаяся тем, что фармакологически приемлемая кислота или ее фармакологически приемлемая соль представляет собой органическую кислоту или ее фармакологически приемлемую соль.5. Композиция вакцины по п.4, отличающаяся тем, что органическая кислота или ее фармакологически приемлемая соль представляет собой органическое соединение, имеющее карбоксильную группу, или органическое соединение, имеющее сульфогруппу, или ...

КОМПОЗИЦИЯ ДЛЯ ЛЕЧЕНИЯ РАКА ПРЕДСТАТЕЛЬНОЙ ЖЕЛЕЗЫ

... 1. Активная (иммуностимулирующая) композиция, включающая по крайней мере одну РНК, кодирующую по крайней мере два, три или четыре различных антигена,а) в которой по крайней мере один антиген выбирают из:шестого трансмембранного эпителиального антигена предстательной железы (ШТЭАП), иб) в которой другой антиген(ы) выбирают по крайней мере из одного антигена из любых следующих антигенов или их специфических комбинаций:простат-специфического антигена (ПСА), илипростат-специфического мембранного антигена (ПСМА), илиантигена стволовых клеток предстательной железы (АСКП),илиПСА и ПСМА, илиПСА и АСКП, илиПСМА и АСКП,илиПСА, ПСМА и АСКП.2. Активная (иммуностимулирующая) композиция по п.1, включающая по крайней мере одну РНК, кодирующую четыре различных антигена, выбранных из ПСА, ПСМА, АСКП и ШТЭАП.3. Активная (иммуностимулирующая) композиция по любому из пп.1-2, в которой по крайней мере длина одной РНК составляет от 250 до 20000 нуклеотидов.4. Активная (иммуностимулирующая) композиция по любому ...

BROMELINBESTANDTEIL

Transnasaler Transport bzw. Impfung mit hochadaptierbaren Trägern

Auf N-Formyl Methionyl Peptide basierendem Adjuvans für Impfstoffe

HPV-E7 ZUR BEHANDLUNG VON MENSCHLICHEM PAPILLOMAVIRUS

IMPFSTOFF SPEZIFISCH GEGEN NIERENTUMORE, GERICHTET GEGEN DAS ANTIGEN G-250 DES NIERENTUMORS

Verwendung von OmpA Enterobakterproteinen um zielgerichtet Antigen-Präsentierende Zellen anzusteuern

Therapeutische Zusammensetzung, welche die Immunitätsreaktion verändert

Vaccines

Immunogenic compositions

Virus strains

The present invention relates to non-laboratory virus strains, for example of herpes viruses such as HSV, with improved oncolytic and/or gene delivery capabilities as compared to laboratory virus strains.

Vaccines

Improved vaccines

INJECTABLE ADJUVANT, METHOD OF PREPARING SAME, AND COMPOSITIONS INCLUDING SUCH ADJUVANT

... 1,263,480. Injectable adjuvants. HAVERLOCKHART LABORATORIES Inc. 17 Feb., 1969 [23 Feb., 1968], No. 8408/69. Heading A5B. An injectable, non-toxic medicinal adjuvant for use with a medicinal agent containing nitrogen atoms comprises a synthetic polymer having free hydroxyl and carboxyl sites and an emulsifier for the polymer admixed therewith, the polymer and the emulsifier, in combination, being capable of undergoing sustained release but substantially complete dissociation and absorption in the tissue of a host. The polymer is suitably a cross-linked polymer of acrylic acid, preferably cross-linked with a polysaccharide such as polyallyl sucrose. The adjuvant may also contain a compound containing amino groups which are reactable with any free hydroxyl and carboxyl sites which have not reacted with the nitrogen atoms of the medicinal agent. Suitable compounds containing amino groups include collagen, preferably reconstituted; basic amino acids; epinephrine or other catecholamines; peptides ...

Vesicular stomatitis virus for prime boost vaccines

Use of biologically active HIV-1 TAT, fragments or derivatives thereof, to target and/or to activate antigen-presenting cells, and/or to deliver cargo molecules for preventive or therapeutic vaccination and/or to treat other diseases

The present invention concerns a method for prophylactic and/or therapeutic vaccination and/or treatment and/or diagnosis of HTWAIDS, other infectious diseases, inflammatory and angiogenic diseases and tumours which utilizes a biologically active HTV-1 Tat protein, fragments or derivates thereof, as a module with one or more of the following features: antigen, adjuvant and targeting-delivery system to specific antigen-presenting cells including dendritic cells, endothelial cells and macrophages. In particular, it is claimed that Tat can be used only in its biologically active form as an antigen combined with one or more other antigens, to prime or to boost protective immune responses against itself as well as other antigens and/or to selectively deliver these antigen(s) as well as active compounds to dendritic cells, endothelial cells and macrophages, due to its capability of targeting these A PC and of activating their maturation and functions and of increasing Th-1 type immune responses ...

Vesicular stomatitis virus for prime boost vaccines

Vesicular stomatitis virus for prime boost vaccines

Yeast-based therapeutic for chronic hepatitis B infection

Use of biologically active HIV-1 TAT, fragments orderivatives thereof, to target and/or to activate antigen-presenting cells, and/or to deliver cargo molecules for preventive or therapeutic vaccinati on and/or to treat other diseases.

Immunost imulation.

"Improved vaccine compositions".

Yeast-based therapeutic for chronic hepatitis B infection

Use of biologically active HIV-1 TAT, fragments orderivatives therof, to target and/or to activate antigen-presenting cells, and/or to deliver cargo molecules for preventive or therapeutic vaccination and/or treat other diseases.

Yeast-based therapeutic for chronic hepatitis B infection

IMMUNE ANSWER AGAINST HPV OF ANTIGENS CAUSED OF COMPOSITIONS SOME HPV ANTIGEN AND A STRESS PROTEIN CONTAINING OR AN EXPRESS ION VECTOR ABLE OF EXPRESSION THESE PROTEINS

DNA VAKZINE AGAINST TUMOR GROWTH AND OPERATING TECHNIQUE FOR IT

DENDRITE-CELL-SPECIFIC KOSTIMULIERENDE MOLECULES

USE OF MHC CLASS II LIGAND (CD4 AND LAG-3) AS ADJUVANS FOR INOCULATION AND OF LAG-3 WITH TREATMENT OF CANCER

IGF-1 AS VACCINE AIDS FOR CATS, IN PARTICULAR AGAINST FELINE RETROVIREN

VIROSOMEN WELL-BEHAVED PARTICLES

LTB4 AS ADJUVANS FOR VACCINES

USE FROM GILZ PROTEIN TO THE MODULATION OF A ANTIGEN-SPECIFIC IMMUNE ANSWER

VERFAHREN ZUR STIMULIERUNG DER IMMUNOLOGISCHEN REAKTIVITAET EINES ANTIGENS

COMPOSITIONS CONTAINING MYELIN-BASIC PROTEIN PEPTIDEN AND MEDICAL USES

TREATMENT PROCEDURE USING CTLA-4 ANTIBODIES

M. TUBERCULOSIS CHAPERONIN 60,1 AND ITS USES

GROWTH-HORMONE-SETTING FREE HORMONE STRENGTHENS AN VAKZIN INDUCING IMMUNE ANSWER

New peptides based on the C-terminal region of hepatitis B virus core antigen, is useful for vaccine production

Peptides (I) based on the C-terminal region of hepatitis B virus core antigen are new. Peptides of formula PepS-(SPBmX1X2)n-PepE(I) are new: PepS, PepE = peptides of 0-200 amino acids; S = serine; P = proline; B = Arg, Lys or His; m = 2-20; n = a positive integer; X1, X2 = amino acids. An Independent claim is also included for a pharmaceutical composition comprising a peptide (I) and a carrier.

USE OF BIOLOGICALLY ACTIVE HIV-1 ACT, FRAGMENTS OR DERIVATIVES OF IT, FOR THE REGULATION AND/OR ACTIVATION OF ANTIGEN-PRESENTING CELLS, AND/OR TO THE DELIVERY OF CARGO MOLECULES FOR INOCULATION AND/OR FOR TREATMENT OF OTHER ILLNESSES

USE OF A VGEFMUTANTS TO ANTI-ANGIOGENIC THERAPY

PREVENTIVE KREBSVAKZINE ON BASIS OF THE BORIS (BREAD AGO OF MODULATOR OF IMPRINTED SITES) MOLECULE

MIMOTOPE

The present invention relates to the use of at least one compound comprising the amino acid sequence: (X1)nX2X3PVX4X5X6(X7)m (Formula I), wherein X1 is any amino acid residue, X2 is an amino acid residue selected from the group consist ing of aspartic acid (D) and glutamic acid (E), X3 is any amino acid residue, X4 is any amino acid residue, X5 is an amino acid residue selected from the group consisting of proline (P) and alanine (A), X6 is an amino acid residue selected from the group consisting of aspartic acid (D) and glutamic acid (E), X7 is any amino acid residue, n and m, independently, are 0 or an integer of more than 0, and wherein the amino acid sequence according to Formula I is not identical with, or does not comprise the 8-mer polypeptide fragment of alpha-synuclein having the amino acid sequence DMPVDPDN, said compound having a binding capacity to an antibody which is specific for an epitope of alpha-synuclein comprising the amino acid sequence DMPVDPDN for producing a medicament ...

VACCINE APPROXIMATELY HUNDECORONAVIRUS.

USE OF ZINC CALCIUM HYDROXIDE, LECITHIN AND PAO TO ADJUVIERUNG OF ANTIGEN SOLDERING AND ADJUVIERTE IN THIS WAY ANTIGEN SOLDERING.

INDUSTRIAL PROCEDURE FOR THE PRODUCTION OF RIBOSOMALER VACCINES AND THE THEN PRESERVATION RIBOSOMALEN OF VACCINES.

COMPOSITIONS AND THEIR USE FOR THE PROMOTION OF THE IMMUNOPOTENTIATION

HPV-E7 FOR THE TREATMENT OF HUMAN ONE PAPILLOMAVIRUS

VIRUS TRUNKS FOR THE ONKOLYTI TREATMENT OF CANCER

IMMUNE-STIMULATING COMPOSITIONS THE ONE A MINERAL SALT AND A FURTHER CONTAINING ADJUVANT

COMPOSITIONS AND METHODS TO THE PURPOSEFUL DELIVERY OF BIOLOGICALLY ACTIVE FACTORS

MORE RECEPTOR-SPECIFICALLY TRANSEPITHELIALTRANSPORT OF THERAPUETICA

IMMUNOADJUVANS

COMBINED MENINGITIS B/C VACCINES

THERAPEUTIC USES OF ANTIGENS OR EPITOPEN ASSOZIERT WITH INCOMPLETE CELLULAR ONES PEPTIDPROZESIERUNG, E.G.: EXPRIMIERT IN RMA-S CELLS GENE TRANSFIZIERT WITH B7-1

VACCINE PREPARATION.

VETERINARY VACCINES.

HELICOBACTER PROTEINS AND IMPSTOFFE

MEDICINE, IN PARTICULAR FOR THE MODULATION OF THE IMMUNE ANSWER WITH THE FIGHT AGAINST VIRUSES, TUMORS, BACTERIA AND PARASITES

RECEPTOR-SPECIFIC TRANSEPITHELIALER TRANSPORT OF IMMUNOGEN ONES

STIMULATION OF THE IMMUNE ANSWER BY VIRALES PROTEIN

STRESS PROTEINS AND YOUR USE

USE OF AUFGEREINIGTEM INVAPLEX AS VACCINE FOR GRAM NEGATIVEBAKTERIEN

SYSTEM OF THE SUPPLY OF A VACCINE ON PEPTIDBASIS, WHICH FORMS ITS OWN ADJUVANS, AND ITS PRODUCTION

Novel b7-4 molecules and uses therefor

Immunotherapy against melanoma and other cancers

The present invention relates to peptides, proteins, nucleic acids and cells for use in immunotherapeutic methods. In particular, the present invention relates to the immunotherapy of cancer. The present invention furthermore relates to tumor- associated T-cell peptide epitopes, alone or in combination with other tumor-associated peptides that can for example serve as active pharmaceutical ingredients of vaccine compositions that stimulate anti-tumor immune responses, or to stimulate T cells ex vivo and transfer into patients. Peptides bound to molecules of the major histocompatibility complex (MHC), or peptides as such, can also be targets of antibodies, soluble T-cell receptors, and other binding molecules.

Synthetic peptide-based emergency vaccine against foot and mouth disease (FMD)

Synthetic FMD peptide immunogens and compositions containing the same are disclosed. Methods for detecting, treating, and preventing an FMD infection in an animal using the synthetic FMD peptide immunogens are also disclosed. In a specific embodiment, a peptide based emergency vaccine and formulations thereof against Foot and Mouth Disease is described. Various vaccine formulations contain a mixture of peptides derived from FMDV VP1 protein; each peptide containing a B cell FMDV neutralizing/receptor binding epitope sequence linked to an artificial Th epitope to enhance the immunogenicity of each peptide. Disclosed vaccine formulations containing viral immunogens can optionally be supplemented with a mixture of peptides representing the FMDV endogenous Th epitopes derived from FMDV proteins, homologues and functional analogues thereof. Such viral peptide compositions are prepared in an acceptable delivery system as vaccine formulations and can provide protection pigs and cattle from infection ...

Immune composition, preparation method therefor, and application thereof

Provided are an immune composition, a preparation method therefor, and a use thereof. In the present invention, a prokaryotic expression system or a recombinant adenovirus system is used to highly efficiently express VZV envelope gE glycoprotein and the flagellin fusion protein thereof. The produced recombinant gE protein, gE flagellin fusion protein, and recombinant adenovirus vector, or compositions thereof is used to immunize a mouse so as to promote the body to generate gE and VZV specific antibody titer, as well as gE and VZV specific cell immunity.

Method of safe administration of phosphorylated Tau peptide vaccine

Methods for inducing anti-phosphorylated Tau antibodies without inducing a severe adverse event in humans are described. The methods include administering to the subject an effective amount of liposomes including a toll-like receptor 4 agonist and a Tau phosphopeptide presented on the surface of the liposome.

Immunomodulating polynucleotides, antibody conjugates thereof, and methods of their use

Immunomodulating polynucleotides are disclosed. The immunomodulating polynucleotides may contain 5-modified uridine, 5-modified cytidine, a total of from 6 to 16 nucleotides, and/or one or more abasic spacers and/or internucleoside phosphotriesters. Also disclosed are conjugates containing a targeting moiety and one or more immunomodulating polynucleotides. The immunomodulating polynucleotides and conjugates may further contain one or more auxiliary moieties. Also disclosed are compositions containing the immunomodulating polynucleotides or the conjugates containing one or more stereochemically enriched internucleoside phosphorothioates. Further disclosed are pharmaceutical compositions containing the immunomodulating polynucleotides or the conjugates and methods of their use.

Cancer vaccines targeting BORIS and uses thereof

Disclosed herein are nucleic acid molecules comprising one or more nucleic acid sequences that encode a synthetic consensus BORIS antigen. Vectors, compositions, and vaccines comprising one or more nucleic acid sequences that encode a synthetic consensus BORIS antigen are disclosed. Methods of treating a subject with a BORIS-expressing tumor and methods of preventing a BORIS-expressing tumor are disclosed. A synthetic consensus BORIS antigen is disclosed.

Artificial cells

The present disclosure relates to various embodiments associated with artificial cells, particularly artificial antigen presenting cells, methods of making the same, methods of administering the same, computer systems relating thereto, computer-implemented methods relating thereto, and associated computer program products.

Artificial cells

The present disclosure relates to various embodiments associated with artificial cells, particularly artificial antigen presenting cells, methods of making the same, methods of administering the same, computer systems relating thereto, computer-implemented methods relating thereto, and associated computer program products.

Novel vaccine adjuvants based on targeting adjuvants to antibodies directly to antigen-presenting cells

Compositions and methods for enhancing an immune response with an adjuvant composition comprising: an anti-dendritic cell (DC)-specific antibody or fragment thereof conjugated to at least a portion of a TLR agonist; and a pharmaceutically acceptable carrier are disclosed herein. The conjugate and agonist are each comprised in an amount such that, in combination with the other, are effective to produce the immune response in a human or animal subject in need of immunostimulation.

Vaccine composition for prophylaxis and/or therapy of alzheimer's disease

A vaccine composition for prophylaxis and/or therapy of Alzheimer's disease, which comprises a fusion protein prepared by inserting a single or tandemly repeated multiple copies of amyloid β antigenic peptide having 5 to 15 continuous amino acid residues derived from the N-terminus of amyloid β peptide into a wild type seed storage protein.

Targeted multi-epitope dosage forms for induction of an immune response to antigens

Provided herein are compositions and methods related to MHC II binding peptides. In some embodiments, the peptides are obtained or derived from a common source. In other embodiment, the peptides are obtained or derived from an infectious agent to which a subject has been repeatedly exposed.

