КОМПОНЕНТЫ ДЛЯ ИСПОЛЬЗОВАНИЯ В СТЕРИЛЬНОМ ОКРУЖЕНИИ

Изобретение относится к медицине. Хирургический инструмент содержит первую часть и вторую часть. Первая часть герметично закрыта мембраной. Вторая часть содержит корпус хирургического инструмента и полость в корпусе хирургического инструмента. Полость выполнена с возможностью приема первой части. Вторая часть содержит первую область, содержащую сообщающееся с полостью отверстие, и закрывающий элемент, выполненный с возможностью перемещения между первым положением и вторым положением. Закрывающий элемент находится в герметизирующем контакте со второй областью, будучи в первом положении, и по меньшей мере частично не находится в герметизирующем контакте со второй областью, будучи во втором положении. Один или более электрических контактов в первой части или во второй части выполнены с возможностью прохождения через мембрану для установления соединения между первой частью и второй частью, когда закрывающий элемент перемещается из второго положения в первое положение. В результате часть инструмента ...

СПОСОБ (ВАРИАНТЫ) И СИСТЕМА ФИКСАЦИИ ГИБКОГО МНОГОПАНЕЛЬНОГО СТЕРИЛИЗАЦИОННОГО КОМПЛЕКТА

Изобретение относится к медицине и заключается в системе для обеспечения фиксации одноразового гибкого многопанельного барьерного комплекта вокруг подлежащего стерилизации предмета. Указанный комплект содержит барьерную панель, выполненную на основе листа проницаемого материала и имеющую по меньшей мере одну кромку. Барьерная панель предназначена для обертывания вокруг содержимого, подлежащего стерилизации. Комплект дополнительно содержит панель защиты сгибов, отходящую от барьерной панели. Панель защиты сгибов имеет проксимальный конец, прилежащий к барьерной панели, и дистальный конец, противолежащий проксимальному концу. После того как барьерная панель будет обернута вокруг содержимого, дистальный конец панели защиты сгибов закрывает одну или более кромок барьерной панели. Система фиксации содержит средства фиксации, служащие для удерживания панели в сложенной конфигурации. Изобретение относится также к способу фиксации указанного комплекта. Технический результат заключается в упрощении ...

ПОСТОБРАБОТКА МЕДИЦИНСКОГО УСТРОЙСТВА ДЛЯ РЕГУЛИРОВАНИЯ МОРФОЛОГИИ И МЕХАНИЧЕСКИХ СВОЙСТВ

Изобретение относится к медицине. Описан способ получения медицинского устройства с покрытием, в котором покрытие, содержащее терапевтический агент, диспергированный в полимерной или олигомерной матрице, наносят на внешнюю поверхность медицинского устройства. Затем покрытие подвергают постобработке с обеспечением селективного удаления значительной части полимерной или олигомерной матрицы из покрытия. Затем покрытие, прошедшее указанную последующую постобработку, стерилизуют. Способ осуществляет точную регулировку требуемого количества терапевтического агента, помещаемого на медицинское устройство. 19 з.п. ф-лы, 12 ил., 8 табл., 9 пр.

УСТАНОВКА ДЛЯ ОБРАБОТКИ МЕДИЦИНСКОГО ОБОРУДОВАНИЯ

Группа изобретений относится к установкам для обработки медицинского оборудования и, в частности, к мойке и дезинфекции эндоскопов. Установка (1) для обработки медицинского оборудования содержит очистительный бак (2), имеющий первое отверстие, выполненное с возможностью обеспечить возможность загрузки/выгрузки медицинского оборудования из первой камеры, и второе отверстие, выполненное с возможностью обеспечить возможность загрузки/выгрузки медицинского оборудования из второй камеры, первую дверную систему (30), плотно закрывающую первое отверстие, вторую дверную систему (31), плотно закрывающую второе отверстие. Установка также содержит разделительный интерфейс (4), выполненный с возможностью прикрепления к стене (М) и закрывания проема стены (ОМ), и подвижную часть (5), выполненную с возможностью демонтажа от разделительного интерфейса, содержащую независимую раму и по меньшей мере частично несущую по меньшей мере один насос, и по меньшей мере один электромагнитный клапан системы обработки ...

СПОСОБ ИЗГОТОВЛЕНИЯ СТЕРИЛИЗОВАННОГО И ТАРИРОВАННОГО МЕДИЦИНСКОГО УСТРОЙСТВА НА ОСНОВЕ БИОСЕНСОРА (ВАРИАНТЫ)

Изобретение относится к области изготовления медицинских устройств. Способ изготовления стерилизованного и тарированного медицинского устройства на основе биосенсора (например, медицинского устройства с объединенными в одно целое биосенсором и ланцетом), содержащее реагент биосенсора (например, реагент биосенсора из специфического фермента для анализируемого вещества и медиатора). Стерилизацию осуществляют, например, гамма-излучением. Затем тарируют реагент биосенсора стерилизованного медицинского устройства на основе биосенсора. Другой способ изготовления стерилизованного и тарированного медицинского устройства на основе биосенсора включает в себя вначале сборку и упаковывание множества медицинских устройств с реагентом биосенсора, затем стерилизацию облучением для создания множества стерилизованных, упакованных медицинских устройств на основе биосенсора. После этого тарируют стерилизованные и упакованные медицинские устройства на основе биосенсора. Тарирование можно выполнять, используя ...

СПОСОБ ПЛАЗМЕННОЙ ВАКУУМНОЙ СТЕРИЛИЗАЦИИ ИЗДЕЛИЙ

Способ используется преимущественно для стерилизации изделий. Изделия, подлежащие стерилизации, помещают в изолированную камеру и камеру вакуумируют. Плазма частиц остаточного газа генерируется в камере в течение начальной стадии вакуумирования. Это облегчает сушку изделий и преимущественно позволяет быстро достичь требуемого давления, чем без плазмы. В камеру инжектируют стерилизующий газ и генерируют вторую плазму для создания плазмы стерилизующего газа, таким образом стерилизуя изделия в камере. Способ обеспечивает повышение эффективности качества стерилизации и сокращение времени цикла. 4 с. и 14 з.п. ф-лы, 8 ил.

ДЕЗИНФИЦИРУЮЩАЯ КОМПОЗИЦИЯ, ИСПОЛЬЗУЕМАЯ ДЛЯ ДЕЗИНФИЦИРОВАНИЯ МЕДИЦИНСКОГО ОБОРУДОВАНИЯ, ИМЕЮЩЕГО МЕТАЛЛИЧЕСКИЕ ЧАСТИ

Изобретение относится к области санитарии и касается дезинфицирующих средств. Дезинфицирующая композиция, используемая для дезинфицирования медицинского оборудования, имеющего металлические части, содержит низкомолекулярную перкислоту, стабилизатор перкислоты и ингибитор коррозии, компоненты берут в определенных количественных соотношениях, причем перкислота не находится в состоянии равновесия, а композицию получают путем смешения двух растворов, один из которых включает низкомолекулярную перкислоту, а другой - ингибитор коррозии и стабилизатор пероксида и/или стабилизатор перкислоты. Предложенная двухмодульная композиция выполнена в виде двух модулей, при этом один модуль содержит первый водный раствор, включающий низшую алифатическую перкислоту, а другой модуль включает второй водный раствор, содержащий ингибитор коррозии и стабилизатор перекиси водорода и/или стабилизатор перкислоты. Композиция позволяет устранить коррозию металлов на оборудовании. 2 с. и 15 з.п. ф-лы.

СТЕТОСКОП

В первом варианте осуществления раскрыт стетоскоп, имеющий корпус, диафрагму и цельную кольцевую аксиально податливую подвеску. Кольцевая аксиально податливая подвеска установлена вокруг диафрагмы с внутренней стороны внутреннего периметра корпуса. При необходимости прижимная прокладка из сетчатого пеноматериала, имеющая кольцевую подвеску, герметично установлена по внутреннему или внешнему диаметру корпуса, при этом диафрагма представляет собой очень тонкую фольгу, предпочтительно выполненную из меди, чтобы обеспечить антимикробные свойства. Во втором варианте осуществления раскрыт стетоскоп, имеющий корпус и диафрагму, которая имеет гибкую замкнутую камеру, содержащую несжимаемую жидкость, подвешенную в корпусе стетоскопа. Прижимная прокладка из сетчатого пеноматериала, имеющая кольцевую подвеску, герметично установлена по внутреннему или внешнему диаметру корпуса. При необходимости диафрагма имеет крышку поверх верхнего торца подвешенной гибкой замкнутой камеры, предпочтительно выполненную ...