Novel malaria vaccine

The present invention provides a vaccine for preventing and/or treating Plasmodium falciparum infections, which comprises a polypeptide set forth in SEQ ID NO: 1 or represented by formula (1), and an adjuvant. X 1 -A-B-X 2 -Y-X 3 -(Y)n-X 4 -(Y)n-X 5   (1) (In the formula, X 1 represents the 1st to 7th amino acid residues in a polypeptide set forth in SEQ ID NO: 1; X 2 represents the 73th to 177th amino acid residues; X 3 represents the 178th to 258th amino acid residues; X 4 represents the 259th to 289th amino acid residues; X 5 represents the 290th to 334th amino acid residues; A represents an 8-mer repeat sequence contained in a 47-kd region of SERA polypeptide of Plasmodium falciparum ; B represents a sequence of a serine-rich region contained in a 47-kd region of SERA polypeptide of Plasmodium falciparum ; Y represents any one selected from A-A, A-B, and B; and n is an integer of 0 or 1.)

Continuous Cell Programming Devices

The present invention comprises compositions, methods and devices for creating an infection-mimicking environment within a polymer scaffold to stimulate antigen-specific dendritic cell activation. Devices of the present invention are used to provide protective immunity to subjects against infection and cancer.

Synthetic Oligopeptides Designed From Mite Cysteine Proteases and Methods for the Production of

The invention refers to the design, synthesis and evaluation of 6 synthetic oligopeptides, that have not been previously described, designed from the T and B epitopes of allergens of group I of intradomiciliary mites of the species Dermatophagoides pteronyssinus, Dermatophagoides farinae and Blomia tropicalis , which can be used in the immunomodulation of individuals having immunocompetent systems and in the production of IgY polyclonal antibodies. The invention relates to a first method for obtaining a composition of IgY polyclonal antibodies that can be used as a diagnostic reagent having low cost and high reactivity in respect of intradomiciliary mites, and a second method for the detection of mite allergens, using the IgY antibody composition developed in the first method. The invention further relates to the composition of the IgY polyclonal antibodies.

Tat-Based Vaccine Compositions and Methods of Making and Using Same

A Tat-based vaccine composition comprising at least one antigen coupled to at least one immunostimulatory lentivirus trans-activator of transcription (Tat) molecule wherein the antigen is a cancer antigen an infectious disease antigen or a fragment thereof and methods to treat disease by administering the Tat-based vaccine composition. An additional Tat-based vaccine composition comprising immunostimulatory lentivirus Tat is provided.

Expression of protective antigens in transgenic chloroplasts and the production of improved vaccines

Vaccines for conferring immunity in mammals to infective pathogens are provided, as well as vectors and methods for plastid transformation of plants to produce protective antigens and vaccines for oral delivery. The invention further provides transformed plastids having the ability to survive selection in both the light and the dark, at different developmental stages by using genes coding for two different enzymes capable of detoxifying the same selectable marker, driven by regulatory signals that are functional in proplastids as well as in mature chloroplasts. The invention utilizes antibiotic-free selectable markers to provide edible vaccines for conferring immunity to a mammal against Bacillus anthracis , as well as Yersina pestis . The vaccines are operative by parenteral administration as well. The invention also extends to the transformed plants, plant parts, and seeds and progeny thereof. The invention is applicable to monocot and dicot plants.

Methods for protecting dopaminergic neurons from stress and promoting proliferation and differentiation of oligodendrocyte progenitors by nrg-2

The invention features methods of treatment and diagnosis using NRG-2 polypeptides, nucleic acid molecules, and antibodies. The invention also provides novel NRG-2 polypeptides and nucleic acid molecules.

Methods and compositions for producing antigenic responses

The present inventions relates to methods of producing an antigenic response in which an antigen is contacted to an antigen-presenting cell, wherein the improvement comprises contacting the antigen-presenting cell with an A 1 adenosine receptor activating agent in an amount sufficient to increase the antigenic response of the antigen-presenting cell to the antigen. The present invention further provides methods, compositions, combination therapies, imaging techniques, and diagnostic kits that may improve the diagnosis, prognosis, and/or survival of cancer patients, pathogen-infected patients, and infectious or non-infectious immune-deficient patients.

Antigen peptide and use thereof

In order to provide an effective vaccine against infection with Propionibacterium acnes, the present invention provides a peptide which is a peptide consisting of a specific amino acid sequence or a peptide consisting of an amino acid sequence derived from the specific amino acid sequence by deletion, substitution, insertion, or addition of one or more amino acids, the peptide suppressing, by immune response, inflammation caused by infection with Propionibacterium acnes.

Dna vaccines and methods for the prevention of transplantation rejection

Methods for preventing, delaying the onset of, or treating rejection of an allograft using a DNA vaccine, where the vaccine can comprise a polynucleotide encoding a pro-apoptotic protein, like BAX and/or a polynucleotide encoding an autoantigen or donor antigen, like secreted glutamic acid decarboxylase 55. Administering one of the DNA vaccines to a transplant recipeint, as described herein, can induce a donor specific tolerogenic response.

Immunogenic pote peptides and methods of use

POTE has recently been identified as a tumor antigen expressed in a variety of human cancers, including colon, ovarian, breast, prostate, lung and pancreatic cancer. Described herein are immunogenic POTE polypeptides, including modified POTE polypeptides, that bind MHC class I molecules. The immunogenic POTE polypeptides are capable of inducing an immune response against POTE-expressing tumor cells. Thus, provided herein is a method of eliciting an immune response in a subject, such as a subject having a type of cancer that expresses POTE.

Compositions and Methods for Self-Adjuvanting Vaccines against Microbes and Tumors

The present invention is drawn to compositions and methods to enhance an immune response in order to prevent or treat infections or hyperproliferative diseases such as cancer. More particularly, the composition is an immuno stimulator intracellular signaling peptide fused directly or indirectly to a peptide that leads to multimerization into complexes of three or more units, where the intracelluar signaling peptide must be present in a complex of three or more units in order to stimulate an immune response. Inserting this fusion construct into viruses like HIV-1 or introducing it into dendritic cells or tumor cells is predicted to lead to a positive therapeutic effect in humans, non-human mammals, birds, and fish.

Kexin-Derived Vaccines to Prevent or Treat Fungal Infections

A vaccine is disclosed that promotes CD4+ T cell-independent host defense mechanisms to defend against infection by fungi such as Pneumocystis spp. The vaccine may be used to prevent or to treat fungal infections. The novel vaccine can provide protective immunity, even for immunocompromised individuals such as HIV patients having reduced levels of CD4+ T cells.

Vaccine and methods to reduce campylobacter infection

Vaccine vectors and methods for enhancing resistance to Campylobacter infection or for enhancing the immune response to Campylobacter are provided herein. The vaccine vectors include a first polynucleotide which encodes an antigenic polypeptide selected from SEQ ID NO 7-9 or a fragment thereof. The vector may also include an immunostimulatory polypeptide. The methods include administering the vaccine vectors to a subject.

Oral vaccine compromising an antigen and a toll-like receptor agonist

The present invention provides an immunogenic composition comprising one or more antigens and a Toll-like receptor (TLR) agonist in an orally (e.g. sublingually) administered composition.

Hmgb1-derived peptides enhance immune response to antigens

The invention provides an immunostimulatory peptide containing the amino acid sequence SAFFLFCSE and uses thereof. The invention also provides an immunostimulatory peptide containing the amino acid sequence DPNAPKRPPSAFFLX 1 X 2 X 3 X 4 or derivatives thereof. In one embodiment, when X1 is alanine (A), glycine (G), or valine (V) then X2 is C, X3 is S and X4 is E; wherein when X2 is alanine (A), glycine (G), or valine (V) then X1 is F, X3 is S and X4 is E; wherein when X3 is alanine (A), glycine (G), or valine (V) then X1 is F, X2 is C and X4 is E; or wherein when X4 is alanine (A), glycine (G), or valine (V) then X1 is F, X2 is C and X3 is S.

Complexation of nucleic acids with disulfide-crosslinked cationic components for transfection and immunostimulation

The present invention is directed to a polymeric carrier cargo complex, comprising as a cargo at least one nucleic acid (molecule) and disulfide-crosslinked cationic components as a (preferably non-toxic and non-immunogenic) polymeric carrier. The inventive polymeric carrier cargo complex allows for both efficient transfection of nucleic acids into cells in vivo and in vitro and/or for induction of an (innate and/or adaptive) immune response, preferably dependent on the nucleic acid to be transported as a cargo. The present invention also provides, pharmaceutical compositions, particularly vaccines and adjuvants, comprising the inventive polymeric carrier cargo complex and optionally an antigen, as well as the use of such the inventive polymeric carrier cargo complex and optionally an antigen for transfecting a cell, a tissue or an organism, for (gene-)therapeutic purposes as disclosed herein, and/or as an immunostimulating agent or adjuvant, e.g. for eliciting an immune response for the treatment or prophylaxis of diseases as mentioned above. Finally, the invention relates to kits containing the inventive polymeric carrier cargo complex and/or the inventive pharmaceutical composition, adjuvant or vaccine in one or more parts of the kit.

Vaccine composition based on sticholysin encapsulated into liposomes

The current invention relates to the field of Biotechnology applied to human health. Here it is described a vaccine vehicle wherein toxins from eukaryotic organisms are encapsulated into multilamellar vesicles obtained by the dehydration-rehydration procedure whose lipidic composition is dipalmitoylphosphatidylcholine:cholesterol in a 1:1 molar ratio for subcutaneous or intramuscular administration. These compositions do not require the use of other adjuvants. The disclosed compositions allow modulation of CTL-specific immune response against one or several antigens co-encapsulated into toxin-containing liposomes. The vaccinal vehicle of the present invention shows advantages over others disclosed by the previous art due to the robustness and functionality of the induced immune response as well as its immunomodulating properties.

Synthetic immunogen useful for generating long lasting immunity and protection against pathogens

The present invention relates to a synthetic immunogen represented by the general formula 1, useful for generating long lasting protective immunity against various intracellular pathogens which are the causative agents of tuberculosis, leishmaniasis, AIDS, trypanosomiasis, malaria and also allergy, cancer and a process for the preparation thereof. The developed immunogen is able to circumvent HLA restriction in humans and livestock. The invention further relates to a vaccine comprising the said immunogen for generating enduring protective immunity against various diseases. The said vaccine is targeted against intracellular pathogens, more particularly the pathogen M. tuberculosis in this case. In the present invention, promiscuous peptides of M. tuberculosis are conjugated to TLR ligands especially; Pam2Cys to target them mainly to dendritic cells and therefore elicit long-lasting protective immunity. (The formula (I) should be inserted here) General formula (I) wherein, X 1 =a promiscuous CD4 T helper epitope selected from SEQ ID No. 1 to 98 OR nil; X 2 =a promiscuous CD8 T cytotoxic epitope selected from SEQ ID No. 99 to 103 OR nil; when X1=nil; X2=SEQ ID No. 99 to 103 and when X2=nil; X1=SEQ ID No. 1 to 98; Y=Lysine; and S=Serine.

Fgf modulation of in vivo antibody production and humoral immunity

The invention provides methods for increasing or decreasing antibody production in vivo by inhibiting or promoting the activity of fibroblast growth factor-2 (FGF2) respectively.

Compositions and Methods for the Treatment or Prevention of Hepatitis B Virus Infection

Disclosed are yeast-based immunotherapeutic compositions, hepatitis B virus (HBV) antigens, and fusion proteins for the treatment and/or prevention of HBV infection and symptoms thereof, as well as methods of using the yeast-based immunotherapeutic compositions, HBV antigens, and fusion proteins for the prophylactic and/or therapeutic treatment of HBV and/or symptoms thereof.

Dna vaccine against multitypes of avian influenza viruses and influenza virus-like particles comprising adjuvant-fused m2 protein

A DNA vaccine comprising hyperglycosylated mutant HA gene, which is derived from avian influenza virus, is provided. A DNA vaccine composition comprising: (a) the DNA vaccine; and (b) a booster is also provided. An influenza virus-like particle comprising adjuvant-fused M2 protein is further provided. A method for eliciting an immune response against a plurality of avian influenza virus subtypes in a subject, comprising delivering the DNA vaccine or the DNA vaccine composition to tissue of the subject is also provided

Recombinant virus expressing foreign dna encoding feline cd80, feline cd86, feline cd28, or feline ctla-4 and uses thereof

The present invention involves a recombinant virus which comprises at least one foreign nucleic acid inserted within a non-essential region of the viral genome of a virus, wherein each such foreign nucleic acid encodes a protein. The protein which is encoded is selected from the groups consisting of a feline CD28 protein or an immunogenic portion thereof, a feline cD80 protein or an immunogenic portion thereof, a feline CD86 protein or an immunogenic portion thereof, or a feline CTLA-4 protein or an immunogenic portion thereof. The protein is capable of being expressed when the recombinant virus is introduced into an appropriate host. The present invention also involves a recombinant virus further comprising a foreign nucleic acid encoding an immunogen derived from a pathogen. The present invention also comprises recombinant viruses which are capable of enhancing an immune response in a feline. The present invention also comprises recombinant viruses which are capable of suppressing an immune response in a feline.

Mammalian cell surface antigens; related reagents

Purified genes encoding a T cell surface antigen from a mammal, reagents related thereto including purified proteins, specific antibodies, and nucleic acids encoding this antigen are provided. Methods of using said reagents and diagnostic kits are also provided.

Controlled activation of complement components for use as endogenous adjuvant

The invention relates to a pharmaceutical composition made of one or more preparation and comprising a therapeutically effective dose of at least one recombinant human C3-derivative and at least one antigen für vaccination.

ADJUVANTING SYSTEMS AND WATER-FREE VACCINE COMPOSITIONS COMPRISING A POLYI:C POLYNUCLEOTIDE ADJUVANT AND A LIPID-BASED ADJUVANT

The present disclosure provides adjuvanting systems comprising: (a) a polyI:C polynucleotide adjuvant; (b) a lipid-based adjuvant;(c) an amphipathic compound; and (d) a hydrophobic carrier. Also provided are vaccine compositions that are water-free or substantially free of water, which comprise the same components together with one or more antigens. The disclosure also provides uses for such compositions in inducing an antibody (humoral) and/or cell-mediated immune response and methods for their use in the treatment of a disease, disorder or ailment ameliorated by an antibody and/or cell-mediated immune response. 129-. (canceled)30. An adjuvanting system comprising:(a) a polyI:C polynucleotide adjuvant in an amount of less than about 100 micrograms per unit dose for humans;(b) a lipid-based adjuvant in an amount of less than about 100 micrograms per unit dose for humans, wherein the lipid-based adjuvant comprises palmitic acid as the lipid component;(c) an amphipathic compound; and(d) a hydrophobic carrier, wherein the hydrophobic carrier is an oil or a mixture of oils selected from a vegetable oil, nut oil, and mineral oil, or the hydrophobic carrier is a mannide oleate in mineral oil solution.31. A composition comprising the adjuvanting system of and an antigen claim 30 , wherein the composition is water-free or substantially free of water.32. The composition of claim 31 , comprising less than about 50 micrograms of the polyI:C polynucleotide adjuvant and less than about 50 micrograms of the lipid-based adjuvant per unit dose for humans.33. The composition of claim 31 , comprising less than about 10 micrograms of the polyI:C polynucleotide adjuvant and less than about 10 micrograms of the lipid-based adjuvant per unit dose for humans.34. The composition of claim 31 , comprising less than about 5 micrograms of the polyI:C polynucleotide adjuvant and less than about 5 micrograms of the lipid-based adjuvant per unit dose for humans.35. The composition of claim 31 , ...

Polymer adjuvant

The invention relates to an adjuvant comprising Pattern Recognition Receptor (PRR) agonist molecules linked to polymer chains that are capable of undergoing particle formation in aqueous conditions, or in aqueous conditions in response to external stimuli; and methods of treatment or prevention of disease using such an adjuvant.

VECTOR CO-EXPRESSING VACCINE AND COSTIMULATORY MOLECULES

Compositions and methods for co-expressing a secretable vaccine protein (such as gp96-Ig) and T-cell co-stimulatory molecules from a single vector, among others, are provided herein. Materials and methods for using gp96-Ig vaccination and T-cell co-stimulation to treat a clinical condition (e.g., cancer) in a subject also are provided. 1. An expression vector comprising a first nucleotide sequence that encodes a secretable vaccine protein , and a second nucleotide sequence that encodes a T cell costimulatory fusion protein comprising TL1A-Ig , wherein the TL1A-Ig protein comprises an amino acid sequence having at least 97% to SEQ ID NO: 9 and enhances activation of antigen-specific T cells when administered to a subject.2. The expression vector of claim 1 , wherein the vector is a mammalian expression vector.3. The expression vector of claim 1 , wherein the secretable vaccine protein is a gp96-Ig fusion protein that lacks the gp96 KDEL (SEQ ID NO:3) sequence.4. The expression vector of claim 3 , wherein the Ig tag in the gp96-Ig fusion protein comprises the Fc region of human IgG1 claim 3 , IgG2 claim 3 , IgG3 claim 3 , or IgG4.512-. (canceled)13. The expression vector of claim 1 , wherein the expression vector comprises DNA.14. The expression vector of claim 1 , wherein the expression vector comprises RNA.1526-. (canceled)27. The expression vector of claim 1 , wherein the expression vector is incorporated into a virus or virus-like particle.28. The expression vector of claim 1 , wherein the expression vector is incorporated into a human tumor cell.29. The expression vector of claim 28 , wherein the human tumor cell is a cell from an established non-small cell lung carcinoma (NSCLC) claim 28 , bladder cancer claim 28 , melanoma claim 28 , ovarian cancer claim 28 , renal cell carcinoma claim 28 , prostate carcinoma claim 28 , sarcoma claim 28 , breast carcinoma claim 28 , squamous cell carcinoma claim 28 , head and neck carcinoma claim 28 , hepatocellular carcinoma ...

PD-1 Peptide Inhibitors

This disclosure provides peptides which have a strong affinity for the checkpoint receptor “programmed death 1” (PD-1). These peptides block the interaction of PD-1 with its ligand PD-L1 and can therefore be used for various therapeutic purposes, such as inhibiting the progression of a hyperproliferative disorder, including cancer, treating infectious diseases, enhancing a response to vaccination, and treating sepsis. 1. A method of inhibiting progression of a hyperproliferative disorder , to treat an infectious disease , or to treat sepsis , comprising administering to a patient in need thereof an effective amount of a pharmaceutical composition comprising: (i) a peptide consisting of the amino acid sequence SEQ ID NO:1;', '(ii) a peptide consisting of the amino acid sequence SEQ ID NO:2;', '(iii) a peptide consisting of the amino acid sequence SEQ ID NO:3; and', '(iv) a peptide consisting of the amino acid sequence SEQ ID NO:4; and, '(a) up to four peptides selected from the group consisting of(b) a pharmaceutically acceptable vehicle.2. The method of claim 1 , wherein the composition is administered to inhibit progression of a hyperproliferative disorder.3. The method of claim 2 , wherein the hyperproliferative disorder is a cancer.4. The method of claim 3 , wherein the cancer is a melanoma.5. The method of claim 3 , further comprising administering a cancer vaccine to the patient.6. The method of claim 2 , further comprising administering a chimeric antigen receptor (CAR) T cell therapy to the patient.7. The method of claim 1 , wherein the composition is administered to treat an infectious disease.8. The method of claim 7 , wherein the infectious disease is malaria.9. The method of claim 7 , wherein the infectious disease is hepatitis B.10. The method of claim 7 , wherein the composition is administered as a vaccine adjuvant to a vaccine against the infectious disease.11. The method of claim 1 , wherein the composition is administered to treat sepsis.12. The ...

Vector co-expressing vaccine and costimulatory molecules

Compositions and methods for co-expressing a secretable vaccine protein (such as gp96-Ig) and T-cell co-stimulatory molecules from a single vector, among others, are provided herein. Materials and methods for using gp96-Ig vaccination and T-cell co-stimulation to treat a clinical condition (e.g., cancer) in a subject also are provided.

ADJUVANT COMPOSITION CONTAINING AT LEAST ONE INFLUENZA VIRUS NEUTRALIZING AND BINDING MOLECULE AND VACCINE COMPOSITION CONTAINING SAME

This invention relates to an adjuvant composition containing at least one binding molecule for neutralizing influenza virus and a vaccine composition containing the same. The composition containing at least one binding molecule for neutralizing influenza virus is capable of increasing the effects of a vaccine, and can thus be used as an adjuvant, which increases an immune response upon vaccine administration, and is very useful in the prevention of diseases caused by viruses. 19-. (canceled)10. A method of enhancing an immune response to a target antigen , comprising administering a vaccine composition comprising at least one binding molecule for neutralizing an influenza virus and a target antigen to a host.11. A method of preparing an immunological product , comprising:(a) immunizing a host by administering a vaccine composition comprising at least one binding molecule for neutralizing an influenza virus and a target antigen to the host; and(b) obtaining an immunological product from the immunized host, wherein the immunological product is a T cell, a B cell or an antibody against a target antigen comprised in the vaccine composition.12. A method of enhancing an immune response to an influenza A virus in a Subject which comprises administering to the subject a vaccine composition comprising a complex of the influenza A virus and an antibody directed to the influenza A virus.13. The method of claim 12 , wherein the antibody is specifically bound to the influenza A virus and the complex binds to an Fc receptor of immune cells.14. The method of claim 12 , wherein the ratio by weight of the influenza A virus to the antibody directed to the influenza A virus in the complex is between 1:0.02 and 1:200.15. The method of claim 12 , wherein the antibody directed to the influenza A virus bind to at least one epitope selected from the group consisting of i) an epitope comprising an amino acid residue selected from the group consisting of the amino acids at positions 18 claim ...

NOVEL PEPTIDE AND USE THEREOF

The invention provides a peptide and an immunostimulant or hair grower containing the peptide as an active ingredient, as well as a method for hair growth or regrowth promotion by administering an effective amount of the peptide to a mammal. The peptide has 23 or less amino acids and includes the amino acid sequence LHRLKRLRKRL (SEQ ID NO: 1), preferably the amino acid sequence LHRLKRLRKRLK (SEQ ID NO: 9). 1. A method for hair growth or regrowth promotion , comprising administering an effective amount of a peptide of 23 or less amino acids comprising the amino acid sequence LHRLKRLRKRLK (SEQ ID NO: 9) to a mammal.2. The method of claim 1 , wherein the peptide comprises the amino acid sequence ELKLIFLHRLKRLRKRLKRK (SEQ ID NO: 2) or an amino acid sequence having 90% or more identity with the amino acid sequence ELKLIFLHRLKRLRKRLKRK.3. The method of claim 2 , wherein the peptide is amidated at the C-terminus.4. The method of claim 3 , wherein the peptide is acetylated at the N-terminus5. The method of claim 2 , wherein the peptide is acetylated at the N-terminus.6. The method of claim 1 , wherein the peptide is amidated at the C-terminus.7. The method of claim 6 , wherein the peptide is acetylated at the N-terminus.8. The method of claim 1 , wherein the peptide is acetylated at the N-terminus. This patent application is a divisional of copending U.S. patent application Ser. No. 15/514,310, filed on Mar. 24, 2017, which is the U.S. national phase of International Patent Application No. PCT/JP2015/077139, filed Sep. 25, 2015, which claims the benefit of Japanese Patent Application No. 2014-197386, filed on Sep. 26, 2014, which are incorporated by reference in their entireties herein.Incorporated by reference in its entirety herein is a computer-readable nucleotide/amino acid sequence listing submitted concurrently herewith and identified as follows: 3,902 bytes ASCII (Text) file named “740543SequenceListing.txt,” created Sep. 14, 2018.The present invention relates to a ...

METHOD FOR TREATING CANCER USING ARTIFICIAL ADJUVANT CELL (aAVC)

[Problem to be Solved]Provided is an effective and safe method for treating or preventing a cancer using aAVC.[Solution]The present invention finds suitable ranges of the dose of α-GalCer loaded on aAVC cell surface, and the amount of α-GalCer loaded on aAVC cell surface in a pharmaceutical composition comprising aAVC, which are preferred in terms of securing effectiveness and safety in the treatment and prevention of a cancer using aAVC, and provides an effective and safe method for treating or preventing a cancer using aAVC, aAVC for effective and safe treatment or prevention of a cancer, and a pharmaceutical composition comprising the same, etc.

Multivalent Stable Vaccine Composition and Methods of Making Same

Stable immunogenic composition capable of eliciting a robust and durable immune response yielding a measurable increase in neutralizing antibodies at least 200 days post-administration, comprising at least one antigen consisting of a ribosome inactivating protein and at least one antigen comprising a toxin derived from bacterial spores. Method making and using a stable immunogenic composition capable of eliciting a stable immune response yielding a measurable increase in neutralizing antibodies at least 200 days post-administration, comprising providing an immunogenic composition comprising at least one antigen comprising a ribosome inactivating protein and at least one antigen comprising a toxin derived from bacterial spores and administering the immunogenic composition to an individual. 1. An immunogenic composition comprising a first antigen comprising a ribosome inactivating protein and a second antigen comprising a toxin derived from bacterial spores , wherein the immunogenic composition is formulated to elicit protective immunity to each of the first and second antigenic components without causing immune interference between the first and the second antigens after administration to an individual.2. The composition of claim 1 , wherein the composition yields a measurable increase in neutralizing antibodies to the first antigen comprising the ribosome inactivating protein.3. The composition of claim 1 , wherein the composition is capable of yielding a measurable increase in neutralizing antibodies to the second antigen comprising a toxin derived from bacterial spores.4. The composition of claim 1 , wherein the composition is capable of yielding a measurable increase in neutralizing antibodies to both the first and the second antigen.5. The composition of claim 1 , wherein the composition elicits a measurable increase in neutralizing antibodies to the first antigen at least 200 days post-administration.6. The composition of claim 1 , wherein the composition ...

METHOD FOR TREATING A beta-AMYLOIDOSIS

The present invention relates to a composition comprising at least one mimotope of an epitope of alpha-synuclein for use in a method for preventing and/or treating β-amyloidoses including Alzheimer's disease, wherein said at least one mimotope is coupled or fused to a pharmaceutically acceptable carrier protein selected from the group consisting of a non-toxic diphtheria toxin mutant, keyhole limpet hemocyanin (KLH), diphtheria toxin (DT), tetanus toxid (TT) and protein D (protein D). 1. A method for treating a β-amyloidosis , a disease associated with β-amyloid formation and/or aggregation , comprising administering to a subject in need thereof at least one mimotope of an epitope of alpha-synuclein ,{'i': 'Haemophilus influenzae', 'wherein said at least one mimotope is coupled or fused to a pharmaceutically acceptable carrier protein selected from the group consisting of a non-toxic diphtheria toxin mutant, keyhole limpet hemocyanin (KLH), diphtheria toxin (DT), tetanus toxid (TT) and protein D (protein D).'}2. The method according to claim 1 ,wherein the non-toxic diphtheria toxin mutant is selected from the group consisting of CRM 197, CRM 176, CRM 228, CRM 45, CRM 9, CRM 102, CRM 103 and CRM 107, in particular CRM 197.3. The method according to claim 1 ,wherein the at least one mimotope is formulated with at least one adjuvant.4. The method according to claim 1 ,wherein at least one adjuvant stimulates the innate immune system.5. The method according to claim 1 ,wherein at least one adjuvant that stimulates the innate immune system comprises or consists of a Toll-like receptor (TLR) agonist.6. The method according to claim 5 ,wherein the TLR agonist is selected from the group consisting of monophosphoryl lipid A (MPL), 3-de-O-acylated monophosphoryl lipid A (3D-MPL), poly I:C, GLA, flagellin, R848, imiquimod and CpG.7. The method according to claim 1 ,wherein the at least one adjuvant comprises or consists of a saponin, preferably QS21, a water in oil emulsion ...

XBP1, CD138, AND CS1 PEPTIDES

The disclosure features, inter alia, immunogenic XBP1-, CD138-, and CS1-derived peptides (and pharmaceutical compositions thereof). The peptides can be used in a variety of methods such as methods for inducing an immune response, methods for producing an antibody, and methods for treating a cancer (e.g., a plasma cell disorder such as multiple myeloma or Waldenstrom's macroglobulinemia). The peptides can also be included in MHC molecule multimer compositions and used in, e.g., methods for detecting a T cell in a population of cells. 1128-. (canceled)129. A composition comprising:(a) a first XBP-1 peptide comprising the amino acid sequence of SEQ ID NO:6, up to 10 amino acids immediately N-terminal of SEQ ID NO: 6, and up to 10 amino acids immediately C-terminal of SEQ ID NO: 6,(b) a second XBP-1 peptide comprising the amino acid sequence of SEQ ID NO:10, up to 10 amino acids immediately N-terminal of SEQ ID NO: 10, and up to 10 amino acids immediately C-terminal of SEQ ID NO: 10, and(c) a CD138 peptide comprising the amino acid sequence of SEQ ID NO:12, up to 10 amino acids immediately N-terminal of SEQ ID NO: 12, and up to 10 amino acids immediately C-terminal of SEQ ID NO: 12.130. The composition of claim 129 , wherein:(a) the first XBP-1 peptide comprises up to 5 amino acids immediately N-terminal of SEQ ID NO: 6, and up to 5 amino acids immediately C-terminal of SEQ ID NO: 6;(b) the second XBP-1 peptide comprises up to 5 amino acids immediately N-terminal of SEQ ID NO: 10, and up to 5 amino acids immediately C-terminal of SEQ ID NO: 10; and(c) the CD138 peptide comprises up to 5 amino acids immediately N-terminal of SEQ ID NO: 12, and up to 5 amino acids immediately C-terminal of SEQ ID NO: 12.131. The composition of claim 129 , wherein:(a) the first XBP-1 peptide consists of the amino acid sequence of SEQ ID NO: 6;(b) the second XBP-1 peptide consists of the amino acid sequence of SEQ ID NO: 10; and(c) the CD138 peptide consists of the amino acid sequence of ...

ADJUVANT COMPOSITION CONTAINING AT LEAST ONE INFLUENZA VIRUS NEUTRALIZING AND BINDING MOLECULE AND VACCINE COMPOSITION CONTAINING SAME

This invention relates to an adjuvant composition containing at least one binding molecule for neutralizing influenza virus and a vaccine composition containing the same. The composition containing at least one binding molecule for neutralizing influenza virus is capable of increasing the effects of a vaccine, and can thus be used as an adjuvant, which increases an immune response upon vaccine administration, and is very useful in the prevention of diseases caused by viruses. 1. An adjuvant composition , comprising at least one binding molecule for neutralizing an influenza virus.2. The adjuvant composition of claim 1 , wherein the binding molecule binds to an epitope in a stem region of a hemagglutinin (HA) protein of an influenza A virus.3. The adjuvant composition of claim 1 , wherein an epitope of the binding molecule is at least one selected from the group consisting of i) an epitope comprising any one amino acid residue selected from the group consisting of amino acids at positions 18 claim 1 , 25 claim 1 , 27 claim 1 , 32 claim 1 , 33 claim 1 , 38 claim 1 , 40 claim 1 , 54 claim 1 , 55 claim 1 , 278 claim 1 , 291 claim 1 , 292 claim 1 , 310 claim 1 , 311 claim 1 , 312 and 318 of an HA1 polypeptide; and ii) an epitope comprising any one amino acid residue selected from the group consisting of amino acids at positions 18 claim 1 , 19 claim 1 , 20 claim 1 , 21 claim 1 , 38 claim 1 , 39 claim 1 , 41 claim 1 , 42 claim 1 , 45 claim 1 , 46 claim 1 , 48 claim 1 , 49 claim 1 , 52 claim 1 , 53 claim 1 , 56 claim 1 , 57 claim 1 , 58 claim 1 , 60 and 99 of an HA2 polypeptide.4. The adjuvant composition of claim 1 , wherein the at least one binding molecule is at least one selected from the group consisting of i) a binding molecule claim 1 , comprising a light-chain variable domain including a CDR1 region of SEQ ID NO:1 claim 1 , a CDR2 region of SEQ ID NO:2 and a CDR3 region of SEQ ID NO:3 claim 1 , and a heavy-chain variable domain including a CDR1 region of SEQ ID NO: ...

CD200 INHIBITORS AND METHODS OF USE THEREOF

The present invention provides in certain embodiments conjugates comprising at least one CD200 inhibitor and an adjuvant, and methods of reversing or modulating immune suppression in a patient having a disease or disorder arising from abnormal cell growth, function or behavior, which method comprises administering to a patient in need thereof a composition comprising a CD200 inhibitor and an adjuvant. 1. A conjugate comprising at least one CD200 inhibitor operably linked to an adjuvant.2. The conjugate of claim 1 , wherein the CD200 inhibitor is a peptide having a length of 5 to 20 amino acids.3. The conjugate of claim 2 , wherein the peptide is 90% identical to amino acid sequence SEQ ID NO:1 claim 2 , SEQ ID NO:2 claim 2 , SEQ ID NO:3 claim 2 , SEQ ID NO:4 claim 2 , SEQ ID NO:5 claim 2 , SEQ ID NO:8 or SEQ ID NO:9.4. The conjugate of claim 1 , wherein the adjuvant is a toll-like receptor (TLR) ligand.5. The conjugate of claim 4 , wherein the adjuvant is a CpG ODN claim 4 , Annexin A2 claim 4 , or Poly ICLC claim 4 , or a fragment thereof.6. The conjugate of claim 5 , wherein the adjuvant is a fragment Annexin A2 claim 5 , and the fragment of Annexin A2 is the first 12-100 amino acid residues of the N-terminus of Annexin A2.7. The conjugate of claim 5 , wherein the adjuvant is a fragment Annexin A2 claim 5 , and the fragment of Annexin A2 is the first 15 amino acid residues of the N-terminus of Annexin A2.8. The conjugate of claim 5 , wherein the adjuvant is MSTVHEILCKLSLEG (SEQ ID NO: 10).9. The conjugate of claim 1 , wherein the adjuvant is linked to the CD200 inhibitor by means of a covalent bond or by means of a linking group.10. A composition comprising the conjugate of and a pharmaceutically acceptable carrier or diluent.11. The composition of claim 10 , further comprising at least one additional CD200 inhibitor.12. The composition of claim 10 , further comprising a cancer vaccine.13. The composition of claim 12 , wherein the cancer vaccine is a tumor lysate ...

Artificial promiscuous t helper cell epitopes that facilitate targeted antibody production with limited t cell inflammatory response

The present invention is directed to novel heterologous promiscuous and artificial T helper cell epitopes (Th epitopes) designed to provide optimum immunogenicity of a target antigenic site. The disclosed Th epitopes, when covalently linked to a B cell epitope in a peptide immunogen construct, elicit a strong antibody response to the B cell epitope of the target antigenic site. The Th epitopes are immunosilent on their own, i.e., little, if any, of the antibodies generated by the peptide immunogen constructs will be directed towards the Th epitope, thus allowing a very focused immune response directed to the targeted antigenic site. The heterologous promiscuous Th epitopes provide effective and safe peptide immunogens that do not generate inflammatory, anti-self, cell-mediated immune responses following administration.