УСТАНОВКА ДЛЯ ОБРАБОТКИ МЕДИЦИНСКОГО ОБОРУДОВАНИЯ

СПОСОБЫ И СИСТЕМЫ ДЛЯ ОБРАБОТКИ МЕДИЦИНСКИХ УСТРОЙСТВ И ТЕКУЧИХ СРЕД

Группа изобретений относится к области дезинфекции и предназначена для уменьшения концентрации липополисахаридов на медицинских устройствах и в текучих средах, которые предназначены для контакта с человеческим телом или нахождения внутри человеческого тела. Для этого к раствору, содержащему один или более эндотоксинов в обнаруживаемых концентрациях, добавляют суспензию стеарата кальция. Группа изобретений относится также к способу обработки медицинских устройств и поверхности ткани млекопитающего путем их приведения в контакт с суспензией стеарата кальция в воде или в неводных растворителях. Группа изобретений обеспечивает простое и эффективное удаление липополисахаридов из различных растворов, в том числе биологических препаратов, а также с различных поверхностей. 3 н. и 11 з.п. ф-лы, 21 табл., 13 пр.

АППАРАТ И СПОСОБ СОЕДИНЕНИЯ ОБОРУДОВАНИЯ ДЛЯ СТЕРИЛИЗАЦИИ МЕДИЦИНСКИХ УСТРОЙСТВ

УСТРОЙСТВО И СПОСОБ СУШКИ ИНСТРУМЕНТОВ ПЕРЕГРЕТЫМ ПАРОМ

... 1. Устройство для сушки инструментов перегретым паром, содержащее ! камеру для размещения инструментов, причем камера имеет по меньшей мере один впускной канал; ! средство генерации пара для генерации перегретого пара; ! средство распределения, соединенное по меньшей мере с одним впускным каналом, для распределения перегретого пара, подаваемого от средства генерации пара через впускной канал, в камере; и ! средство удаления для продувки испаренной влаги из камеры. ! 2. Устройство по п.1, отличающееся тем, что средство удаления содержит по меньшей мере один выходной канал и по меньшей мере одно средство удаления влаги, соединенное с по меньшей мере одним выходным каналом, для удаления испаренной влаги из камеры. ! 3. Устройство по п.1, отличающееся тем, что средством распределения является коллектор, содержащий некоторое количество распределенных паровых каналов, соединенных некоторым количеством взаимно соединенных паропроводов, причем это количество взаимно соединенных паропроводов соединено ...

СИСТЕМА И СПОСОБ СТЕРИЛИЗАЦИИ ИМПЛАНТИРУЕМОГО МЕДИЦИНСКОГО УСТРОЙСТВА

... 1. Имплантируемая медицинская система, включающая ! имплантируемое медицинское устройство, сконструированное таким образом, чтобы располагаться в брюшной полости пациента; и ! внутренний модуль управления в электрической связи, по меньшей мере, с одним из имплантируемого медицинского устройства или внешнего устройства, и дополнительно включающий компоненты схемы, устойчивые к некоторому количеству радиации какого-либо типа. ! 2. Система по п.1, где компоненты схемы являются устойчивыми к некоторому количеству радиации, используемой в процессе стерилизации имплантируемого медицинского устройства. ! 3. Система по п.1, где имплантируемое медицинское устройство представляет собой ограничивающее устройство, сконструированное таким образом, чтобы производить ограничение проводящего пути. ! 4. Система по п.1, где, по меньшей мере, один из компонентов схемы изготовлен, по меньшей мере, частично, из радиационностойкого материала. ! 5. Система по п.4, где радиационностойкий материал выбран из группы ...

РАСШИРИТЕЛИ ОБЪЕМА ДЛЯ ЭНДОСКОПОВ

СТЕРИЛИЗАТОР И СПОСОБ СТЕРИЛИЗАЦИОННОЙ ОБРАБОТКИ

... 1. Стерилизатор, содержащий: ! источник подачи стерилизующего средства; ! первую стерилизационную камеру и вторую стерилизационную камеру, каждая из которых выполнена с возможностью заполнения стерилизующим средством, при размещении в камере объекта, для проведения стерилизационной обработки объекта; ! первый трубопровод, соединяющий источник подачи и каждую из первой стерилизационной камеры и второй стерилизационной камеры; !второй трубопровод, соединяющий первую стерилизационную камеру и вторую стерилизационную камеру; ! механизм подачи, выполненный с возможностью обеспечения для оставшейся части стерилизующего средства, использованного для стерилизационной обработки в первой стерилизационной камере, возможности ввода во вторую стерилизационную камеру по второму трубопроводу; ! выпускной трубопровод, соединенный с первой стерилизационной камерой одним концом упомянутого трубопровода, для выпуска газа, оставшегося в первой стерилизационной камере; и ! выпускной механизм, выполненный с ...

ВОЗБУЖДЕНИЕ ПЛАЗМЫ

Аппарат и способ для идентификации типа эндоскопа и обеспечения оптимальной повторной обработки

Устройство и способ для стерилизации эндоскопа

УСТРОЙСТВО ДЛЯ СТЕРИЛИЗАЦИИ ИЗДЕЛИЯ ПЕРОКСИДОМ ВОДОРОДА, СПОСОБ СТЕРИЛИЗАЦИИ ИЗДЕЛИЯ ПАРОМ ПЕРОКСИДА ВОДОРОДА, СПОСОБ СТЕРИЛИЗАЦИИ ИЗДЕЛИЯ ПЛАЗМОЙ ПЕРОКСИДА ВОДОРОДА, СПОСОБ СТЕРИЛИЗАЦИИ ИЗДЕЛИЯ ПЕРОКСИДОМ ВОДОРОДА, ГЕРМЕТИЗИРОВАННЫЙ КОЖУХ, СПОСОБ ПОЛУЧЕНИЯ НЕВОДНОГО КОМПЛЕКСА ПЕРОКСИДА ВОДОРОДА, ОРГАНИЧЕСКИЙ КОМПЛЕКС ПЕРОКСИДА ВОДОРОДА, КОМПЛЕКС КАРБОНАТ РУБИДИЯ - ПЕРОКСИД ВОДОРОДА

В изобретении используют пар пероксида водорода, выделяемый из неводного органического комплекса пероксида водорода, такого как комплекс мочевина-пероксид. Дополнительно можно использовать плазму в сочетании с паром. Также разработан способ получения неводных комплексов пероксида водорода. Эти комплексы используют в качестве источника пероксидного пара в стерилизаторах с паром пероксида водорода и в качестве компонента самостерилизующихся упаковочных материалов.

ИНСТРУМЕНТ ДЛЯ ОЧИСТКИ

... 1. Инструмент, применяемый для очистки крепежных поверхностей устройства, используемого в медицинских применениях, причем инструмент содержит корпус, имеющий открытый конец и закрытый конец, сжимаемую, впитывающую жидкость гибкую вставку из пеноматериала, ограниченную с возможностью высвобождения внутри корпуса с помощью установочной манжеты; обрабатывающую жидкость, расположенную внутри корпуса; и съемную крышку, герметизированную сверху открытого конца.2. Инструмент по п. 1, в котором установочная манжета посажена внутри корпуса.3. Инструмент по п. 1, в котором установочная манжета расположена между открытым концом и закрытым концом.4. Инструмент по п. 2, в котором вставка из пеноматериала ограничена с помощью установочной манжеты, перед тем как установочная манжета посажена внутри корпуса.5. Инструмент по п. 1, в котором установочная манжета содержит отверстие, обеспечивающее сообщение по текучей среде между первой секцией, расположенной между открытым концом и установочной манжетой, ...