KIDNEY-SPECIFIC TUMOR VACCINE DIRECTED AGAINST KIDNEY TUMOR ANTIGEN G-250

This invention provides an anti-cancer immunogenic agent(s) (e.g. vaccines) that elicit an immune response specifically directed against renal cell cancers expressing a G250 antigenic marker. Preferred immunogenic agents comprise a chimeric molecule comprising a kidney cancer specific antigen (G250) attached to a granulocyte-macrophage colony stimulating factor (GM-CSF). The agents are useful in a wide variety of treatment modalities including, but not limited to protein vaccination, DNA vaccination, and adoptive immunotherapy. 117-. (canceled)18. A nucleic acid encoding a fusion protein comprising a G250 kidney cancer specific antigen attached to a granulocyte macrophage colony stimulating factor (GM-CSF).19. The nucleic acid of claim 18 , wherein said nucleic acid is a deoxyribonucleic acid (DNA).20. The nucleic acid of claim 18 , wherein the G250 antigen is a human G250 antigen and the GM-CSF is a human GM-CSF.21. The nucleic acid of claim 20 , wherein the G250 antigen and the GM-CSF are joined by a peptide linker ranging in length from 2 to about 20 amino acids.22. The nucleic acid of claim 21 , wherein said peptide linker is -Arg-Arg-.23. The nucleic acid of claim 22 , wherein said nucleic acid encodes the polypeptide of SEQ ID NO: 1.24. The nucleic acid of claim 22 , wherein said nucleic acid comprises the nucleic acid of SEQ ID NO: 2.25. The nucleic acid of claim 20 , wherein said nucleic acid is present in an expression cassette.26. The nucleic acid of claim 20 , wherein said nucleic acid is present in a vector.27. (canceled)28. A host cell transfected with a nucleic acid comprising the nucleic acid of .29. The host cell of claim 28 , wherein said host cell is a eukaryotic cell.30. (canceled)31. A method of producing an anti-tumor vaccine claim 18 , said method comprising: culturing a cell transfected with a nucleic acid comprising the nucleic acid of under conditions where said nucleic expresses a G250-GM-CSF fusion protein; and recovering said fusion ...

DRUG COMBINATIONS

The invention provides combinations of derivatives of decitabine and other active agents, including T-cell activating agents, cancer vaccines, and adjuvants. Some derivatives of decitabine exhibit superior chemical stability and shelf life, with similar physiological activity. Methods of treating one or more myelodysplasia syndromes, cancers, haematological disorders, or diseases associated with abnormal haemoglobin synthesis using the combinations are described. 170-. (canceled)73. The method of claim 72 , wherein Rand Rare independently H claim 72 , OH claim 72 , OMe claim 72 , OEt claim 72 , OCHCHOMe claim 72 , OBn claim 72 , or F.74. The method of claim 72 , wherein X together with the oxygen atoms to which X is bound forms a phosphodiester.75. The method of claim 72 , wherein Rand Rare H.78. The method of claim 77 , wherein the pharmaceutically-acceptable salt is a sodium salt.79. The method of claim 71 , wherein the condition is a myelodysplastic syndrome (MDS).80. The method of claim 71 , wherein the condition is a cancer.81. The method of claim 71 , wherein the condition is a hematological disorder.82. The method of claim 71 , wherein the condition is a disease associated with abnormal hemoglobin synthesis.83. The method of claim 81 , wherein the hematological disorder is a leukemia.84. The method of claim 83 , wherein the leukemia is acute myeloid leukemia (AML).85. The method of claim 83 , wherein the leukemia is acute promyelocyte leukemia.86. The method of claim 83 , wherein the leukemia is acute lymphoblastic leukemia.87. The method of claim 83 , wherein the leukemia is chronic myelogenous leukemia.88. The method of claim 71 , wherein the T-cell activating agent is an anti-CTLA4 antibody.89. The method of claim 71 , wherein the T-cell activating agent is ipilimumab.90. The method of claim 77 , wherein the compound of Formula I or the pharmaceutically-acceptable salt thereof is administered before administration of the T-cell activating agent. This ...

NOVEL IMMUNOTHERAPY AGAINST SEVERAL TUMORS INCLUDING NEURONAL AND BRAIN TUMORS

The present invention relates to peptides, nucleic acids and cells for use in immunotherapeutic methods. In particular, the present invention relates to the immunotherapy of cancer. The present invention furthermore relates to tumor-associated cytotoxic T cell (CTL) peptide epitopes, alone or in combination with other tumor-associated peptides that serve as active pharmaceutical ingredients of vaccine compositions that stimulate anti-tumor immune responses. The present invention relates to 30 peptide sequences and their variants derived from HLA class I and class II molecules of human tumor cells that can be used in vaccine compositions for eliciting anti-tumor immune responses. 1. A method of treating a patient who has cancer , comprising administering to the patient an effective amount of an antibody specifically binding to an MHC class I or II molecule complexed with a HLA-restricted antigen consisting of the amino acid sequence of KIQEILTQV (SEO ID NO: 14) , wherein the cancer is selected from the group consisting of glioblastoma , renal cell carcinoma , melanoma , endometrial cancer , esophageal squamous cell carcinoma , pancreatic cancer , and urothelial cancer.2. The method of claim 1 , wherein the antibody is a polyclonal antibody claim 1 , a monoclonal antibody claim 1 , or a chimeric antibody.3. The method of claim 1 , wherein the antibody binds to the HLA-restricted antigen with a binding affinity of below 20 nanomolar.4. The method of claim 1 , wherein the antibody binds to the MHC class I molecule complexed with the HLA-restricted antigen.5. The method of claim 1 , wherein the antibody is humanized.6. The method of claim 1 , wherein the effective amount of the antibody is from about 1 μg/kg to about 100 mg/kg of body weight per day.7. The method of claim 1 , wherein the antibody is conjugated with a toxin.8pseudomonas. The method of claim 7 , wherein the toxin is selected from the group consisting of diptheria toxin claim 7 , exotoxin A claim 7 , ...

MUCOSAL ADJUVANT

A mucosal adjuvant may have high mucosal immunogenicity and high safety and be useful in the preparation of mucosal vaccines, and a mucosal vaccine composition may include the same. Such mucosal adjuvant may include TGDK. A method for preparing the mucosal vaccine composition may include mixing TGDK with an immunogen. 1. A mucosal adjuvant , comprising:TGDK.2. A mucosal adjuvant composition , comprising:TGDK; anda pharmaceutically acceptable carrier.3. A mucosal vaccine composition , comprising:{'claim-ref': {'@idref': 'CLM-00001', 'claim 1'}, 'the mucosal adjuvant of ; and'}an immunogen.4. The composition of claim 3 , wherein the immunogen is a whole particle or a split antigen of influenza virus.5. A method for preparing the mucosal vaccine composition of claim 3 , the method comprising:mixing TGDK with an immunogen.6. TGDK adapted for use as a mucosal adjuvant.7. A composition claim 3 , comprising:TGDK; andan immunogen,wherein the composition is suitable for use in mucosal vaccine therapy.89-. (canceled)10. A mucosal vaccine therapy claim 3 , comprising:administering an effective amount of a composition comprising TGDK and an immunogen to a subject in need thereof. The present invention relates to a mucosal adjuvant which enhances the mucosal immunity induction of an antigen.Mucosal vaccines initiate both mucosal local immunity and systemic immune response by the transmucosal (e.g., transnasal) administration of antigens, and can thereby construct double defense lines against pathogens. On the other hand, mucosal vaccines practically used are live vaccines having infectiveness or vaccines based on mucosotropic special toxins as antigens. Other inactivated antigens cannot induce sufficient immunity by single administration and need to be combined with adjuvants or the like.Heretofore, attenuated pathogens having infectiveness have been used as methods for initiating sufficient immunity with mucosal vaccines. However, attenuated live vaccines cause strong side ...

COMBINATION OF VACCINATION AND OX40 AGONISTS

The present invention relates to a vaccine/agonist combination comprising an RNA vaccine comprising at least one RNA comprising at least one open reading frame (ORF) coding for at least one antigen and a composition comprising at least one OX40 agonist. The present invention furthermore relates to a pharmaceutical composition and a kit of parts comprising the components of such a vaccine/agonist combination. Additionally the present invention relates to medical use of such a vaccine/agonist combination, the pharmaceutical composition and the kit of parts comprising such a vaccine/agonist combination, particularly for the prevention or treatment of tumor or cancer diseases or infectious diseases. Furthermore, the present invention relates to the use of an RNA vaccine in therapy in combination with an OX40 agonist. 1. A vaccine/agonist combination comprising:(i) as vaccine an RNA vaccine comprising at least one RNA comprising at least one open reading frame (ORF) coding for at least one antigen and(ii) as agonist a composition comprising an OX40 agonist.2. The combination according to claim 1 , wherein the OX40 agonist is a binding molecule which specifically binds to OX40.3. The combination according to or claim 1 , wherein the binding molecule is selected from the group consisting of an agonistic antibody or a nucleic-acid encoded agonistic antibody claim 1 , an aptamer claim 1 , a protein comprising an OX40 ligand or a nucleic-acid encoded OX40 ligand claim 1 , and a small molecule agonist.4. The combination according to claim 3 , wherein the agonistic antibody or an antigen binding fragment thereof claim 3 , or a nucleic-acid encoded agonistic antibody or an antigen binding fragment thereof claim 3 , is directed against OX40.5. The combination according to claim 4 , wherein the agonistic antibody directed against OX40 is monoclonal antibody 9B12.6. The combination according to claim 3 , wherein the protein comprising an OX40 ligand or a nucleic-acid encoded OX40 ...

Prostate cancer vaccine

Androgen receptor-based vaccines for eliciting an immune reaction in vivo against cells expressing androgen receptor are disclosed. The vaccines are useful in the treatment of prostate cancer. Also disclosed are methods for inducing immune reaction to androgen receptor or treating prostate cancer in a mammal, using the vaccines and pharmaceutical compositions comprising the vaccines.

Fusion Protein Comprising Diphtheria Toxin Non-Toxic Mutant CRM197 or Fragment Thereof

Provided in the present invention are a diphtheria toxin non-toxic mutant CRM197 or a fragment thereof as an adjuvant in a fusion protein and the use thereof to enhance the immunogenicity of a target protein fused therewith, for example, an HEV capsid protein, or an influenza virus M2 protein or an immunogenic fragment thereof. Also provided is a method for enhancing the immunogenicity of a target protein, comprising the fusion expression of the CRM197 or the fragment thereof with the target protein to form a fusion protein. Further provided is a fusion protein comprising the CRM197 or the fragment thereof and a target protein, the CRM197 or the fragment thereof enhancing the immunogenicity of the target protein. The present invention also provides an isolated nucleic acid encoding the fusion protein, a construct and a vector comprising said nucleic acid, and a host cell comprising the nucleic acid. 1. A method for enhancing immunogenicity of a target protein , comprising obtaining a fusion protein comprising CRM197 or a fragment thereof and the target protein , wherein said CRM197 or a fragment thereof enhances immunogenicity of the target protein.2. The method of claim 1 , wherein the fragment of CRM197 comprises Fragment A claim 1 , Transmembrane Domain T claim 1 , and/or Receptor Binding domain R of CRM197.3. The method of claim 2 , wherein the fragment of CRM197 comprises Fragment A claim 2 , or Fragment A and Transmembrane Domain T.4. The method of claim 2 , wherein the fragment of CRM197 comprises aa 1-190 of CRM197 claim 2 , or comprises aa 1-389 of CRM197.5. The method of claim 1 , wherein CRM197 has an amino acid sequence as set forth in SEQ ID NO: 2.6. The method of claim 1 , wherein the fusion protein is obtained by fusion expression of CRM197 or the fragment of CRM197 with the target protein claim 1 , optionally using a linker.7. The method of claim 1 , wherein the fusion protein comprises CRM197 or the fragment of CRM197 which is linked to the N- ...

ANTI-TUMOR COMPOSITIONS AND USES THEREOF

The present invention provides a composition for raising an immune response against a tumor. The composition comprises at least one tumor antigen, a saponin-based adjuvant, a TLR ligand and a Flt3 ligand. 1. A composition , the composition comprising at least one tumor antigen , a saponin-based adjuvant , a TLR ligand and a Flt3 ligand.2. The composition as claimed in in which the saponin-based adjuvant is ISCOMATRIX™ adjuvant.3. The composition as claimed in in which the Flt3 ligand is a chimera of human Flt3 ligand and human Fc.4. The composition as claimed in in which the TLR ligand is a TLR 3 ligand.5. The composition as claimed in which the TLR 3 ligand is Poly IC.6. The composition as claimed in in which the TLR ligand is a TLR 4 ligand.7. The composition as claimed in which the TLR 4 ligand is monophosphoryl lipid A (MPL).8. The composition as claimed in in which the TLR ligand is a TLR 5 ligand.9. The composition as claimed in which the TLR 5 ligand is Flagellin.10. The composition as claimed in in which the TLR ligand is a TLR 7/8 ligand.11. The composition as claimed in which the TLR 7/8 ligand is imidazoquinoline (R848).12. The composition as claimed in in which the TLR ligand is a TLR 9 ligand.13. The composition as claimed in which the TLR 9 ligand is CpG.14. A method of treating a tumor in a subject the method comprising administering to the subject a composition as claimed in .15. A method of protecting a subject against development of a tumor claim 1 , the method comprising administering to the subject a composition as claimed in prior to development of the tumor.16. A method of inducing an immune response against a tumor in a subject claim 1 , the method comprising administering to the subject a composition as claimed in . This application is a continuation of U.S. patent application Ser. No. 14/447,532, filed Jul. 30, 2014, which application claims convention priority from Australian Patent application No. 2013902846, filed Jul. 31, 2013, the ...

CHOLERA TOXIN CHIMERA AND ITS USE AS A STAPH VACCINE

The present invention relates to chimeric protein vaccines and methods of use thereof in the treatment of . One embodiment of the present invention provides a method of generating an immune response in a mammal, that includes administering to the mammal, a composition having a chimeric protein having at least one of: a portion of a cholera toxin, a portion of a heat-labile toxin, and a portion of a shiga toxin; and an antigen having at least one of: an antigenic material from and an antigenic material from a -specific polypeptide. 1S. aureus. An specific polypeptide antigen comprising a truncated iron-regulated surface determinant A (IsdA).2S. aureus. The specific polypeptide antigen of having a sequence of SEQ ID NO:4 or a protein with 90% homology thereto.3. The protein of claim 1 , wherein said (IsdA) protein comprises the amino acid sequence as set forth in SEQ ID NO: 5 or SEQ ID NO: 6.4. A chimeric protein comprising the antigen of and an adjuvant protein.5. The chimeric protein of comprising SEQ ID NO:4 or a protein with 90% homology thereto.6. The chimeric protein of wherein said adjuvant is selected form the group consisting of: a portion of cholera toxin claim 5 , a portion of heat labile toxin claim 5 , or a portion of shiga toxin.7. The chimeric protein of wherein said adjuvant is cholera toxin subunit A or B claim 6 , heat labile toxin subunit B claim 6 , or Shiga toxin subunit B.8. The chimeric protein of wherein said adjuvant is cholera toxin adjuvant protein is CTAor CTB.9. The chimeric protein of wherein the chimeric protein is assembled from a first polypeptide and a second polypeptide that are non-covalently linked.10. The chimeric protein of wherein the chimeric protein is a fusion protein.11. The chimeric protein of comprising a sequence of SEQ ID NO: 2 claim 8 , 3 claim 8 , 5 claim 8 , or 6 claim 8 , or a sequence with 90% homology thereto.12. An immunogenic composition comprising the chimeric protein of and a carrier.13. The immunogenic ...

SYNTHETIC TOLL-LIKE RECEPTOR-4 (TLR-4) AGONIST PEPTIDES

The invention provides novel immunological adjuvants and methods for identification of such adjuvants. The invention further provides methods and compositions for eliciting an immune response to an immunogen using the novel adjuvants. The adjuvants can be employed with any suitable immunogen, including proteins, peptides, lipids, and carbohydrates. The immunogen can be derived from a virus, a cancer, or a diseased cell. The elicited immune response can be cellular, humoral, or both. 1. A method of identifying an immunological adjuvant , which comprises isolating a compound that specifically binds to an anti-lipopolysaccharide (LPS) antibody or antigen binding fragment thereof , and activates NF-κB in a cell , wherein activation of NF-κB identifies the peptide as an immunological adjuvant.2. The method of claim 1 , wherein the anti-lipopolysaccharide antibody binds to LPS core.3. The method of claim 1 , wherein the anti-lipopolysaccharide antibody binds to lipid A.4. The method of claim 1 , wherein the anti-lipopolysaccharide antibody is 2D7/1.5. The method of claim 1 , wherein activation of NF-κB is indicated by nuclear localization of NF-κB in a cell.6. The method of claim 1 , wherein activation of NF-κB is indicated by secretion of one or more inflammatory cytokines from an antigen presenting cell.7. The method of claim 6 , wherein the antigen presenting cell is a macrophage.8. The method of claim 1 , wherein the compound is identified by screening a phage display library.9. The method of claim 1 , wherein the compound is a peptide.10. The method of claim 9 , wherein the peptide is from 4 to 10 amino acids in length.11. The method of claim 9 , wherein the peptide is from 7 to 15 amino acids in length.12. A method of inducing an immune response in a subject claim 9 , which comprises administering an immunogen and an adjuvant peptide to a subject in an amount effective to produce an immune response therein claim 9 , wherein said adjuvant peptide is administered in ...