СПОСОБ ДЛЯ ОЧИСТКИ, ДЕЗИНФЕКЦИИ И СТЕРИЛИЗАЦИИ МЕДИЦИНСКИХ ИНСТРУМЕНТОВ И УСТРОЙСТВО ДЛЯ ЕГО ОСУЩЕСТВЛЕНИЯ

... 1. Способ очистки, дезинфекции и стерилизации медицинских инструментов, содержащих протяженные каналы, преимущественно эндоскопов и стоматологических наконечников турбинных, в котором обрабатываемые медицинские инструменты размещают в камере, заполненной электропроводящей средой, и подвергают косвенному воздействию электрического тока, который подают на электроды, предварительно размещенные в камере и соединенные с источником питания без электропроводящего контакта медицинских инструментов с электродами, отличающийся тем, что для осуществления интенсивного косвенного воздействия электрическим током на медицинские инструменты их располагают в непосредственной близости от электродов: по меньшей мере, одного анода и катода, при этом воздействие электрическим током осуществляют при условии генерации микроплазменных разрядов одновременно на всех электродах.2. Способ по п.1, отличающийся тем, что для очистки и стерилизации медицинских инструментов, содержащих каналы, дополнительно осуществляют ...

ЭЛЕМЕНТЫ ДЛЯ ПРЕДОТВРАЩЕНИЯ ПЕРЕКРЕСТНОГО ЗАГРЯЗНЕНИЯ ЭНДОСКОПА ОТ СИСТЕМЫ ПОВТОРНОЙ ОБРАБОТКИ

КОМПОНЕНТЫ ДЛЯ ИСПОЛЬЗОВАНИЯ В СТЕРИЛЬНОМ ОКРУЖЕНИИ

... 1. Хирургический инструмент, содержащий:первую часть, содержащую по меньшей мере один первый электрический контакт;мембрану, герметично закрывающую первую часть; ивторую часть, содержащую:корпус хирургического инструмента;стенку, определяющую полость в корпусе хирургического инструмента, причем полость выполнена с возможностью по меньшей мере частично принимать первую часть, которая при этом остается герметично закрытой мембраной;первую область, содержащую по меньшей мере один второй электрический контакт;вторую область, содержащую отверстие, сообщающееся с полостью; изакрывающий элемент, выполненный с возможностью перемещения между первым положением и вторым положение, причем закрывающий элемент находится в герметизирующем контакте со второй областью, будучи в первом положении, при этом закрывающий элемент по меньшей мере частично не находится в герметизирующем контакте со второй областью, будучи во втором положении, и при этом один из первого электрического контакта и второго электрического ...

Автономный биологический индикатор

Устройство и способ обнаружения влаги в вакуумной камере

АЭРОЗОЛЬНАЯ СИСТЕМА СТЕРИЛИЗАЦИИ

... 1. Способ дезинфекции или стерилизации инструмента, включающий стадии: размещения инструмента в камере; понижения давления в камере до первого уровня давления; введения аэрозоля, содержащего стерилизующий агент, в камеру; диффузии аэрозоля по всей камере для введения в контакт с предметом, где первый уровень давления ниже атмосферного давления и выше давления пара стерилизующего агента, посредством чего усиливается диффузия аэрозоля по всему объему камеры. 2. Способ по п. 1, в котором стерилизующий агент содержит пероксид водорода. 3. Способ по п. 2, в котором аэрозоль содержит водный раствор пероксида водорода. 4. Способ по п. 1, в котором первый уровень давления, по меньшей мере, на 5 торр ниже атмосферного давления. 5. Способ по п. 4, в котором первый уровень давления, по меньшей мере, на 15 торр ниже атмосферного давления. 6. Способ по п. 4, в котором первый уровень давления, по меньшей мере, на 30 торр ниже атмосферного давления. 7. Способ по п. 1, дополнительно включающий стерилизацию ...

Strahlungsverträgliches Schmiermittel für medizinische Geräte

Griffelement für Sterilisierbehälter

Verfahren und Maschine zum Aufbereiten eines medizinischen Instruments

Es wird ein Verfahren zum Aufbereiten eines medizinischen Instruments vorgestellt mit den Schritten: Bereitstellen eines Aufbereitungsmittels, Bereitstellen eines Verdünnungsmittels, Anmischen einer Aufbereitungslösung aus dem Aufbereitungsmittel und dem Verdünnungsmittel, und Aufbereiten des medizinischen Instruments mit der Aufbereitungslösung, wobei das Anmischen der Aufbereitungslösung unmittelbar vor dem Aufbereiten erfolgt. Das Verfahren zeichnet sich dadurch aus, dass ein Mischungsverhältnis von Aufbereitungsmittel und Verdünnungsmittel individuell in Abhängigkeit von zeitlich veränderlichen, das Aufbereitungsmittel charakterisierender Daten festgelegt wird.Ebenso wird eine Maschine zum Aufbereiten eines medizinischen Instruments (20) vorgestellt, mit einer Zufuhr (1,5) für ein Aufbereitungsmittel, einer Zufuhr (10,11) für ein Verdünnungsmittel, einer Mischvorrichtung (2,6,12,15) zum Anmischen einer Aufbereitungslösung aus dem Aufbereitungsmittel und dem Verdünnungsmittel, einem ...

Verpackung für temporäre Myokard-Elektroden

Vorrichtung zum Verpacken von temporären Myokard Elektroden (TME) bestehend aus einer rechteckigen Kunststoffplatte (1) wobei die Platte (1) eine strukturierte Oberfläche aufweist in Form von paarweise angeordneten Erhebungen (8) zur Aufnahme der Thoraxnadel (11) sowie zur Aufnahme des Steckerpins (13), wobei beide Querseiten der Platte (1) Verzahnungen (2), (3) aufweisen, dadurch gekennzeichnet dass die Platte (1) entlang beider Längsseiten mindestens je ein Schlitz (4), (5) aufweist, wobei sich Schlitz (4) und Schlitz (5) im Wesentlichen gegenüber liegen und in den Schlitzen (4) und (5) mindestens ein Kunststoffschlauch (6) verankert ist, sodass der Schlauch (6) über die Breite der Platte (1) gespannt ist und wobei die paarweise angeordneten Erhebungen einen Abstand von 0,5-1,5mm haben und dazwischen eine Rille vorhanden ist die zur Aufnahme der Thoraxnadel dient und wobei die paarweise angeordneten Erhebungen so über die Kunststoffplatte verteilt sind, dass verschieden geformte Thoraxnadeln ...

Verfahren zum Reinigen und Desinfizieren von Rehabilitationsmitteln und Vorrichtung

Die Erfindung betrifft ein Verfahren zur Reinigung und Desinfektion eines Rehabilitationsmittels (20), sowie eine Vorrichtung zu dessen Ausführung.Erfindungsgemäß ist vorgesehen, dass das Verfahren die folgenden Schritte in der angegebenen Reihenfolge umfasst:a) Anordnen eines Rehabilitationsmittels (20) in einer flüssigkeitsdichten allseitig mit Wänden (11) umschlossenen Kammer (10),b) Applizieren eines Fluids umfassend ein Reinigungsmittel (R1-LM) und Wasser über eine Mehrzahl von in der Kammer (10) angeordneten Applikationsmitteln (13) auf das Rehabilitationsmittel (20),c) Applizieren eines Fluids umfassend ein Desinfektionsmittel (D-LM) und Wasser über die Mehrzahl von Applikationsmitteln (13) auf das Rehabilitationsmittel (20)d) Applizieren eines Fluids umfassend ein Spülmittel (R2-LM) und Wasser über die Mehrzahl von Applikationsmitteln (13) auf das Rehabilitationsmittel (20),wobei in zumindest einem der Verfahrensschritte (b) bis (d) das Fluid mit einer Temperatur im Bereich von ...