In Vivo Activation of Antigen Presenting Cells for Enhancement of Immune Responses Induced by Virus-Like Particles

The invention relates to the finding that stimulation of antigen presenting cell (APC) activation using substances such as anti-CD40 antibodies or DNA oligomers rich in non-methylated C and G (CpGs) can dramatically enhance the specific T cell response obtained after vaccination with recombinant virus like particles (VLPs) coupled, fused or otherwise attached to antigens. While vaccination with recombinant VLPs fused to a cytotoxic T cell (CTL) epitope of lymphocytic choriomeningitis virus induced low levels cytolytic activity only and did not induce efficient anti-viral protection, VLPs injected together with anti-CD40 antibodies or CpGs induced strong CTL activity and full anti-viral protection. Thus, stimulation of APC-activation through antigen presenting cell activators such as anti-CD40 antibodies or CpGs can exhibit a potent adjuvant effect for vaccination with VLPs coupled, fused or attached otherwise to antigens.

DRUG COMBINATIONS

The invention provides combinations of derivatives of decitabine and other active agents, including T-cell activating agents, cancer vaccines, and adjuvants. Some derivatives of decitabine exhibit superior chemical stability and shelf life, with similar physiological activity. Methods of treating one or more myelodysplasia syndromes, cancers, haematological disorders, or diseases associated with abnormal haemoglobin synthesis using the combinations are described. 1. A combination comprising a compound of Formula I or a pharmaceutically-acceptable salt thereof:{'br': None, '(5-azacytosine group)-L-(guanine group)\u2003\u2003(I)'}wherein L is a phosphorous-containing linker wherein the number of phosphorus atoms in L is 1; and (a) a T-cell activating agent;', '(b) a cancer vaccine;', '(c) an IDO inhibitor; and', '(c) an adjuvant., 'one or more ancillary therapeutic component(s) selected from3. The combination of or , wherein Rand Rare independently H , OH , OMe , OEt , OCHCHOMe , OBn , or F.4. The combination of any one of the preceding claims wherein X together with the oxygen atoms to which X is bound forms a phosphodiester.5. The combination of any one of the preceding claims wherein Rand Rare H.6. The combination of any one of the preceding claims , wherein the compound of Formula I is any one of I-(1-44).9. The combination of wherein said salt is a sodium salt.10. The combination of any one of the preceding claims wherein the compound of Formula I or salt thereof is in the form of a formulation claim 8 , being dissolved in a substantially anhydrous solvent comprising about 45% to about 85% propylene glycol; about 5% to about 45% glycerin; and 0% to about 30% ethanol.11. The combination of wherein said solvent comprises about 65% to about 70% propylene glycol; about 25% to about 30% glycerin claim 10 , and 0% to about 10% ethanol.12. The combination of wherein said solvent comprises 65% to 70% propylene glycol and 25% to 30% glycerin claim 11 , any balance being ...

Fusion Protein Comprising Diphtheria Toxin Non-Toxic Mutant CRM197 or Fragment Thereof

Provided in the present invention are a diphtheria toxin non-toxic mutant CRM197 or a fragment thereof as an adjuvant in a fusion protein and the use thereof to enhance the immunogenicity of a target protein fused therewith, for example, an HEV capsid protein, or an influenza virus M2 protein or an immunogenic fragment thereof. Also provided is a method for enhancing the immunogenicity of a target protein, comprising the fusion expression of the CRM197 or the fragment thereof with the target protein to form a fusion protein. Further provided is a fusion protein comprising the CRM197 or the fragment thereof and a target protein, the CRM197 or the fragment thereof enhancing the immunogenicity of the target protein. The present invention also provides an isolated nucleic acid encoding the fusion protein, a construct and a vector comprising said nucleic acid, and a host cell comprising the nucleic acid.

METHODS AND MATERIALS FOR TREATING CANCER

This document provides methods and materials related to treating cancer. For example, methods and materials for using nucleic acid libraries to treat cancer are provided. 1. A method for treating cancer present in a mammal, wherein said method comprises administering, to said mammal, a nucleic acid library under conditions wherein nucleic acid members of said nucleic acid library are expressed in said mammal, thereby reducing the number of viable cancer cells present within said mammal. This application is a divisional application of U.S. Ser. No. 13/578,224, filed Aug. 9, 2012, which is a National Stage application under 35 U.S.C. § 371 and claims benefit of International Application No. PCT/US2011/024397, having an International Filing Date of Feb. 10, 2011, which claims the benefit of U.S. Provisional Application Ser. No. 61/303,222, filed Feb. 10, 2010. The disclosures of the prior applications are considered part of (and are incorporated by reference in) the disclosure of this application.This document relates to methods and materials involved in treating cancer. For example, this document provides methods and material for using nucleic acid libraries to treat cancer.Cancer is a serious illness that affects many people every year. In general, there are several common methods for treating cancer: surgery, chemotherapy, radiation therapy, immunotherapy, and biologic therapy. When initially diagnosed with cancer, a cancer specialist such as an oncologist can provide a patient with various cancer treatment options. Typically, an oncologist will recommend the best treatment plan based on the type of cancer, how far it has spread, and other important factors like the age and general health of the patient.This document provides methods and materials related to treating cancer. For example, this document provides methods and materials for using nucleic acid libraries to treat cancer. As described herein, a nucleic acid library can be used to deliver a large number of ...

Topical hyper-allergenic composition and method of treating using the same

A topical hyper-allergenic composition that includes a first protein that exhibits amyloid-β structure and immunogenicity in humans, a second protein that exhibits immunogenicity in humans, an immunologic adjuvant, and a carrier.

VACCINE DELIVERY METHOD

A vaccine delivery method is presented that includes a composition including as one component a slurry matrix that is a liquid at room temperature and a gel at physiological pH, physiological salt concentrations and/or physiological temperatures and as a second component one or more antigens. Also included are methods of inducing an immune response in a subject and vaccinating a subject by administering such compositions. 1. (canceled)2. A vaccine composition comprising a peptide hydrogel of the peptide scaffold RADARADARADARADA (SEQ ID NO:2) , an influenza antigen , and a TLR9 agonist.3. A vaccine composition comprising a peptide hydrogel of the peptide scaffold RADARADARADARADA (SEQ ID NO:2) , a hepatitis antigen , and a TLR9 agonist.4. The vaccine composition of claim 2 , wherein the TLR9 agonist comprises a CpG oligodeoxynucleotide (ODN).5. The vaccine composition of claim 2 , wherein the influenza antigen comprises an influenza A claim 2 , influenza B claim 2 , or influenza C antigen.6. The vaccine composition of claim 2 , wherein the influenza antigen comprises a recombinant nucleoprotein (rNP) influenza virus antigen.7. The vaccine composition of claim 2 , wherein the influenza antigen comprises a whole-inactivated influenza virus.8. The vaccine composition of claim 3 , wherein the hepatitis antigen comprises a hepatitis A claim 3 , hepatitis B claim 3 , or hepatitis C antigen.9. The vaccine composition of claim 3 , wherein the hepatitis antigen comprises a recombinant Hepatitis B antigen (rHepBag).10. The vaccine composition of claim 2 , wherein the vaccine composition is lyopholized.11. A method of producing an immune response in a subject claim 2 , the method comprising administering a vaccine composition of to the subject.12. A method of producing an immune response in a subject claim 3 , the method comprising administering a vaccine composition of to the subject.13. A method of vaccinating a subject to influenza claim 2 , the method comprising ...

Method for Treating Cancers by Alternating Immunotherapeutics and Directly Oncolytic Therapeutics

The present invention describes a unique immunotherapeutic method of treating cancer with the administration of CATS™ or an alternation of CATS™ immunotherapeutic followed by a directly oncolytic compound or agent, which protocol (BYES) can be by example an agent specifically targeting cancer stern cells, other cancer-specific growth pathways, radiotherapy, or compartmentalized chemotherapy. The BYES combination of CATS™ immunotherapeutic with cyclophosphamide delivers a very high statistical significant difference in survival and primary tumor control compared against either agent individually. 1. A method for treating cancer in a patient comprising:a. administering a therapeutically effective amount of a Cysteine-rich Adjuvant;b. causing a cessation of growth or regression of said cancer in said patient.2. The method of wherein said administering is initiated with a bolus dosing to arrest tumor progression.3. The method of wherein the metabolic breakdown of the Cysteine-rich Adjuvant is delayed by genetic modifications or other means claim 1 , producing a sustained action.4. The method of wherein said cancer is endstage.5. A method for treating cancer in a patient comprising:a. Administering a therapeutically effective dose of an immunotherapeutic thereby activating and priming the immune system to be on alert to fight the cancer;b. Administering a second therapeutically effective dose of an oncolytic agent to kill the cancer cells causing them to shed cancer antigens;c. Causing a cessation of growth or regression or cure of said cancer in said patient.6. The method of where the immunotherapeutic is a Cysteine-rich Adjuvant claim 5 , and the oncolytic agent is cyclophosphamide claim 5 , the oncolytic having an additional activity to antagonize TReg immune suppression.7. The method of where said cancer is at an advanced stage and/or extensively metastatic.8. The method of (b) where the oncolytic agent induces the cancer cell to undergo apoptosis.9. The method of ...

NOVEL IMMUNOADJUVANT FLAGELLIN-BASED COMPOUNDS AND USE THEREOF

The present invention relates to novel peptide compounds derived from flagellin originating from that exhibit an in vivo immune adjuvant activity. 1. An immunoadjuvant compound comprising:a) a N-terminal peptide having at least 90% amino acid identity with the amino acid sequence starting from the amino acid residue located at position 1 of SEQ ID NO 1 and ending at an amino acid residue selected from the group consisting of any one of the amino acid residues located at positions 99 to 173 of SEQ ID NO 1; andb) a C-terminal peptide having at least 90% amino acid identity with the amino acid sequence starting at an amino acid residue selected from the group consisting of any one of the amino acid residues located at positions 401 to 406 of SEQ ID NO 1 and ending at the amino acid residue located at position 494 of SEQ ID NO. 1, 'the said N-terminal peptide is directly linked to the said C-terminal peptide.', 'wherein2. The immunoadjuvant compound according to claim 1 , wherein the said N-terminal peptide is selected from the group consisting of the amino acid sequences 1-99 claim 1 , 1-137 claim 1 , 1-160 and 1-173 of SEQ ID NO 13. The immunoadjuvant compound according to claim 1 , wherein the said C-terminal peptide is selected from the group consisting of the amino acid sequences 401-494 and 406-494 of SEQ ID NO 14. The immunoadjuvant compound of claim 1 , wherein the said N-terminal and C-terminal peptides consist of the amino acid sequences 1-173 and 401-494 of SEQ ID NO 1 claim 1 , respectively5. The immunoadjuvant compound of claim 1 , wherein the said N-terminal and C-terminal peptides consist of the amino acid sequences 1-160 and 406-494 of SEQ ID NO 1 claim 1 , respectively.6. The immunoadjuvant compound of claim 1 , wherein the said N-terminal and C-terminal peptides consist of the amino acid sequences 1-137 and 406-494 of SEQ ID NO 1 claim 1 , respectively.7. The immunoadjuvant compound of claim 1 , wherein the said N-terminal peptide and the said C- ...

GRANULYSIN IN IMMUNOTHERAPY

Methods of stimulating or enhancing an immune response in a host are disclosed. The methods include contacting a monocyte with 15 kD granulysin thereby producing a monocyte-derived dendritic cell. In one example, the method further includes contacting the monocyte or monocyte-derived dendritic cell with a target antigen, such as a tumor antigen or an autoimmune antigen. In another embodiment, the method includes contacting the monocyte with an additional agent that enhances maturation of dendritic cells or induces immunological tolerance. The methods are of use in vivo, in vitro and ex vivo. In another aspect, the disclosure relates to compositions and methods for the treatment of tumors. 1. A method of enhancing an immune response against a target antigen , comprising administering to a subject in need thereof:(a) a therapeutically effective amount of the target antigen and a monocyte-derived dendritic cell produced by contacting a monocyte with an effective amount of 15 kD granulysin; or,(b) co-administering the target antigen and the 15 kD granulysin to the subject.2. The method of claim 1 , further comprising contacting the monocyte with an additional agent other than 15 kD granulysin that enhances dendritic cell maturation.3. The method of claim 2 , wherein the additional agent that enhances dendritic cell maturation comprises GM-CSF claim 2 , M-CSF claim 2 , IL-4 claim 2 , IL-6 claim 2 , IL-7 claim 2 , IL-13 claim 2 , flt-3L claim 2 , TNF-α claim 2 , IFN-α claim 2 , CpG motif containing oligonucleotides claim 2 , toll-like receptors claim 2 , heparan sulfate claim 2 , calcium ionophore claim 2 , or a combination thereof.4. The method of claim 1 , wherein the target antigen comprises a protein claim 1 , a polypeptide claim 1 , a polysaccharide claim 1 , a lipid claim 1 , a DNA molecule claim 1 , a RNA molecule claim 1 , a whole cell lysate claim 1 , an apoptotic cell claim 1 , a live claim 1 , attenuated claim 1 , or heat-killed antigen claim 1 , or a ...

Rabies Composition Comprising Pika Adjuvant

The present disclosure provides a rabies composition comprising IPRV and PIKA adjuvant, and the pharmaceutical use thereof. The present disclosure also discloses a method for prophylaxis or therapeutic treatment of rabies virus infection, the method comprises a step of administering the rabies vaccine composition to a host. The rabies composition is more stable and safe, and is able to induce earlier and higher titers of neutralizing antibody.

Non-digestible sugar-coated products and process

A method and composition are provided for coating a component to achieve colon-targeted delivery. A component is coated with a fructose-based non-digestible carbohydrate such as a inulin, fructo-oligosaccharide or neosugar. The coated component is orally administered to a monogastric animal. The non-digestible coating causes the composition to pass through the stomach and small intestine without being degraded, and delivers the component to the colon where the coating is digested by microbial fermentation and the component is released.

Oncolytic virus and checkpoint inhibitor combination therapy

The present invention pertains to a combination for simultaneous, separate or sequential use which comprises (a) an oncolytic virus and (b) a checkpoint inhibitor and to its use for the treatment of cancer.

GITR Antibodies And Methods Of Inducing Or Enhancing An Immune Response

The present invention provides binding molecules that specifically bind to GITR, e.g., human GITR (hGITR), on T cells and dendritic cells. Binding molecules of the invention are characterized by binding to hGITR with high affinity, in the presence of a stimulating agent, e.g., CD3, are agonistic, and abrogate the suppression of Teff cells by Treg cells. Various aspects of the invention relate to binding molecules, and pharmaceutical compositions thereof, as well as nucleic acids, recombinant expression vectors and host cells for making such binding molecules. Methods of using a binding molecule of the invention to detect human GITR or to modulate human GITR activity, either in vitro or in vivo, are also encompassed by the invention. 157-. (canceled)58. A method for inducing or enhancing an immune response in a subject , the method comprising:administering to the subject an agonistic GITR (glucocorticoid-induced TNFR family-related receptor)-binding antibody, or an antigen-binding fragment thereof, and an antigen, such that an immune response or an enhanced immune response occurs, wherein the antibody or antigen-binding fragment thereof comprises the light chain complementarity determining region (CDR) amino acid sequences shown in amino acid residues 44-54 of SEQ ID NO:2, amino acid residues 70-76 of SEQ ID NO:2, and amino acid residues 109-117 of SEQ ID NO:2, and heavy chain CDR amino acid sequences shown in amino acid residues 45-56 of SEQ ID NO:1, amino acid residues 119-127 of SEQ ID NO:1, and one of amino acid residues 71-86 of SEQ ID NO:1 and amino acid residues 71-86 of SEQ ID NO:66; andadministering to the subject an additional antibody or antigen-binding fragment thereof or giving the subject a treatment selected from the group consisting of chemotherapy and hormonal therapy.59. The method of claim 58 , wherein the subject comprises a source of antigen to which the immune response is directed.60. The method of claim 59 , wherein the source of antigen ...