Gerät zur Reinigung und Desinfektion/Sterilisation eines Endoskops

Vorrichtung und Verfahren zur Sterilisation von medizinischer Schutzbekleidung

Eine Vorrichtung (1) zur Sterilisation von medizinischer Schutzbekleidung (2), wie Atemschutzmasken, Schutzanzügen und Handschuhen, weist eine Einrichtung zum in Kontakt bringen eines Sterilisationsmittels mit der medizinischen Schutzbekleidung (2) und eine Einrichtung zur Erzeugung einer sterilisierenden Wirkung des Sterilisationsmittels durch Einwirkung von Wärme auf.

Sterilisationssystem und -verfahren mit temperaturgeregelter Kondensationsoberfläche

Halteelement für ein Haltesystem für medizinische Gegenstände und Haltesystem für medizinische Gegenstände

Halteelement (16) für ein Haltesystem (1) für medizinische Gegenstände (2) mit einem Grundkörper (17), der eine obere Stirnfläche (18) und eine untere Stirnfläche (19) sowie Seitenflächen (23, 24) aufweist, mit einer den Grundkörper (17) von einer Seitenfläche (23) zu einer gegenüberliegenden Seitenfläche (24) durchsetzenden, zu einer der beiden Stirnflächen (18, 19) offenen Aufnahme (22) für die medizinischen Gegenstände (2) und mit einer den Grundkörper (17) ebenfalls von der einen Seitenfläche (23) zu der gegenüberliegenden Seitenfläche (24) durchsetzenden, geschlossenen Lageröffnung (21) für die medizinischen Gegenstände (2), die auf der der offenen Seite der Aufnahme (22) abgewandte Seite des Grundkörpers (17) angeordnet ist, und mit einer Umfangsnut (20) im Bereich zwischen der Aufnahme (22) und der Lageröffnung (21) zur Aufnahme eines den Grundkörper (17) am Haltesystem (1) in zwei entgegengesetzten Orientierungen festlegenden Lagerelementes (10).

Ein automatischer Trockner- und Desinfektionsschrank

Ein automatischer Trockner- und Desinfektionsschrank mit einem Gehäuse (1), dadurch gekennzeichnet, dass er einen auf dem Boden des Gehäuses (1) angeordneten elektrischen Trockner (6), einen an der Decke des Gehäuses (1) angeordneten Desinfektionssprüher (4) und ein auf dem elektrischen Trockner (6) stehendes Drehregal (2) umfasst, auf der Außenseite der Decke des Gehäuses (1) ein Kontrollcomputer (3) angebracht ist, an einer Seite des Gehäuses (1) eine Temperaturanzeige (5) befestigt ist, das Drehregal (2) einen Drehpfahl (7) und eine Anzahl von an dem Drehpfahl (7) angeordneten Regalböden (8) umfasst, die Regalböden (8) jeweils eine Reihe von Löchern als Instrumentenhalter (9) aufweisen, in welche die medizinischen Instrumente eingesteckt werden können, ferner dass in dem Gehäuse (1) ein Feuchtigkeits- und ein Temperatursensor angeordnet sind, die mit dem Kontrollcomputer (3) verbunden sind, und dass der elektrische Trockner (6) und der Desinfektionssprüher (4) mit dem Kontrollcomputer ...

Mehrkammer-Sterilisationssystem

Spülverteilervorrichtung und Spülverfahren

Spülverteilervorrichtung mit Anschlussadapter zum Anschluss und zum Reinigen von Hohlrauminstrumenten in Reinigungs- und Desinfektionsmaschinen oder in Ultra-schallbädern oder in einem Siebkorb, dadurch gekennzeichnet, dass zumindest ein Steckteil (6, 9) vorhanden ist, das in Wanddurchbrüche (21, 44) oder Halterungsöffnungen (31, 37) eingebracht wird und durch Drehen einer schrägen Steckteilfläche (11) oder durch Schieben oder Drehen eines Eingreifteils (16) oder eines Riegels (43) es zu einer Flächenüberlagerung kommt und dadurch eine Rückstellkraft über das Steckteil hergestellt wird, welche die Festlegung unterstützt.In Weiterbildung wird die Vorrichtung auch verfahrenstechnisch in Reinigungsmaschinen eingesetzt.

Maschine zum Reinigen von schlauchfoermigen Artikeln.

Optische Überprüfung des Adapteranschlusses einer Aufbereitungsvorrichtung für ein chirurgisches Instrument

Die Erfindung betrifft ein Verfahren, ein Computerprogramm und eine Aufbereitungsvorrichtung (1) zum Aufbereiten wenigstens eines Kanals (4) eines chirurgischen Instruments, insbesondere eines Endoskops (3). Die Aufbereitungsvorrichtung (1) umfasst hierbei einen Spülraum, wenigstens einen Adapter (6) zum Anschluss an einen Eingang (5) des wenigstens einen Kanals (4), wenigstens eine Spülmittelflussregulierungsvorrichtung, insbesondere ein Ventil (7), das zur Einleitung eines Spülmittels durch den wenigstens einen Adapter (6) in den wenigstens einen Kanal (4) eingerichtet ist, und wenigstens eine Kamera (8), wobei die wenigstens eine Kamera (8) zur Aufnahme wenigstens eines Bildes eines Anschlussbereichs (17) eingerichtet ist.Die Erfindung zeichnet sich dadurch aus, dass die Aufbereitungsvorrichtung (1) zur Auswertung von Bildinformationen des wenigstens ...

Hohlfasermembran mit verbesserten Diffusionseigenschaften

Die Erfindung betrifft wellenförmige thermostabile Hohlfasermembran mit reduzierter Wandstärke, wobei die Wandstärke von 20 µm oder mehr und 30 µm oder weniger beträgt und die Wellenform, der Hohlfasermembran eine Wellenlänge im Bereich von mehr als 1 mm und weniger als 5 mm aufweist. Insbesondere betrifft die Erfindung ein Verfahren zur Herstellung wellenförmiger thermostabiler Hohlfasermembranen mit geringer Wandstärke.

STERILISATOR MIT VAKUUMUNTERSTÜTZTER LUFTENTFERNUNG

Sterilization device has ethylene oxide fillable sterilization chamber and heated desorption chamber, where internal combustion engine is provided with supporting fuel terminal

The sterilization device has ethylene oxide fillable sterilization chamber (2) and a heated desorption chamber (3). An internal combustion engine (6) is provided with a supporting fuel terminal (7). The internal combustion engine is connected with an output side of the sterilization chamber. A unit is provided for heating the desorption chamber with the heat released from the internal combustion engine. The internal combustion engine is a gasoline, diesel or rotary engine, where auxiliary fuel is provided as gasoline, diesel, natural gas, municipal gas, butane or propane gas. An independent claim is also included for a method for operating a sterilization device.

Device for identifying medical equipment or instruments in program-controlled automatic cleaning, disinfection devices has separate identification data medium attached to each item

The device has a separate data medium with identification data attached to each item placed in a cleaning chamber, transmitter/receiver devices for each data medium outside the chamber, enabling detection and recording of all items in the cleaning chamber and if appropriate further specific information regarding the cleaning process. A processing program is selected using the detected data.

Verfahren zum Sterilisieren von Lumen

VORRICHTUNG MIT TEMPERATURABHÄNGIG GEDICHTETEM DICHTSPALT

Der ringförmige Dichtspalt (3) wird von der konischen inneren Dichtfläche (4) des Hahngehäuses (1) und der konischen äußeren Dichtfläche (5) des Kükens (2) gebildet. Die in die innere Ringnut (6) des Hahngehäuses (1) eingesetzte und in die äußere Ringnut (7) des Kükens (2) eingreifende Feder (8) hält das Küken (2) im Hahngehäuse (1). Die Feder (8) besteht aus einer Formgedächtnis-Legierung und ist so ausgelegt, dass sie bei Raumtemperatur flach ist. In einem erhöhten Temperaturbereich verformt sich die Feder (8) aufgrund ihres Formgedächtnisses wie dargestellt so, dass der in die äußere Ringnut (7) des Kükens (2) eingreifende innere Bogen (8b) der Feder (8) ausgelenkt wird und das Küken (2) in axialer Richtung anhebt. Hierdurch erweitert sich der Dichtspalt (3), so dass die Dichtflächen (4, 5) freiliegend beim Autoklavieren vom Dampf erreicht werden können.

Sterilisationsbehälter für Instrumente mit Verriegelungseinrichtung

A method for cleaning the inside of hollow medical products has a spray tube within a housing held in a height adjustable fixture

The spray tube (3) is held in a fixture (23) with a height adjusting column (7) set by a screw (9) and having feet (25) for bolting down. A closing end piece (15) enables rotation of the tube and another (19) enables rotation and axial movement of the inner piston (24). Filling is by a connection (16).

VERFAHREN UND VORRICHTUNG ZUR DEAKTIVIERUNG VON GEGENSTÄNDEN UND ZUR AUFRECHTERHALTUNG SOLCHER GEGENSTÄNDE IN EINEM DEAKTIVIERTEN ZUSTAND

AKTIVIERTE PEROXIDLÖSUNGEN UND ZUGEHÖRIGES HERSTELLUNGSVERFAHREN

Chirurgische Halterung für einen chirurgischen Behälter und chirurgischer Behälter

Um eine chirurgische Halterung für chirurgische Instrumente und/oder Implantate für einen chirurgischen Behälter, insbesondere einen Sterilbehälter oder Siebkorb, umfassend eine Lagereinrichtung zum Halten und/oder Lagern von chirurgischen Instrumenten und/oder Implantaten und eine Befestigungseinrichtung zum Befestigen der Halterung am Behälter, so zu verbessern, dass sie am Behälter einfacher befestigt werden kann, wird vorgeschlagen, dass die Befestigungseinrichtung von einer Befestigungsstellung, in welcher sie mit dem Behälter in Eingriff brinbar und verbindbar ist, in eine Anlegestellung überführbar ist, in welcher sie mit dem Behälter außer Eingriff bringbar ist, und dass die Befestigungseinrichtung mindestens zwei über die Lagereinrichtung miteinander verbundene Befestigungsglieder zum Befestigen der Halterung am Behälter umfasst. Ferner wird ein verbesserter chirurgischer Behälter vorgeschlagen.

Presentation tray for surgical instruments

Rdioactive ray irradiating apparatus

Method of decontamination and sterilisation

Ethylene oxide treatment

Acinetobacter lysins

Sphygmomanometer cuff cleaning device

A tomography controlled radio-active ray irradiating apparatus

In projecting radioactive rays for sanitizing food or the like, an irradiating condition which attains a uniform dose of radioactive rays for the entire objects to be exposed is automatically determined. An X-ray CT unit 6 captures a sectional image of an object to be exposed 2, and an irradiating condition determining section 8 acquires the density distribution of the object to be exposed 2 based on the captured sectional image. The irradiating condition determining section 8 then searches for a particular irradiating condition under which the dose distribution of the radioactive rays in the object to be exposed 2 falls within a predetermined range. An irradiation controlling section 16 controls a radioactive ray irradiating unit 14 based on the irradiating condition, and projects radioactive rays to the object to be exposed 2 in accordance with the irradiation condition when the object is transported to the radioactive ray irradiating unit 14 by a belt conveyor.

Autoclaves

PTFE oxidation resistant coating for medical or surgical instruments

An endoscope is protected from the corrosive effect of a sterilisation solution by application of a polytetrafluoroethylene coating. A suitable applicator and application process are also described.

Medical device cleaning vessel with scrubber

A medical device cleaning apparatus has first and second liquid cleaning vessels 1,2 the first 1 also containing a scrubbing means (fig.4) and a support means 3,4,5 above the vessels 1,2, on which a non-operative portion, such as the device handle, can be held during cleaning, and during period of non-use of the device. The device may by be an auriscope or speculum, with a patient contact portion of the device depending into the first vessel 1 so as to be cleaned by a cleaning fluid and the brush contained within. The second container may contain a second cleaning fluid, such as alcohol, and may have a self re-sealed press open membrane closure 8.

Medical accessory holder

Acinetobacter lysins

Acinetobacter lysin polypeptides and variants peptides with killing activity against gram negative bacteria. Methods for treating bacterial infections or bacterial colonization using Acintobacter lysin polypeptides.

Cleaner for medical or veterinary devices, for example auriscopes

A disposable container for surgical instruments

A disposable container for surgical instruments

A disposable container 1 for surgical instruments is provided for transporting sterile instruments to the point of use. The container comprises an enclosure with a base 6 and an upstanding wall having a securing lip defined around its upper edge. A lid is connected to an upper edge of the upstanding wall by a hinge 12. The lid includes a roof 24, an inner wall 26 extending downwardly from the roof, an outer wall 30 extending upwardly from the base of the inner wall, and a securing lip 20 at the upper end of the outer wall configured to secure over the securing lip of the base. When the lid is in the closed position the base of the inner and outer walls is located within the enclosure at a position below the securing lip with the outer wall being seated against the inner surface of the upstanding walls of the enclosure. A method of sterilizing a surgical instrument within an enclosure as described above is also claimed.

Apparatus for tracking a number of medical instrument sterility cycles

Electrochemical cell assembly and method for operation of the same

A device for producing ozonated water from a reservoir of water provided, the apparatus comprising an electrochemical cell to electrolyse water to produce ozone and having a first and second electrode assembly; an electrical supply for providing an electrical energy source to the electrochemical cell; a conductivity sensor for determining the conductivity of fluid in the region of the electrode assemblies of the cell; a processor for receiving an indication of fluid conductivity from the conductivity sensor and determining if the conductivity of the fluid in the region of the electrode assemblies is above a threshold value and, if the conductivity is above the threshold value, activating the electrochemical cell. A method of use is also provided. The electrical supply may be a battery, cable, or solar panel or array. The electrodes can be formed of a diamond material with a conductive coating.

COMPOSITIONS AND USES THEREOF

Irradiation apparatus for production line use

Sterlisation of endoscopes

A medical instrument sterilizing and drying equipment with rotating hair dryer

A high-temperature steam sterilizing scapel storage cabinet

Cleaning tool

Cleaning tool

Compositions and uses thereof

Cleaning tool

PRODUCTION OF HYDROGEN PEROXIDE COMPLEXES

SYSTEM AND PROCEDURE FOR THE DISINFECTION OF A CRYOSTAT

PROCEDURE AND DEVICE FOR THE TREATMENT OF A SUBSTRATE WITH OZONE SOLVENTS A SOLUTION

STEAM STERILIZATION USING INORGANI HYDROGEN PEROXIDE COMPLEXES

CATCH DIAPHRAGM FOR A PACKING FOR PRODUCTS WHICH CAN BE STERILIZED WITH A HIGH TEMPERATURE STERILIZATION FLUID

MODULAR STERISET

CLEANING AND DECONTAMINATION FORMULA FOR SURFACES, WHICH ARE CONTAMINATED WITH PRIONENINFIZIERTEM MATERIAL

STERILE CONTAINER

STERILISATION APPARATUS WITH MODULE TO THE PLASMA TREATMENT AND STERILISATION PROCEDURE

STERILIZATION CONTAINER

EQUIPMENT FOR DISINFECTING WITH A NANOMETER DISINFECTING FUNCTION

STERILE CONTAINER

METHOD FOR STERILIZING A MEDICAL DEVICE HAVING A HYDROPHILIC COATING

PROCEDURE AND DEVICE FOR THE TREATMENT OF VORSTERILISIERTER COMPONENTS IN A STERILE FIELD

PROCEDURE FOR THE STATEMENT OF BLOCKAGES IN THE PASSAGES OF A MEDICAL INSTRUMENT

TRANSPARENT AUTO+PIANO-CASH BAG

COMPOSITION TO THE CLEANING OF DENTALER INSTRUMENTS AND PROCEDURE

PROCEDURE FOR THE ENTKEIMEN, STERILIZING AND PACKING SENTENCES OF SURGICAL INSTRUMENTS

STERILIZE-CASH PACKAGE WITH HIGH OXYGEN BARRIER

Uv resistant clear laminates

A multilayer construct includes a fluoropolymer first layer; a UV resistant fluoropolymer adhesive layer, and a third layer, wherein the fluoropolymer adhesive layer is between the first and third layers. The adhesive layer can optionally include an ultraviolet radiation absorber.