COMPOSITION AND USES THEREOF

The present invention provides a particle comprising a fusion protein, wherein the fusion protein comprises at least one NANP repeat (SEQ ID NO: 7), some or all of the C-terminus of the CS protein from and a hepatitis B surface antigen, and wherein the particle comprises no, or substantially no, free hepatitis B surface antigen protein, and uses thereof. 1Plasmodium falciparumPlasmodium falciparum. A method of immunizing a subject against malaria/infection comprising administering to the subject an effective amount of a pharmaceutical composition or vaccine composition , the composition comprising (i) a fusion protein comprising at least one NANP repeat (SEQ ID NO: 7) , some or all of the C-terminus of the CS protein from and a hepatitis B surface antigen; and optionally (ii) a recombinant or non-recombinant modified vaccinia virus Ankara (MVA); and (iii) a pharmaceutically acceptable carrier or excipient.2. The method of claim 1 , wherein the fusion protein and the MVA are administered separately claim 1 , simultaneously claim 1 , or sequentially.3Plasmodium falciparum. A composition comprising (i) a fusion protein comprising at least one NANP repeat (SEQ ID NO: 7) claim 1 , the C-terminus of the CS protein from comprising the sequence: NKNNQGNGQGHNMPNDPNRNVDENANANSAVKNNNNEEPSDKIEKEYLNKIQNSLS TEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKICKMEKCSSVFN VVNSSIGI (SEQ ID NO: 6); or the sequence NKNNQGNGQGHNMPNDPNRNVDENANANSAVKNNNNEEPSDKHIKEYLNKIQ NSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKICKMEKCSSV (SEQ ID NO: 4) claim 1 , or a sequence with 90% or more sequence identity therewith claim 1 , and a hepatitis B surface antigen (HBsAg); and optionally (ii) a recombinant or non-recombinant modified vaccinia virus Ankara (MVA).4. The composition of claim 3 , wherein the fusion protein is provided as a virus-like particle claim 3 , the virus-like particle comprising no free HBsAg.5. The composition of claim 3 , wherein the fusion protein is RTS.6. The composition of claim 5 , ...

Cholera toxin chimera and its use as a staph vaccine

The present invention relates to chimeric protein vaccines and methods of use thereof in the treatment of Staphylococcus aureus . One embodiment of the present invention provides a method of generating an immune response in a mammal, that includes administering to the mammal, a composition having a chimeric protein having at least one of: a portion of a cholera toxin, a portion of a heat-labile toxin, and a portion of a shiga toxin; and an antigen having at least one of: an antigenic material from S. aureus and an antigenic material from a S. aureus -specific polypeptide.

Salmonella vaccine for the treatment of coronavirus

The present invention provides live-attenuated bacterium of the genus Salmonella comprising a recombinant plasmid encoding a fusion protein, wherein the fusion protein comprises a coronavirus antigen and an adjuvant peptide.

SYNTHETIC INNATE IMMUNE RECEPTOR LIGANDS AND USES THEREOF

An adjuvant formulation includes a monophosphoryl Lipid A (MPLA) analogue, a Pam3CSK4 analogue, or a muramyldipeptide (MDP) analogue, or combinations thereof. The adjuvant may be formulated in soluble form or in a nanoparticle, such as polylactic glycolic acid nanoparticles. A vaccine formulation comprises the adjuvant formulation and an immunogen. Methods of vaccinating an animal include delivering the vaccine formulation to the animal. 2. (canceled)3. (canceled)4. (canceled)5. (canceled)6. The adjuvant of claim 1 , wherein the peptide comprises one peptide or two peptides separated by a linker.7. The adjuvant of claim 6 , wherein the peptide comprises two peptides separated by a linker comprising an alkylene (CH) claim 6 , where n is an integer 1≤n≤20.8. The adjuvant of claim 7 , wherein 2≤n≤10.9. The adjuvant of claim 6 , wherein the peptide comprises two peptides separated by a linker and a first peptide comprises 4 to 7 amino acids.10. The adjuvant of claim 9 , where the first peptide comprises Ser claim 9 , Lys claim 9 , Asp claim 9 , Ala claim 9 , Gln and Lys claim 9 , or any combination thereof claim 9 , in any sequence including multiple repeats of any single amino acid.11. The adjuvant of claim 9 , wherein the first amino acid of the first peptide is Ser.12. The adjuvant of claim 9 , wherein the last amino acid of the first peptide is Lys.13. The adjuvant of claim 6 , wherein a second peptide comprises a chemotactic peptide.14. The adjuvant of claim 13 , wherein the chemotactic peptide is a tripeptide comprising Phe claim 13 , Leu and formyl Met.17. The adjuvant of claim 16 , wherein X is substituted or unsubstituted alkylene linker comprising between 6 to 20 carbon atoms.18. (canceled)19. (canceled)20. (canceled)21. The adjuvant of wherein R is a tripeptide comprising Ala claim 16 , IsoGln and Ser.23. (canceled)24. (canceled)25. (canceled)26. (canceled)27. (canceled)28. (canceled)29. An adjuvant formulation comprising a combination of at least two ...

LYMPHANGIOGENESIS FOR THERAPEUTIC IMMUNOMODULATION

The present invention concerns methods and compositions for evoking protective immune responses against pathogen infection or cancer. In certain embodiments, the methods and compositions comprise a lymphangiogenesis inducer and an antigen. 1. A method of eliciting an immune response to an antigen in a subject comprising administering to the subject one or more lymphangiogenesis inducers and an effective amount of the antigen.2. The method of claim 1 , wherein the one or more lymphangiogenesis inducers comprise vascular endothelial growth factor C (VEGF-C) or vascular endothelial growth factor D (VEGF-D).3. The method of or claim 1 , wherein the one or more lymphangiogenesis inducers comprise CCL21.4. The method of any of - claim 1 , wherein the antigen is bacterial antigen claim 1 , a viral antigen claim 1 , a fungal antigen claim 1 , a protozoal antigen claim 1 , a helminth antigen or a cancer antigen.5. The method of any of - claim 1 , wherein the lymphangiogenesis inducer and the antigen are administered in a single composition.6. The method of any of - claim 1 , wherein the lymphangiogenesis inducer and the antigen are provided over multiple administrations.7. The method of any of - claim 1 , wherein the subject is also administered an adjuvant.8. The method of any of - claim 1 , wherein the lymphangiogenesis inducer and the antigen are administered in a single composition comprising an adjuvant.9. The method of any of - claim 1 , wherein the lymphangiogenesis inducer and the antigen are administered in a single composition comprising a pharmaceutically acceptable excipient.10. The method of any of - claim 1 , wherein the composition is administered parenterally claim 1 , subcutaneously or intramuscularly.11. The method of any of - claim 1 , wherein the subject is administered an effective amount of a second antigen.12. The method of any of - claim 1 , wherein the lymphangiogenesis inducer is incorporated into a matrix.13. The method of claim 12 , wherein the ...

Cancer Therapy

Provided herein is technology relating to cancer treatment and prevention and particularly, but not exclusively, to compositions and methods related to therapies for prostate cancer. 1. A method for treating prostate cancer in a subject , the method comprising:(a) administering to a subject a vaccine comprising a nucleic acid comprising a nucleotide sequence from a prostatic acid phosphatase (PAP) gene wherein the nucleotide sequence encodes a polypeptide comprising an amino acid sequence at least 95% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: I, SEQ ID NO: 2, and SEQ ID NO: 3; and(b) administering to the subject a human programmed death receptor-I (PD-I) inhibitor selected from the group consisting of pembrolizumab and nivolumab, wherein the vaccine and the PD-I inhibitor are administered concurrently.2. The method of claim 1 , wherein the nucleic acid further comprises a transcriptional regulatory element and/or an immunostimulatory sequence.3. The method of claim 1 , wherein the subject is a human.4. The method of claim 1 , wherein the vaccine and the PD-I inhibitor are administered a plurality of times claim 1 , and wherein after the first concurrent administration of the vaccine and the PD-I inhibitor claim 1 , the vaccine is administered every 10 to 21 days and the PD-I inhibitor is administered every 17 to 24 days for a period of up to 90 days.5. The method of claim 4 , further comprising administering the vaccine every 10 to 21 days and the PD-I inhibitor every 17 to 24 days for a period of from 91 days to 365 days.6. The method of claim 5 , wherein patients that exhibit a decrease in PSA or tumor regression after 90 days are selected for the administration of the vaccine every 10 to 21 days and the PD-1 inhibitor every 17 to 24 days for a period of from 91 days to 365 days.7. The method of claim 5 , further comprising administering the vaccine every 10 to 21 days and the PD-1 inhibitor every 14 to 24 days for a ...

MYCOPLASMA VACCINES AND USES THEREOF

Immunogenic proteins comprising subsp. and subsp. proteins, encoding polynucleotides, a method for producing said proteins, and use of compositions to prevent subsp. infections are disclosed. 1. An immunogenic protein selected from:{'i': Mycoplasma mycoides', 'M. mycoides', 'mycoides', 'M. mycoides', 'capri, '(a) a fusion protein comprising two or more proteins selected from subsp. (Mmm) and subsp. (Mmc) proteins;'}(b) an Mmm or Mmc protein or fusion protein conjugated with an immunogenic carrier;(c) variants of the proteins of (a) and (b); or{'i': 'Mycoplasma', '(d) a protein corresponding to (a) or (b) from another strain, species or subspecies.'}2Mycoplasma. The immunogenic protein of claim 1 , wherein the Mmm or Mmc protein or fusion protein comprises an Mmm and/or Mmc protein listed in Table 1 or Table 4 claim 1 , variants thereof claim 1 , or the corresponding proteins from another strain claim 1 , species or subspecies.3. The immunogenic protein of claim 1 , wherein the Mmm or Mmc protein or fusion protein comprises(a) a protein comprising the amino acid sequence of SEQ ID NOS:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26 or 28;(b) an Mmm protein present in the fusion of SEQ ID NO:75;(c) an Mmm protein present in the fusion of SEQ ID NO:77;(d) variants of (a), (b) and (c); or{'i': 'Mycoplasma', '(e) the corresponding protein from another strain, species or subspecies.'}4. The immunogenic protein of claim 1 , wherein the fusion protein is selected from:(a) a protein comprising the amino acid sequence of SEQ ID NO:51;(b) a protein comprising the amino acid sequence of SEQ ID NO:53;(c) a protein comprising amino acids 927-1421 of SEQ ID NO:75;(d) a protein comprising amino acids 927-1468 of SEQ ID NO:77;(e) variants of (a), (b), (c) and (d); or{'i': 'Mycoplasma', '(f) a fusion protein comprising proteins corresponding to (a), (b), (c) and (d) from another strain, species or subspecies.'}5. The immunogenic protein of claim 1 , wherein the Mmm or Mmc protein ...

Combination of vaccination and ox40 agonists

The present invention relates to a vaccine/agonist combination comprising an RNA vaccine comprising at least one RNA comprising at least one open reading frame (ORF) coding for at least one antigen and a composition comprising at least one OX40 agonist. The present invention furthermore relates to a pharmaceutical composition and a kit of parts comprising the components of such a vaccine/agonist combination. Additionally the present invention relates to medical use of such a vaccine/agonist combination, the pharmaceutical composition and the kit of parts comprising such a vaccine/agonist combination, particularly for the prevention or treatment of tumor or cancer diseases or infectious diseases. Furthermore, the present invention relates to the use of an RNA vaccine in therapy in combination with an OX40 agonist.

Financial Method

The present invention provides a composition for raising an immune response against a tumor. The composition comprises at least one tumor antigen, a saponin-based adjuvant, a TLR ligand and a Flt3 ligand. 116-. (canceled)17. A method for providing paid selective personalized health care services to at least one individual in a population of individuals , comprising: (a) establishing a record of information representative of the status of an individual in the population; (b) analyzing said record according to one or more defined algorithms; (c) generating a recommendation to the at least one individual based upon said analysis , and (d) charging the at least one individual a fee for the recommendation , wherein if the status indicates that the at least one individual has a tumor or is at risk of developing a tumor , the recommendation that is generated recommends administration of a composition to the at least one individual , wherein the composition comprises at least one tumor antigen , a saponin-based adjuvant , a TLR ligand and a Flt3 ligand.181. The method of claim in which the saponin-based adjuvant is an ISCOMATRIX adjuvant.191. The method of claim in which the Flt3 ligand is a chimera of human Flt3 ligand and human Fc.201. The method of claim in which the TLR ligand is a TLR 3 ligand.214. The method of claim in which the TLR 3 ligand is Poly IC.221. The method of claim in which the TLR ligand is a TLR 4 ligand.236. The method of claim in which the TLR 4 ligand is monophosphoryl lipid A (MPL).241. The method of claim in which the TLR ligand is a TLR 5 ligand.258. The method of claim in which the TLR 5 ligand is Flagellin.261. The method of claim in which the TLR ligand is a TLR 7/8 ligand.2710. The method of claim in which the TLR 7/8 ligand is imidazoquinoline (R848).281. The method of claim in which the TLR ligand is a TLR 9 ligand.2912. The method of claim in which the TLR 9 ligand is CpG. This application is a continuation of U.S. patent application Ser. ...

VIRUS STRAINS

The present invention relates to non-laboratory virus strains, for example of herpes viruses such as HSV, with improved oncolytic and/or gene delivery capabilities as compared to laboratory virus strains. 1. Use of a modified , oncolytic , non-laboratory virus strain in the manufacture of a medicament for the oncolytic treatment of cancer.261-. (canceled) The present invention relates to non-laboratory virus strains, for example of herpes viruses such as HSV, with improved oncolytic and/or gene delivery capabilities as compared to laboratory virus strains.Viruses have been suggested or demonstrated to have utility in a variety of applications in biotechnology and medicine on many occasions. Each is due to the unique ability of viruses to enter cells at high efficiency. This is followed in such applications by either virus gene expression and replication and/or expression of an inserted heterologous gene. Thus viruses can either deliver and express genes in cells (either viral or other genes) which may be useful in for example gene therapy or the development of vaccines, or they may be useful in selectively killing cells by lytic replication or the action of a delivered gene in for example cancer.Herpes simplex virus (HSV) has been suggested to be of use both as a gene delivery vector in the nervous system and elsewhere and for the oncolytic treatment of cancer. In both applications the virus must however be disabled such that it is no longer pathogenic but such that it can still enter cells and perform the desired function. Thus for non-toxic gene delivery to target cells using HSV it has become apparent that in most cases immediate early gene expression must be prevented/minimised from the virus. For the oncolytic treatment of cancer, which may also include the delivery of gene(s) enhancing the therapeutic effect, a number of mutations to HSV have been identified which still allow the virus to replicate in culture or in actively dividing cells in vivo (e.g. in ...

HERPES VIRUS STRAINS

The present invention provides a herpes virus with improved oncolytic properties which comprises a gene encoding an immunomodulatory cytokine and which lacks a functional ICP gene and a functional ICP encoding gene. 1. A herpes virus which comprises a gene encoding an immunomodulatory protein , which lacks a functional ICP34.5 encoding gene and a functional ICP47 encoding gene and which is replication competent in tumour cells.243-. (canceled) This is a continuation application of U.S. patent application Ser. No. 13/600,711, filed Aug. 31, 2012, which is a continuation application of U.S. patent application Ser. No. 11/738,807, filed Apr. 23, 2007, now U.S. Pat. No. 8,277,818, which is a continuation application of U.S. patent application Ser. No. 10/181,697, filed Oct. 2, 2002, now U.S. Pat. No. 7,223,593, which is the U.S. National Phase of International Application PCT/GB01/00225, filed Jan. 22, 2001, which claims priority to United Kingdom Patent Application Numbers: 0001475.3, filed Jan. 21, 2000; 0002854.8, filed Feb. 8, 2000; 0100288.0, filed Jan. 5, 2001; and 0100430.8, filed Jan. 6, 2001, which are incorporated by reference herein in their entireties.The present invention relates to herpes virus strains with improved anti-tumour activity as compared to previously known strains.Viruses have been shown to have utility in a variety of applications in biotechnology and medicine on many occasions. Each is due to the unique ability of viruses to enter cells at high efficiency. This is followed in such applications by either virus gene expression and replication and/or expression of an inserted heterologous gene. Thus viruses can either deliver and express genes in cells (either viral or other genes) which may be useful in for example gene therapy or the development of vaccines, or they may be useful in selectively killing cells by lytic replication or the action of a delivered gene in for example cancer.Herpes simplex virus (HSV) has been suggested to be of use ...

ANTI-TUMOR COMPOSITIONS AND USES THEREOF

The present invention provides a composition for raising an immune response against a tumor. The composition comprises at least one tumor antigen, a saponin-based adjuvant, a TLR ligand and a Flt3 ligand. 1. A composition , the composition comprising at least one tumor antigen , a saponin-based adjuvant , a TLR ligand and a Flt3 ligand.2. The composition as claimed in in which the saponin-based adjuvant is ISCOMATRIXT™ adjuvant.3. The composition as claimed in in which the Flt3 ligand is a chimera of human Flt3 ligand and human Fc.4. The composition as claimed in in which the TLR ligand is a TLR 3 ligand.5. The composition as claimed in which the TLR 3 ligand is Poly IC.6. The composition as claimed in in which the TLR ligand is a TLR 4 ligand.7. The composition as claimed in which the TLR 4 ligand is monophosphoryl lipid A (MPL).8. The composition as claimed in in which the TLR ligand is a TLR 5 ligand.9. The composition as claimed in which the TLR 5 ligand is Flagellin.10. The composition as claimed in in which the TLR ligand is a TLR 7/8 ligand.11. The composition as claimed in which the TLR 7/8 ligand is imidazoquinoline (R848).12. The composition as claimed in in which the TLR ligand is a TLR 9 ligand.13. The composition as claimed in which the TLR 9 ligand is CpG.14. A method of treating a tumor in a subject the method comprising administering to the subject a composition as claimed in .15. A method of protecting a subject against development of a tumor claim 1 , the method comprising administering to the subject a composition as claimed in prior to development of the tumor.16. A method of inducing an immune response against a tumor in a subject claim 1 , the method comprising administering to the subject a composition as claimed in . This application claims convention priority from Australian Patent application No. 2013902846 filed 31 Jul. 2013, the disclosure of which is incorporated herein by cross referenceThe present invention relates to a compositions ...