Medium chain peroxycarboxylic acid compositions

The present invention relates to compositions including medium chain peroxycarboxylic acid, methods for making these compositions, and methods for reducing the population of a microorganism. The compositions can include advantageously high levels of the medium chain peroxycarboxylic acid, can be readily made, and/or can exhibit reduced odor.

Terpolymers as pressure-sensitive adhesives

Disclosed herein are terpolymers that can function as pressure-sensitive adhesives. The disclosed articles comprise the terpolymers adhered to a release liner. The disclosed implant devices comprise the pressure-sensitive adhesive terpolymer adhered to a surface thereof. The pressure-sensitive adhesive terpolymer can promote adhesion of the implant device to a location in a subject.

Sterile packing and sterilization method using this packing

The packing according to the invention comprises: a container for holding said at least one object to be sterilized, having an inlet opening and a discharge opening via which said at least one object may pass into and out of said container, said container comprising a rigid part which comprises a peripheral wall bored with a multitude of small holes having dimensions smaller than those of the said at least one object, and a non-rigid part in a material porous to the sterilization fluid and non-porous to microbial contamination, this non-rigid part being able to contain said rigid part and to be sealed thereon; and at least one envelope made in a flexible and airtight material, which is vacuum sealing fitted on said container.

Ozone generation module

An ozone supply module for supplying ozonated water to an appliance that typically includes: an appliance module housing having a water inlet; a water outlet; and an electrical connection for receiving electrical power; a proton exchange membrane cell positioned within the housing; and a water conveying system within the module housing and operably connected to both the water inlet and water outlet. The water conveying system is typically configured to allow water to flow through the deionizing resin and into contact with the proton exchange membrane cell. The module and the proton exchange membrane cell receive electrical power from a home appliance when the module is operably connected to the appliance. The module produces water that contains (dissolved) ozone to be delivered to a chamber within the appliance when the module is in the engaged position with the appliance. The appliance is typically a residential appliance.

Methods and devices for treating surfaces with surface plasma`

Methods and devices for treating surfaces of objects using a non-thermal plasma are disclosed herein. The non-thermal plasma is generated through the use of an apparatus configured to generate a non-thermal plasma on its surface. The apparatus is comprised of a substrate that contains one or more electrodes of different polarity. The electrodes are placed within a layer of the substrate acting as a dielectric layer. The apparatus may also have additional layers to contain the dielectric layer. When an appropriate potential, being either an alternating current or pulsed high voltage potential, is applied and removed from the one or more electrodes, the gas on at least one surface of the apparatus becomes ionized and forms a non-thermal plasma. The electrodes can be configured to be of various shapes and sizes to modify or tune the plasma.

Catheter insertion sterilization

A device includes a sheath having a lumen defined by a wall. The wall has an outer surface that is configured to emit ultraviolet light in a direction substantially normal to the wall. The lumen has a distal end configured for percutaneous placement. The lumen has a proximal end configured to receive a catheter.

Process for sterilizing an article

A composition is disclosed which comprises (A) an anti-microbial agent comprising peracetic acid; and (B) a reagent mixture comprising a buffer, an anticorrosive agent and a chelator. The composition may be characterized by the absence of molybdate. The foregoing composition may be dispersed in water to form a liquid sterilant. The liquid sterilant may be used for sterilizing articles such as medical, dental, pharmaceutical, veterinary or mortuary instruments, devices, and the like.

Universal sterilizing tool

The sterilizing tool is configured to wipe debris from and to sterilize and/or dry a working end-site of medical device; using a wiping, twisting, dabbing, push/pull, and/or screwing motion around all of the surface aspects of the device to be sterilized. Additionally, the sterilizing tool is configured to form fit to the surfaces of the end-site and to apply an inclusive layer of an anti-pathogenic agent to the inner and outer surfaces of the working end-site. The sterilizing tool may be frictionally engaged with and retained on the working end-site until removed and the end-site is ready for use. The sterilizing tool is intended for a one time, single use, disposable application.

Method of controlling a decontamination process

A method of controlling a multi-step decontamination process is disclosed. The method comprises assigning articles into a plurality of groups, processing the articles through a first and/or second sub-process of the multi-step decontamination process, quantifying a biological analyte associated with residue on or in the processed articles, and setting action limits for the first and second sub-processes. A method and a system for monitoring the control of the decontamination process are also disclosed.

Stabilization Of Perhydrolases

Disclosed herein are enzyme powders comprising a spray-dried formulation of at least one CE-7 esterase, at least one oligosaccharide excipient, and optionally at least one surfactant. Also disclosed herein is a process for producing peroxycarboxylic acids from carboxylic acid esters using the aforementioned enzyme powders. Further, disinfectant and laundry care formulations comprising the peracids produced by the processes described herein are provided.

Apparatus and Method for Reprocessing Lumened Instruments

Methods and apparatus for liquid, gas, and gas plasma sterilization of items. The apparatus includes two chambers and a holder to connectorlessly secure a lumened instrument such that a first portion of the lumened instrument lies in the first chamber and a second portion of the instrument lies in the second chamber, a liquid medium contained within the two chambers, and pumping means for simultaneously increasing fluid pressure within the first chamber of said container while decreasing fluid pressure within the second chamber of the container in a reciprocating fashion. The pumping means displaces at least a total internal volume of the liquid medium through the lumen for a given highest volume of a lumened instrument during a stroke.

Composite comprising at least one type of perfluoroalkyl-perfluoro-phthalocyanine

The present invention relates to a composite comprising at least one type of perfluoroalkyl-perfluoro-phthalocyanine, and to a method of producing such composite. The present invention also relates to a method of generating singlet oxygen, a method of killing eukaryotic or prokaryotic cells and a method of sterilization, cleaning and/or decontamination. Moreover, the present invention relates to a composite or a device for use in a method of sterilization, cleaning and/or decontamination.

Radiation sterilization of medical devices

A method for medical device sterilization comprises staggering a stack of packages so that a back surface of each package partially overlaps a front surface of another of the packages. Each package contains a medical device. The stack of packages are positioned so that the front surfaces of the packages face toward a radiation source. The packages are then exposed to radiation.

Disinfecting caps for medical male luer connectors

Disclosed herein are disinfecting caps that can be used to cover and disinfect a male luer post of a medical connector when not in use or when disconnected from its female connector counterpart. The caps are configured to engage threads of the connector. The caps contain a disinfecting agent disposed in a chamber of the cap.

Aqueous radiation protecting formulations and methods for making and using them

Medical devices are typically sterilized in processes used to manufacture such products and their sterilization by exposure to radiation is a common practice. Radiation has a number of advantages over other sterilization processes including a high penetrating ability, relatively low chemical reactivity, and instantaneous effects without the need to control temperature, pressure, vacuum, or humidity. Unfortunately, radiation sterilization can compromise the function of certain components of medical devices. For example, radiation sterilization can lead to loss of protein activity and/or lead to bleaching of various dye compounds. Embodiments of the invention provide methods and materials that can be used to protect medical devices from unwanted effects of radiation sterilization.

Sterilization methods and apparatus

Sterilization methods for implantable prostheses are described, where a polymeric stent may be sterilized, e.g., via ETO sterilization, at a temperature below a glass transition temperature of the stent. A separate delivery catheter may be sterilized separately and the stent and delivery catheter may then be combined in an aseptic, or semi-aseptic environment and sterilized as an assembled system such that the requirements for sterilizing the system are relatively lower. Additionally and/or alternatively, valve and filter assemblies may be used with an optional mandrel assembly for maintaining sterility of the internal components of a catheter system.