PROSTATE CANCER VACCINE

Androgen receptor-based vaccines for eliciting an immune reaction in vivo against cells expressing androgen receptor are disclosed. The vaccines are useful in the treatment of prostate cancer. Also disclosed are methods for inducing immune reaction to androgen receptor or treating prostate cancer in a mammal, using the vaccines and pharmaceutical compositions comprising the vaccines. 1. A DNA vaccine comprising a plasmid vector comprising a polynucleotide operatively linked to a transcriptional regulatory element wherein the polynucleotide encodes a member selected from (i) a mammalian androgen receptor , (ii) a fragment of the androgen receptor that comprises a ligand-binding domain , (iii) a fragment of the ligand-binding domain defined by SEQ ID NO:9 , (iv) a fragment of the ligand-binding domain defined by SEQ ID NO:10 , (v) a fragment of the ligand-binding domain defined by SEQ ID NO:11 , and (vi) a fragment of the ligand-binding domain defined by SEQ ID NO:12 , wherein upon administration of said vaccine to a mammal a cytotoxic immune reaction against cells expressing androgen receptor is induced.2. The DNA vaccine of claim 1 , wherein the plasmid vector comprises(a) a backbone of pNGVL3;(b) a polynucleotide operably inserted therein wherein the polynucleotide encodes a member selected from (i) a mammalian androgen receptor, (ii) a fragment of the androgen receptor that comprises a ligand-binding domain, (iii) a fragment of the ligand-binding domain defined by SEQ ID NO:9, (iv) a fragment of the ligand-binding domain defined by SEQ ID NO:10, (v) a fragment of the ligand-binding domain defined by SEQ ID NO:11, and (vi) a fragment of the ligand-binding domain defined by SEQ ID NO:12; and optionally(c) an immunostimulatory sequence (ISS) motif.3. The DNA vaccine of claim 1 , wherein the plasmid vector comprises(a) a polynucleotide operatively linked to a CMV promoter wherein the polynucleotide encodes a member selected from (i) a mammalian androgen receptor, (ii) ...

IMMUNOMODULATING POLYNUCLEOTIDES, ANTIBODY CONJUGATES THEREOF, AND METHODS OF THEIR USE

Immunomodulating polynucleotides are disclosed. The immunomodulating polynucleotides may contain 5-modified uridine, 5-modified cytidine, a total of from 6 to 16 nucleotides, and/or one or more abasic spacers and/or internucleoside phosphotriesters. Also disclosed are conjugates containing a targeting moiety and one or more immunomodulating polynucleotides. The immunomodulating polynucleotides and conjugates may further contain one or more auxiliary moieties. Also disclosed are compositions containing the immunomodulating polynucleotides or the conjugates containing one or more stereochemically enriched internucleoside phosphorothioates. Further disclosed are pharmaceutical compositions containing the immunomodulating polynucleotides or the conjugates and methods of their use. 1446-. (canceled)449. The compound of claim 448 , wherein Z is S.450. The compound of claim 448 , wherein d is 1.451. The compound of claim 447 , wherein the PEG comprises a total of at least 20 ethylene glycol repeating units and a total of 30 or fewer ethylene glycol repeating units.452. The compound of claim 451 , wherein the PEG comprises a total of 25 ethylene glycol repeating units.453. The compound of claim 451 , wherein the PEG comprises a total of 24 ethylene glycol repeating units.454. The compound of claim 451 , wherein the PEG comprises a total of 23 ethylene glycol repeating units.455. The compound of claim 447 , wherein b is an integer ranging from 1 to 15 and the sum of b and c is an integer ranging from 5 to 15.456. The compound of claim 455 , wherein sum of b and c is 11.457. The compound of claim 455 , wherein sum of b and c is 12.458. The compound of claim 447 , wherein each Xis independently a 2′-deoxyribonucleotide selected from the group consisting of 2′-deoxyadenosine claim 447 , 2′-deoxyguanosine claim 447 , 2′-deoxycytidine claim 447 , a 5-halo-2′-deoxycytidine claim 447 , 2′-deoxythymidine claim 447 , 2′-deoxyuridine claim 447 , and a 5-halo-2′-deoxyuridine or a 2′- ...

Peptides and combination of peptides of non-canonical origin for use in immunotherapy against different types of cancers

The present invention relates to peptides, proteins, nucleic acids and cells for use in immunotherapeutic methods. In particular, the present invention relates to the immunotherapy of cancer. The present invention furthermore relates to tumor-associated T-cell peptide epitopes, alone or in combination with other tumor-associated peptides that can for example serve as active pharmaceutical ingredients of vaccine compositions that stimulate anti-tumor immune responses, or to stimulate T cells ex vivo and transfer into patients. Peptides bound to molecules of the major histocompatibility complex (MHC), or peptides as such, can also be targets of antibodies, soluble T-cell receptors, and other binding molecules. 1. A method of treating a patient who has cancer , comprising administering to said patient a population of activated T cells that kill cancer cells that present a peptide consisting of the amino acid sequence of SEQ ID NO: 1 or 2-101 ,wherein said cancer is selected from AML (acute myeloid leukemia), CRC (colorectal cancer), GBM (glioblastoma), HCC (hepatocellular carcinoma), HNSCC (head and neck squamous cell carcinoma), MEL (melanoma), NHL (non-Hodgkin lymphoma), NSCLC (non-small cell lung cancer), OC (ovarian cancer), OSCAR (esophageal cancer), PRCA (prostate cancer), RCC (renal cell carcinoma), SCLC (small cell lung cancer), UBC (urinary bladder carcinoma), and UEC (uterine endometrial cancer).2. The method of claim 1 , wherein the T cells are autologous to the patient.3. The method of claim 1 , wherein the T cells are obtained from a healthy donor.4. The method of claim 1 , wherein the T cells are obtained from tumor infiltrating lymphocytes or peripheral blood mononuclear cells.5. The method of claim 1 , wherein the activated T cells are expanded in vitro.6. The method of claim 1 , wherein the population of activated T cells are administered in the form of a composition.7. The method of claim 6 , wherein the composition further comprises an adjuvant.8. ...

PEPTIDES AND COMBINATION OF PEPTIDES OF NON-CANONICAL ORIGIN FOR USE IN IMMUNOTHERAPY AGAINST DIFFERENT TYPES OF CANCERS

The present invention relates to peptides, proteins, nucleic acids and cells for use in immunotherapeutic methods. In particular, the present invention relates to the immunotherapy of cancer. The present invention furthermore relates to tumor-associated T-cell peptide epitopes, alone or in combination with other tumor-associated peptides that can for example serve as active pharmaceutical ingredients of vaccine compositions that stimulate anti-tumor immune responses, or to stimulate T cells ex vivo and transfer into patients. Peptides bound to molecules of the major histocompatibility complex (MHC), or peptides as such, can also be targets of antibodies, soluble T-cell receptors, and other binding molecules. 1. A method of treating a patient who has cancer , comprising administering to said patient a population of activated T cells that kill cancer cells that present a peptide consisting of the amino acid sequence of SEQ ID NO: 2 , 1 , or 3-101 ,wherein said cancer is selected from BRCA (breast cancer), CRC (colorectal cancer), GBC (gallbladder cancer), GEJC (gastroesophageal junction cancer), HNSCC (head and neck squamous cell carcinoma), MEL (melanoma), NHL (non-Hodgkin lymphoma), NSCLC (non-small cell lung cancer), OC (ovarian cancer), OSCAR (esophageal cancer), PACA (pancreatic cancer), SCLC (small cell lung cancer), and UEC (uterine endometrial cancer).2. The method of claim 1 , wherein the T cells are autologous to the patient.3. The method of claim 1 , wherein the T cells are obtained from a healthy donor.4. The method of claim 1 , wherein the T cells are obtained from tumor infiltrating lymphocytes or peripheral blood mononuclear cells.5. The method of claim 1 , wherein the activated T cells are expanded in vitro.6. The method of claim 1 , wherein the population of activated T cells are administered in the form of a composition.7. The method of claim 6 , wherein the composition further comprises an adjuvant.8. The method of claim 7 , wherein the adjuvant is ...

PEPTIDES AND COMBINATION OF PEPTIDES OF NON-CANONICAL ORIGIN FOR USE IN IMMUNOTHERAPY AGAINST DIFFERENT TYPES OF CANCERS

The present invention relates to peptides, proteins, nucleic acids and cells for use in immunotherapeutic methods. In particular, the present invention relates to the immunotherapy of cancer. The present invention furthermore relates to tumor-associated T-cell peptide epitopes, alone or in combination with other tumor-associated peptides that can for example serve as active pharmaceutical ingredients of vaccine compositions that stimulate anti-tumor immune responses, or to stimulate T cells ex vivo and transfer into patients. Peptides bound to molecules of the major histocompatibility complex (MHC), or peptides as such, can also be targets of antibodies, soluble T-cell receptors, and other binding molecules. 1. A method of treating a patient who has cancer , comprising administering to said patient a population of activated T cells that kill cancer cells that present a peptide consisting of the amino acid sequence of SEQ ID NO: 71 , 1-70 , or 72-101 ,wherein said cancer is selected from CLL (chronic lymphocytic leukemia), GBM (glioblastoma), GC (gastric cancer), and MEL (melanoma).2. The method of claim 1 , wherein the T cells are autologous to the patient.3. The method of claim 1 , wherein the T cells are obtained from a healthy donor.4. The method of claim 1 , wherein the T cells are obtained from tumor infiltrating lymphocytes or peripheral blood mononuclear cells.5. The method of claim 1 , wherein the activated T cells are expanded in vitro.6. The method of claim 1 , wherein the population of activated T cells are administered in the form of a composition.7. The method of claim 6 , wherein the composition further comprises an adjuvant.8. The method of claim 7 , wherein the adjuvant is selected from anti-CD40 antibody claim 7 , imiquimod claim 7 , resiquimod claim 7 , GM-CSF claim 7 , cyclophosphamide claim 7 , sunitinib claim 7 , bevacizumab claim 7 , interferon-alpha claim 7 , interferon-beta claim 7 , CpG oligonucleotides and derivatives claim 7 , poly-(I:C) ...

Medicine

The present invention provides a medicine comprising a Toll-like receptor agonist, LAG-3 protein, a variant or derivative thereof.

IMMUNOTHERAPY AGAINST MELANOMA AND OTHER CANCERS

A method of treating a patient who has melanoma includes administering to said patient a composition containing a population of activated T cells that selectively recognize cells in the patient that aberrantly express a peptide. A pharmaceutical composition contains activated T cells that selectively recognize cells in a patient that aberrantly express a peptide, and a pharmaceutically acceptable carrier, in which the T cells bind to the peptide in a complex with an MHC class I molecule, and the composition is for treating the patient who has melanoma. A method of treating a patient who has melanoma includes administering to said patient a composition comprising a peptide in the form of a pharmaceutically acceptable salt, thereby inducing a T-cell response to the melanoma. 1. A method for treating a patient who has cancer comprising administering to the patient a population of activated T cells that selectively recognize cancer cells that present a peptide consisting of the amino acid sequence of FVYGEPREL (SEQ ID NO: 45) ,wherein said cancer is selected from the group consisting of melanoma, acute myelogenous leukemia, breast cancer, bile duct cancer, brain cancer, chronic lymphocytic leukemia, colorectal carcinoma, esophageal cancer, gallbladder cancer, gastric cancer, hepatocellular cancer, non-Hodgkin lymphoma, non-small cell lung cancer, ovarian cancer, pancreatic cancer, prostate cancer, renal cell cancer, small cell lung cancer, urinary bladder cancer, and uterine cancer.2. The method of claim 1 , wherein the T cells are autologous to the patient.3. The method of claim 1 , wherein the T cells are obtained from a healthy donor.4. The method of claim 1 , wherein the activated T cells are produced by contacting T cells with the peptide loaded human class I or II MHC molecules expressed on the surface of an antigen-presenting cell for a period of time sufficient to activate the T cells.5. The method of claim 1 , wherein the activated T cells are expanded in vitro ...

Immunotherapy against melanoma and other cancers

A method of treating a patient who has melanoma includes administering to said patient a composition containing a population of activated T cells that selectively recognize cells in the patient that aberrantly express a peptide. A pharmaceutical composition contains activated T cells that selectively recognize cells in a patient that aberrantly express a peptide, and a pharmaceutically acceptable carrier, in which the T cells bind to the peptide in a complex with an MHC class I molecule, and the composition is for treating the patient who has melanoma. A method of treating a patient who has melanoma includes administering to said patient a composition comprising a peptide in the form of a pharmaceutically acceptable salt, thereby inducing a T-cell response to the melanoma. 1. A method for treating a patient who has cancer comprising administering to the patient a population of activated T cells that selectively recognize cancer cells that present a peptide consisting of the amino acid sequence of ILLDRLFSV (SEQ ID NO: 91) ,wherein said cancer is selected from the group consisting of head-and-neck cancer, melanoma, acute myelogenous leukemia, breast cancer, bile duct cancer, brain cancer, chronic lymphocytic leukemia, colorectal carcinoma, esophageal cancer, gallbladder cancer, gastric cancer, hepatocellular cancer, non-Hodgkin lymphoma, non-small cell lung cancer, ovarian cancer, pancreatic cancer, prostate cancer, renal cell cancer, small cell lung cancer, urinary bladder cancer, and uterine cancer.2. The method of claim 1 , wherein the T cells are autologous to the patient.3. The method of claim 1 , wherein the T cells are obtained from a healthy donor.4. The method of claim 1 , wherein the activated T cells are produced by contacting T cells with the peptide loaded human class I or II MHC molecules expressed on the surface of an antigen-presenting cell for a period of time sufficient to activate the T cells.5. The method of claim 1 , wherein the activated T cells ...

Immunotherapy against melanoma and other cancers

A method of treating a patient who has melanoma includes administering to said patient a composition containing a population of activated T cells that selectively recognize cells in the patient that aberrantly express a peptide. A pharmaceutical composition contains activated T cells that selectively recognize cells in a patient that aberrantly express a peptide, and a pharmaceutically acceptable carrier, in which the T cells bind to the peptide in a complex with an MHC class I molecule, and the composition is for treating the patient who has melanoma. A method of treating a patient who has melanoma includes administering to said patient a composition comprising a peptide in the form of a pharmaceutically acceptable salt, thereby inducing a T-cell response to the melanoma. 1. A method for treating a patient who has cancer comprising administering to the patient a population of activated T cells that selectively recognize cancer cells that present a peptide consisting of the amino acid sequence of SLDEVAVSL (SEQ ID NO: 71) ,wherein said cancer is selected from the group consisting of melanoma, acute myelogenous leukemia, breast cancer, bile duct cancer, brain cancer, chronic lymphocytic leukemia, colorectal carcinoma, esophageal cancer, gallbladder cancer, gastric cancer, hepatocellular cancer, non-Hodgkin lymphoma, non-small cell lung cancer, ovarian cancer, pancreatic cancer, prostate cancer, renal cell cancer, small cell lung cancer, urinary bladder cancer, and uterine cancer.2. The method of claim 1 , wherein the T cells are autologous to the patient.3. The method of claim 1 , wherein the T cells are obtained from a healthy donor.4. The method of claim 1 , wherein the activated T cells are produced by contacting T cells with the peptide loaded human class I or II MHC molecules expressed on the surface of an antigen-presenting cell for a period of time sufficient to activate the T cells.5. The method of claim 1 , wherein the activated T cells are expanded in vitro ...

Immunotherapy against melanoma and other cancers

A method of treating a patient who has melanoma includes administering to said patient a composition containing a population of activated T cells that selectively recognize cells in the patient that aberrantly express a peptide. A pharmaceutical composition contains activated T cells that selectively recognize cells in a patient that aberrantly express a peptide, and a pharmaceutically acceptable carrier, in which the T cells bind to the peptide in a complex with an MHC class I molecule, and the composition is for treating the patient who has melanoma. A method of treating a patient who has melanoma includes administering to said patient a composition comprising a peptide in the form of a pharmaceutically acceptable salt, thereby inducing a T-cell response to the melanoma. 1. A method for treating a patient who has cancer comprising administering to the patient a population of activated T cells that selectively recognize cancer cells that present a peptide consisting of the amino acid sequence of VLKADVVLL (SEQ ID NO: 42) ,wherein said cancer is selected from the group consisting of melanoma, acute myelogenous leukemia, breast cancer, bile duct cancer, brain cancer, chronic lymphocytic leukemia, colorectal carcinoma, esophageal cancer, gallbladder cancer, gastric cancer, hepatocellular cancer, non-Hodgkin lymphoma, non-small cell lung cancer, ovarian cancer, pancreatic cancer, prostate cancer, renal cell cancer, small cell lung cancer, urinary bladder cancer, and uterine cancer.2. The method of claim 1 , wherein the T cells are autologous to the patient.3. The method of claim 1 , wherein the T cells are obtained from a healthy donor.4. The method of claim 1 , wherein the activated T cells are produced by contacting T cells with the peptide loaded human class I or II MHC molecules expressed on the surface of an antigen-presenting cell for a period of time sufficient to activate the T cells.5. The method of claim 1 , wherein the activated T cells are expanded in vitro ...