Method of cleaning medical instrument and apparatus therefor

A method of cleaning a medical instrument, in which a medical instrument to which a body fluid adheres is subjected to ultrasonic cleaning in a cleaning solution in which chlorine dioxide is dissolved, and a cleaning apparatus including a cleaning tank constructed to be capable of ultrasonic cleaning, a mixing portion for generating the cleaning solution in which chlorine dioxide is dissolved, a first pipe for supplying the cleaning solution to the cleaning tank from the mixing portion, and a second pipe for supplying water to the cleaning tank, and constructed to dilute the cleaning solution supplied from the mixing portion through the first pipe with water supplied through the second pipe such that a prescribed concentration of chlorine dioxide dissolved in the cleaning solution is attained in the cleaning tank are provided.

Wound care system and bacteridical methods and devices

A variety of article and systems including wound care systems, methods for making the wound care systems, bactericidal, and methods for treating wounds using these systems are disclosed. The wound care systems may include a first material comprising one or more fibers or porous media. The one or more fibers or porous media may be coated with a second material that is capable of inhibiting the growth of bacteria and killing the bacteria to render the wound care system sterile, increasing the absorbency of the first material, or both upon exposure to light. The first material may be cotton, or any suitable fibrous material, the second material may be TiO 2 , and the light may be UV or visible light. A variety of methods including ALD may be used to coat the first material.

Method and apparatus for disinfecting and/or self-sterilizing a stethoscope using plasma energy

A method and apparatus for disinfecting and/or self-sterilizing at least a portion of the surface of a stethoscope is provided. Methods and devices are provided by which a device or apparatus can generate a sterilizing plasma such that a stethoscope, or portion of a stethoscope, can be placed within or near the device or apparatus so that the plasma disinfects and/or sterilizes and/or decontaminates at least a portion of the stethoscope. A method and apparatus are disclosed for providing a self-disinfecting and/or self-sterilizing and/or self-decontaminating stethoscope and stethoscope disinfecting and/or sterilization apparatus for disinfecting and/or sterilizing, respectively, all or at least a portion of a stethoscope.

Devices and articles comprising up-converting sterilizing compositions and methods for using the same

There is disclosed various devices and articles comprising phosphors for converting electromagnetic energy to radiation having a shorter wavelength, the composition comprising at least one phosphor capable of converting an initial electromagnetic radiation having a wavelength (A) to an electromagnetic radiation having a shorter wavelength (B) comprising UV radiation or radiation of a shorter wavelength. There is also a method of sterilizing such devices and articles by exposing it to UV radiation or radiation of a shorter wavelength for a time sufficient to deactivate or kill at least one microorganism and/or for a time sufficient to inhibit abnormal cell growth within the body, when the composition is in an implantable medical device.

Hydrogen peroxide sterilization method

A method of metering a preselected volume of hydrogen peroxide into a vessel under vacuum is disclosed. The method comprises the steps of connecting a passage of known volume to the vessel under vacuum to evacuate the passage; sealing the passage; connecting the passage to a supply of hydrogen peroxide solution for a time sufficient to draw the hydrogen peroxide solution into the evacuated passage and fill the passage with the hydrogen peroxide solution; sealing the passage; and repeating steps a) to d) until a cumulative volume of fills of the passage is equal to the preselected volume. The volume of the passage is preferably 15 μL to 75 μL. Sterilization is controlled in an economic manner by obviating the need for a means to measure the hydrogen peroxide concentration in the chamber.

Pressurized heating system with enhanced pressure locks

A microwave heating system configured to heat a plurality of articles and a process for using the same are provided. The microwave heating system includes a liquid-filled thermalization zone, a liquid-filled microwave heating zone, and a pressure lock system disposed therebetween. The pressure lock system includes a pair of locking gate valves and a pressure adjustment chamber configured to transition the articles being heated from the thermalization zone to the microwave heating zone, which may be operated at different pressures.

Optimized allocation of microwave power in multi-launcher systems

A microwave system for heating a plurality of articles and a method of using the same is provided. The microwave heating system comprises at least three microwave launchers and at least three microwave allocation devices for dividing the microwave energy into at least three separate portions. Each allocation device is configured to divide the microwave energy passing therethrough according to a predetermined ratio, and at least one of the allocation devices is configured to divide the microwave energy according to a predetermined ratio that is not 1:1. The resulting energy portions can then be discharged into the microwave heating chamber via the launchers and used to heat a plurality of articles, including foodstuffs, medical fluids, or medical instruments, disposed within the heating chamber.

Multi-line microwave heating system with optimized launcher configuration

A microwave heating system configured to heat a plurality of articles and a process for using the same is provided. The heating system includes at least two laterally-spaced parallel convey lines and two or more groups of microwave launchers configured to heat articles transported along each convey line. The groups of microwave launchers can include pairs of oppositely disposed launchers that are spaced apart from one another along the axis of convey. When the system includes multiple convey lines, adjacent launcher groups are staggered relative to one another in the convey direction. Heating articles, such as foodstuffs or medical fluids or equipment in such a system, minimize undesirable interference between launchers of adjacent groups and provide a more uniform heating field.

Methods and apparatus to inactivate infectious agents on a catheter residing in a body cavity

Methods and apparatus for the inactivation of infectious agents in, on or around a catheter residing in a patient's body cavity. The method comprises transmitting non-ultraviolet sterilizing electromagnetic radiation (EMR) substantially axially along an optical element in the catheter body. Through delivery of the sterilizing EMR to particular areas of highest infection, the present disclosure is able to inactivate the major sources of infection in catheters.

Multi Mode Low Temperature Plasma Sterilizer

In a low temperature hydrogen peroxide gas plasma sterilizer, the accurate control of concentration of the hydrogen peroxide sterilant is an important factor in determining reliability and sterilization efficacy of the sterilization process. The present application describes sterilizers, and sterilization methods, which use a novel injector-concentrator arrangement which allows accurate concentration of the sterilant performed concurrently with the sterilization process. This process enables the device to sterilize wide range of sensitive equipment within a shorter sterilization cycle.

Devices, systems, and methods for cleaning, disinfecting, rinsing, and priming blood separation devices and associated fluid lines

Systems and methods for providing for the automatic instrument-based rapid reprocessing of an intact extracorporeal circuit for use in hemodialysis. The system includes a manifold with connectors for engaging a dialyzer as well as venous and arterial blood lines. The manifold is adapted to be moved from a dialysis machine to a reuse instrument without removing the dialyzer and associated blood lines. The system allows for reprocessing of the extracorporeal circuit wherein prior to the next treatment, there is no residual chemical disinfectant requiring testing, the extracorporeal circuit is pre-primed, the levels in the bubble traps are set, and all of the required quality assurance tests are performed and recorded.

Wireless, Reusable, Rechargeable Medical Sensors and System for Recharing and Disinfecting the Same

Embodiments described herein may include systems and method for monitoring physiological parameters of a patient. Specifically, embodiments disclose wireless, reusable, rechargeable medical sensors that include an inductive coil coupled to a rechargeable battery. Additionally, embodiments disclose systems and methods for recharging and disinfecting the disclosed medical sensors.

Reactive Oxidative Species Generating Materials and Methods of Use

Materials capable of delivering stabilized free radicals to targeted treatment sites. The materials comprise semi-crystalline, hydrolytically degradable polymers that are subjected to ionizing radiation to create stabilized free radicals therein. Upon exposure to oxygen containing aqueous media, the materials generate reactive oxidative species which are useful in biological processes.