Combination Vaccine Devices and Methods of Killing Cancer Cells

The present invention comprises compositions, methods, and devices for enhancing an endogenous immune response against a cancer. Devices and methods provide therapeutic immunity to subjects against cancer. 1. A device comprising:a) an inhibitor of an immune-inhibitory protein;b) a scaffold composition;c) a cell recruitment composition; andd) a bioactive composition, wherein the bioactive composition is incorporated into or coated onto the scaffold composition, and wherein the bioactive composition causes modification of cells in or recruited to the device.2. The device of claim 1 , wherein the immune-inhibitory protein is selected from the group consisting of cytotoxic T-lymphocyte-associated antigen 4 (CTLA4) claim 1 , programmed cell death protein 1 (PD1) claim 1 , programmed cell death protein 1 ligand (PDL1) claim 1 , lymphocyte activation gene 3 (LAG3) claim 1 , B7-H3 claim 1 , B7-H4 claim 1 , and T cell membrane protein 3 (TIM3).3. The device of claim 2 , wherein the immune-inhibitory protein is CTLA4.4. The device of claim 2 , wherein the immune-inhibitory protein is PD1.5. The device of claim 1 , comprising an inhibitor of CTLA4 and an inhibitor of PD1.6. The device of claim 1 , wherein the inhibitor comprises a protein claim 1 , peptide claim 1 , or nucleic acid.7. The device of claim 2 , wherein the inhibitor comprises an antibody or fragment thereof.8. The device of wherein the antibody or fragment thereof binds to CTLA4.9. The device of claim 8 , wherein the antibody or fragment thereof is Ipilimumab claim 8 , Tremelimumab claim 8 , or a fragment thereof.10. The device of claim 2 , wherein the inhibitor binds to PD1 claim 2 , and wherein the inhibitor is a protein.11. The device of claim 10 , wherein the inhibitor is MDX-1106 claim 10 , MK3475 claim 10 , CT-011 claim 10 , AMP-224 claim 10 , or a fragment thereof.12. The device of claim 10 , wherein the inhibitor is a PDL2-immunoglobulin (Ig) fusion protein.13. The device of claim 2 , wherein the ...

IMMUNOGENIC COMPOSITION COMPRISING ELEMENTS OF C. DIFFICILE CDTB AND/OR CDTA PROTEINS

The present invention relates to immunogenic compositions comprising isolated CDTb and/or CDTa protein. In particular the isolated CDTb protein is suitably a truncated CDTb protein comprising the receptor binding domain or a mutated CDTb protein incapable of binding to CDTa, and the isolated CDTa protein is suitably a truncated CDTa protein which does not comprise the C-terminal domain. In particular the invention also relates to fusion proteins comprising a CDTa protein and a CDTb protein and also fusion proteins between an isolated toxin A protein and/or an isolated toxin B protein fused to a CDTb protein. 1Clostridium difficileClostridium difficile. An immunogenic composition comprising a fusion protein , said fusion protein comprising a binary toxin a (CDTa) protein sequence covalently linked to a binary toxin b (CDTb) protein sequence , wherein:(a) the CDTa protein sequence comprises the CDTa C-terminal domain, and(b) the CDTb protein sequence lacks the CDTb prodomain sequence and is selected from a sequence comprising amino acids 212-876 of SEQ ID NO: 3, SEQ ID NO:9, and a sequence having at least 95% sequence identity to SEQ ID NO:9.2. A vaccine comprising the immunogenic composition of and a pharmaceutically acceptable excipient.3C. difficile. A method of preventing or treating disease comprising administering the vaccine of to a human subject.4. The immunogenic composition of claim 1 , wherein said CDTa protein includes an amino acid substitution selected from R345K claim 1 , Q350A claim 1 , N385A claim 1 , R402A claim 1 , S388F claim 1 , E428Q claim 1 , and E430Q claim 1 , where the amino acid numbering corresponds to that of SEQ ID NO: 1.5. The immunogenic composition of claim 1 , wherein in said fusion protein claim 1 , the CDTa protein sequence and CDTb protein sequence are covalently linked via a peptide linker.6Clostridium difficileC. difficile. The immunogenic composition of claim 1 , wherein the immunogenic composition further comprises an isolated ...

Materials and methods for producing improved lentiviral vector particles

Materials and methods useful for generating highly mannosylated pseudotyped lentiviral vector particles comprising a Vpx protein are provided.

MATERIALS AND METHODS FOR MITIGATING IMMUNE-SENSITIZATION

The present invention concerns materials and method for delivery and internalization of an agent into a cell even in the presence of an immune response, such as antibodies or antisera or immune cells that bind to the agent. The agent can be a compound, drug, peptide, protein, nucleic acid, antigen, immunogen, or other biological molecule. In one embodiment, the agent is operatively linked to a lectin-based carrier. The present invention can be used for delivery and cellular internalization of any entity where an immune response to the entity is present or is likely to be produced or developed. The present invention also concerns methods and materials for providing for an adjuvant and carrier for vaccinations of a person or animal. The present invention also concerns a method for treating or preventing a disease or condition in a human or animal wherein the human or animal has produced or will produce an immune response against a therapeutic agent that can treat said disease or condition, the method comprising administering to the human or animal an effective amount of said therapeutic agent operatively linked to a lectin-based carrier. 1. A method for delivering an agent into a cell , in the presence of immune components against said agent , the method comprising providing said agent in an environment comprising said cell and comprising immune components directed against said agent , wherein said agent is operatively linked to a lectin-based carrier , and whereby said agent operatively linked to said lectin-based carrier is internalized into said cell by uptake mechanisms directed by the lectin-based carrier.2. The method according to claim 1 , wherein said immune components are immune cells or antibodies or antisera that bind to one or more epitopes of said agent.3. The method according to claim 1 , wherein said immune cells or antibodies or antisera are neutralizing.4. The method according to claim 1 , wherein said lectin-based carrier is a plant lectin claim 1 , ...

HETEROLOGOUS COMBINATION PRIME:BOOST THERAPY AND METHODS OF TREATMENT

The present disclosure provides a Farmington virus formulated to induce an immune response in a mammal against a tumour associated antigen. The Farmington virus may express an antigenic protein that includes an epitope from the tumour associated antigen. The Farmington virus may be formulated in a composition where the virus is separate from an antigenic protein that includes an epitope from the tumour associated antigen. The present disclosure also provides a prime:boost therapy for use in inducing an immune response in a mammal. The boost includes a Farmington virus, or a composition that includes a Farmington virus. 1. A Farmington virus comprising a nucleic acid that is capable of expressing a tumour associated antigen or an epitope thereof.2. The Farmington virus of claim 1 , wherein the genomic backbone of the Farmington virus encodes a protein having at least 90% sequence identity with any one of SEQ ID NOs 3-7.3. The Farmington virus of claim 2 , wherein the genomic backbone of the Farmington virus encodes a protein having at least 95% sequence identity with any one of SEQ ID NOs 3-7.4. The Farmington virus of any one of - claim 2 , wherein the tumour associated antigen is a foreign antigen.5. The Farmington virus of claim 4 , wherein the foreign antigen comprises E6 protein from HPV or E7 protein from HPV.6. The Farmington virus of claim any one of - claim 4 , wherein the tumour associated antigen is a self antigen.7. The Farmington virus of claim 6 , wherein the self antigen is MAGEA3.8. The Farmington virus of claim any one of - claim 6 , wherein the tumour associated antigen is a neoepitope.9. The Farmington virus of any one of - claim 6 , wherein the Farmington virus induces an immune response against the tumour associated antigen in a mammal to whom the Farmington virus is administered.10. The Farmington virus of claim 9 , wherein the mammal has been previously administered a prime that is immunologically distinct from the Farmington virus.11. The ...

Mutant fragments of ospa and methods and uses relating thereto

The present invention relates to compositions and methods for the prevention and treatment of Borrelia infection. Particularly, the present invention relates to a polypeptide comprising a hybrid C-terminal fragment of an outer surface protein A (OspA), a nucleic acid coding the same, an antibody specifically binding the same, a pharmaceutical composition (particularly for use as a medicament or in a method of treating or preventing a Borrelia infection) comprising the polypeptide and/or the nucleic acid and/or the antibody, a method of treating or preventing a Borrelia infection and a method of immunizing a subject.

PEPTIDE AGONISTS OF TOLL-LIKE RECEPTOR 5 LIGAND AND METHOD OF USE

The present invention refers to peptides functionally related to Toll-like receptor 5 (TLR-5) ligand, having a sequence of amino acids ordered by means of the protein informational analysis techniques using the informational spectrum method with reference to the informational properties of flagellin. The sequence has in the informational spectrum the frequency of virtually the same value as the frequency characteristic determining the flagellin/TLR-5 interaction. 1. An isolated polypeptide which polypeptide presents substantially the same frequencies as natural flagellin in the informational cross-spectrum with human toll-like receptor-5 (TLR-5) , obtained by Fourier transformation according to the method of the informational spectrum analysis , wherein in the informational spectrum as a dominant the frequency component F is in the region 0.404-0.407 , preferably 0.405.2. An isolated polypeptide according to having the general formula R1-L-R2 wherein: R1 is an amino terminal sequence claim 1 , L is flexible peptide linker comprising 10-14 amino acids claim 1 , R2 is the carboxy terminal sequence claim 1 , wherein both R1 and R2 have in their informational spectrum the dominant frequency component belonging to the frequency interval 0.404-0.407.3. An isolated polypeptide according to claim 2 , wherein R1 and R2 sequences consist in the general formula X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-X11-X12-X13-X14-X15-X16-17-X18-X19-X20-X21-X22-X23-X24-X25 (SEQ ID NO 3) claim 2 , wherein X1 is Val claim 2 , Leu claim 2 , lie or Asn claim 2 , X2 is Thr or Arg claim 2 , X3 is Val claim 2 , Leu claim 2 , Ile or Asn claim 2 , X4 is Met or Gln claim 2 , X5 is Val claim 2 , Leu claim 2 , lie or Asn claim 2 , X6 is Val claim 2 , Leu claim 2 , lie or Asn claim 2 , X7 is Val claim 2 , Leu claim 2 , lie claim 2 , Asn or Ala claim 2 , X8 is Val claim 2 , Leu claim 2 , Ile or Asn claim 2 , X9 is Asp claim 2 , X10 is Val claim 2 , Leu claim 2 , Ile or Asn claim 2 , X11 is Gly or Glu claim 2 , X12 ...

Uses and Compositions for Treatment of Rheumatoid Arthritis

The invention provides methods, uses and compositions for the treatment of rheumatoid arthritis. The invention describes methods and uses for treating rheumatoid arthritis wherein a TNFα inhibitor, such as a human TNFα antibody, or antigen-binding portion thereof. Also described are methods for determining the efficacy of a TNFα inhibitor for treatment of rheumatoid arthritis in a subject.

Adjuvant Formulations and Methods

The present invention is directed to methods for administering antigenic material to a patient as a vaccine against an infection comprising providing both an antigenic material specific to the desired immunological response desired plus an adjuvant comprised of a peptide of a sequence derived from the sequence of pneumococcal surface adhesin A protein (PsaA). Preferably the peptide comprises a sequences derived from one or more sequences of PsaA that contain the epitope regions or contiguous amino acids of SEQ ID NOs 1 or 2. The invention is also directed to vaccine compositions containing adjuvant of the invention and also adjuvant compositions of the invention. 1. A method of generating a protective immune response in a mammal that is protective against infection of a pathogen , comprising administering to said mammal a dose of an antigenic material and a peptide containing a sequence that comprises at least 12 contiguous amino acids of the sequence of PsaA with or without one or more conservative deletions , additions or substitutions.2. The method of claim 1 , wherein the amount of antigenic material per dose comprises one quarter or less of the amount of only antigenic material needed to generate a protective immune response in said mammal.3. The method of claim 2 , wherein the amount of antigenic material comprises one half or less of the amount of only antigenic material needed to generate the protective immune response in said mammal.4. The method of claim 1 , wherein the amount of peptide is from about 0.1 to 10.0 micrograms per antigen unit.5. The method of claim 1 , wherein the amount of peptide is from about 0.5 to 5.0 micrograms per antigen unit.6. The method of claim 1 , wherein the amount of peptide is from about 1.0 to 2.0 micrograms per antigen unit.7. The method of claim 1 , wherein the sequence comprises at least 18 contiguous amino acids of the sequence of PsaA with or without one or more conservative deletions claim 1 , additions or ...

COMPOSITIONS AND METHODS FOR METAL CONTAINING FORMULATIONS CAPABLE OF MODULATING IMMUNE RESPONSE

This disclosure provides compositions and methods for stimulating the innate immune response in a subject with agents capable of stimulating an innate immune response in a subject upon administration to the subject (e.g., damage-associated molecular patterns (DAMPs) and pathogen-associated molecular patterns (PAMPs)). In particular, the present invention is directed to compositions of DAMPs/PAMPs and metals ions, as well as systems and methods utilizing such nanoparticles (e.g., in diagnostic and/or therapeutic settings). 1. A composition comprising one or more DAMPs or PAMPs , and eithera) calcium phosphate and copolymers of cationic poly(ethylene imine) (PEI) and polyethylene glycol (PEG), poly(histidine)-polyethylene glycol (PH-PEG), lipid-poly-histidine, poly(lysine)-polyethylene glycol PEG(PK-PEG), or anionic poly(glutamic acid)-polyethylene glycol (PGA-PEG); or{'sup': 2+', '2+', '2+', '2+', '3+', '2+', '2+', '2+', '2+', '2+', '2+', '2+', '2+', '2+', '3+', '3+', '3+', '3+', '3+', '3+', '3+', '+', '+', '+', '+', '2+', '2+', '2+', '2+', '2+', '2+', '4+', '+', '+, 'b) one or more cations selected from the group consisting of Zn, Mn, Ca, Fe, Fe, Cu, Ni, Co, Pb, Sn, Ru, Au, Mg, VO, Al, Co, Cr, Ga, Tl, Ln, MoO, Cu, Au, Tl, Ag, Hg, Pt, Pb, Hg, Cd, Pd, Pt, Na, K, and relative phosphate or carbonate salt.'}26-. (canceled)7. The composition of claim 1 , wherein the one or more DAMPs or PAMPs are selected from STING agonists claim 1 , purine containing or purine derived agents claim 1 , Toll-Like receptor (TLR) agonists claim 1 , NOD-Like receptor (NLR) agonists claim 1 , RIG-I-Like receptor (RLR) agonists claim 1 , cytosolic DNA sensor (CDS) agonists claim 1 , C-type lectin receptor (CLR) agonists claim 1 , and inflammasome inducers.911-. (canceled)12. The composition of claim 1 ,wherein the composition is associated with a nanoparticle,wherein associated is selected from complexed, conjugated, encapsulated, absorbed, adsorbed, and admixed;wherein the nanoparticle is ...

ANTI-TUMOR DNA VACCINE

The present invention provides a pharmaceutical composition for treating a tumor, which is a micelle encapsulating at least one tumor-associated antigen gene. The present invention also provides a method for treating a tumor, comprising administering a micelle encapsulating at least one tumor-associated antigen gene to a patient in need of such treatment. 121-. (canceled)22. A pharmaceutical composition for treating a tumor , which is a micelle encapsulating at least one tumor-associated antigen gene and at least one adjuvant gene.23. The pharmaceutical composition of claim 22 , wherein the tumor-associated antigen gene is at least one selected from the group consisting of squamous cell carcinoma antigen recognized by T cells 3 (SART3) claim 22 , Y-box binding protein 1 (YB-1) claim 22 , Mucin 1 claim 22 , cell surface associated (MUC1) and Survivin.24. The pharmaceutical composition of or claim 22 , wherein the adjuvant gene is at least one selected from the group consisting of Granulocyte-macrophage colony-stimulating factor (GM-CSF) and CD40L.25. The pharmaceutical composition according to or claim 22 , wherein the adjuvant gene is any one of polynucleotide selected from the group consisting of (a) to (e) below:(a) a polynucleotide comprising the nucleotide sequence of SEQ ID NO: 13;(b) a polynucleotide encoding a protein consisting of the amino acid sequence of SEQ ID NO: 14;(c) a polynucleotide encoding a protein consisting of an amino acid sequence wherein 1 to 40 amino acids are deleted, substituted, inserted and/or added in the amino acid sequence of SEQ ID NO: 14, and having an activity of 28scFv(LH)-CD86 chimera;(d) a polynucleotide encoding a protein having an amino acid sequence having at least 85% homology to the amino acid sequence of SEQ ID NO: 14, and having an activity of 28scFv(LH)-CD86 chimera; and,(e) a polynucleotide which hybridizes to a polynucleotide consisting of a nucleotide sequence complementary to the nucleotide sequence of SEQ ID NO: 13 ...

Peptides and combination of peptides of non-canonical origin for use in immunotherapy against different types of cancers

The present invention relates to peptides, proteins, nucleic acids and cells for use in immunotherapeutic methods. In particular, the present invention relates to the immunotherapy of cancer. The present invention furthermore relates to tumor-associated T-cell peptide epitopes, alone or in combination with other tumor-associated peptides that can for example serve as active pharmaceutical ingredients of vaccine compositions that stimulate anti-tumor immune responses, or to stimulate T cells ex vivo and transfer into patients. Peptides bound to molecules of the major histocompatibility complex (MHC), or peptides as such, can also be targets of antibodies, soluble T-cell receptors, and other binding molecules.