Compositions, Methods and Uses for Cleaning, Disinfecting and/or Sterilizing

The present specification discloses a composition comprising, consisting essentially of, or consisting of hypochlorous acid or free available chlorine and one or more disinfectants, a composition comprising, consisting essentially of, or consisting of hypochlorous acid or free available chlorine, one or more disinfectants and one or more surfactants, a composition comprising, consisting essentially of, or consisting of hypochlorous acid or free available chlorine and one or more surfactants, a composition comprising, consisting essentially of, or consisting of one or more guanide-containing compound and one or more alcohols, kits comprising, consisting essentially of, or consisting of a disclosed composition, as well as methods and uses to clean, disinfect and/or sterilize a device using such compositions, methods and uses to clean, disinfect and/or sterilize a surface area using such compositions, methods and uses to clean, disinfect and/or sterilize a microbial infection in an individual using such compositions. 1. A composition comprising one or more biguanide-containing compounds and one or more alcohols.2. The composition according to claim 1 , wherein the one or more biguanide-containing compounds comprise one claim 1 , two claim 1 , three claim 1 , four or five biguanide functional groups.3. The composition according to claim 1 , wherein the one or more biguanide-containing compounds include a polyhexamethylene biguanide (PHMB) claim 1 , polyaminopropyl biguanide (PAPB) claim 1 , 1 claim 1 ,1′-(1 claim 1 ,6-Hexanediyl)bis{2-[N′-(2-ethylhexyl)carbamimidoyl]guanidine} (alexidine) claim 1 , chlorhexidine claim 1 , chlorhexidine gluconate claim 1 , or any combination thereof.4. The composition according to claim 1 , wherein the one or more alcohols include methanol claim 1 , ethanol claim 1 , propanol claim 1 , isopropanol claim 1 , butanol claim 1 , pentanol claim 1 , or 1-hexadecanol.5. The composition according to claim 1 , wherein the one or more alcohols are ...

WIPE FOR KILLING SPORES

This invention relates to a wipe for killing spores comprising an absorbent sheet holding an aqueous composition and a sealed package containing the absorbent sheet, wherein the aqueous composition comprises water, an antimicrobial agent and a peroxide. The invention also relates to a process for killing spores using the above-indicated wipe. 149-. (canceled)50. A process for killing spores positioned on a substrate , comprising:contacting the spores with an aqueous composition using an absorbent sheet, the aqueous composition comprising water, an antimicrobial agent, and a peroxide, the concentration of the peroxide in the water being in the range from about 0.01 to about 14% by weight; andmaintaining the aqueous composition in contact with the spores for an effective period of time to effect at least a 4 log reduction in the number of spores capable of returning to vegetative growth.51. The process of wherein the substrate is made of a material comprising brass claim 50 , copper claim 50 , aluminum claim 50 , stainless steel claim 50 , carbon steel claim 50 , rubber claim 50 , plastic claim 50 , glass claim 50 , wood claim 50 , painted surface claim 50 , or a combination of two or more thereof.52. The process of wherein the substrate comprises a table top claim 50 , counter top claim 50 , floor claim 50 , wall claim 50 , ceiling claim 50 , window claim 50 , door claim 50 , door handle claim 50 , sink claim 50 , faucet claim 50 , toilet or toilet seat.53. The process of wherein the substrate comprises a medical claim 50 , dental claim 50 , pharmaceutical claim 50 , veterinary or mortuary device.54. The process of wherein the substrate comprises human skin.55. The process of wherein the temperature of the aqueous composition is in the range from about 1° C. to about 40° C.56. The process of wherein the effective period of time is from about 30 seconds to about 20 minutes.57. The process of wherein the spores comprise bacterial spores.58BacillusClostridia genera.. ...

ENDOSCOPE SYSTEM, AND LEAK DETECTION PROCESSING METHOD AND LEAK DETECTION PROCESSING APPARATUS FOR ENDOSCOPE

An endoscope system includes a valve configured to keep an internal space of an endoscope airtight, an air pump configured to open and close the valve by applying a negative pressure and a positive pressure, a pressure sensor configured to detect a pressure at a time of the negative pressure and the positive pressure being applied, and a control section configured to receive a detection signal from the pressure sensor, and perform drive control of the air pump. 1. An endoscope system , comprising:a valve configured to keep an internal space of an endoscope airtight;a pipe sleeve configured to be connectable to a leak detection mechanism having the valve;an air-feeding and suction mechanism configured to open the valve by applying a negative pressure, close the valve by performing pressurization, and detach the sleeve from the leak detection mechanism by continuing pressurization, in a state where the leak detection mechanism and the pipe sleeve are connected to each other;a pressure sensor configured to detect a pressure at a time of the negative pressure being applied, and output a first detection signal indicating that a hole does not occur in a member that forms the internal space of the endoscope; anda control section configured to perform drive control to the air-feeding and suction mechanism that applies the negative pressure, to perform pressurization, by the first detection signal being inputted from the pressure sensor.2. The endoscope system according to claim 1 ,wherein the leak detection mechanism is a first pipe sleeve, andthe pipe sleeve is a second pipe sleeve.3. The endoscope system according to claim 1 ,wherein the pressure sensor further detects a pressure at a time of performing pressurization, andthe control section outputs a stop signal to the air-feeding and suction mechanism, when a second detection signal indicating that pressure is detected is inputted from the pressure sensor, when pressurization is performed.4. The endoscope system ...

DECONTAMINATION OF RESPIRATORY EQUIPMENT

Described herein are methods, devices and systems for decontaminating respiratory medical devices and equipment. Decontamination includes removing humidity from an interior of a respiratory equipment decontamination chamber after an interior thereof is sealed to exclude ambient air. The interior of the decontamination chamber is conditioned by introducing vaporized hydrogen peroxide (VHP) thereto to achieve a target concentration, which is maintained at a predetermined concentration for a decontamination period. The interior of the decontamination chamber is then aerated. Other examples are disclosed and claimed. 1. A respiratory equipment decontamination device , comprising:a respiratory equipment decontamination chamber including an interior that is reversibly sealed to exclude ambient air;an inlet that provides entry of vaporized hydrogen peroxide (VHP);a dehumidifier operatively coupled to the interior; and receive a selection indicating one or more types of respiratory equipment to be decontaminated;', 'operate the dehumidifier to remove humidity from the interior of the respiratory equipment decontamination chamber after the interior is sealed;', 'condition the interior by introducing VHP thereto to achieve a target concentration;', 'maintain, based on the selection, VHP at a predetermined concentration for a decontamination period by introducing VHP to the interior; and', 'aerate the interior by removing VHP from the interior to achieve an aeration target concentration of VHP., 'a controller programmed to2. The device of claim 1 , wherein the interior of the respiratory equipment decontamination chamber is about 48 ft.3. The device of claim 1 , wherein the target concentration and the predetermined concentration are equal.4. The device of claim 1 , wherein the predetermined concentration is about 0.6 mg/L to about 3.4 mg/L.5. The device of claim 1 , wherein the predetermined concentration is about 2.3 mg/L.6. The device of claim 1 , wherein the ...

AIRCRAFT GALLEY PATHOGEN TEST KIT

A galley monument for a cabin area of an aircraft including a first monument stack, a second monument stack adjacent to the first monument stack, a tray within the second monument stack to secure a rapid pathogen tester, a slidably moveable support located below the tray to secure a plurality of tools to use along with the rapid pathogen tester, and at least one light within the tray to irradiate the tools placed within the support. 1. A galley monument for a cabin area of an aircraft comprising:a first monument stack;a second monument stack adjacent to the first monument stack;a tray within the second monument stack to secure a rapid pathogen tester;a slidably moveable support located below the tray to secure a plurality of tools to use along with the rapid pathogen tester; andat least one light within the tray to irradiate the tools placed within the support.2. The monument of claim 1 , wherein the light is a UV light.3. The monument of claim 1 , wherein the light is attached to an underside of the tray.4. The monument of claim 1 , wherein the light protrudes out of the underside of the tray.5. The monument of claim 1 , wherein the tray includes an indentation for bordering the pathogen tester.6. The monument of claim 5 , further comprising an elevation surrounding the indentation.7. The monument of claim 6 , wherein the elevation surrounds the indentation from at least three sides.8. The monument of claim 6 , wherein the elevation surrounds the indentation from four sides.9. The monument of claim 1 , further comprising a tray in a stack adjacent to the second monument stack to secure the tester when in use.10. The monument of claim 1 , wherein the light is placed such that it irradiates at least three sides of the support.11. The monument of claim 1 , further comprising rails to hold up the support.12. The monument of claim 1 , wherein the support is a drawer.13. The monument of claim 1 , wherein the tray includes at least one aperture for threading wiring to ...

SYSTEMS, METHODS, AND DEVICES FOR OZONE SANITIZATION OF CONTINUOUS POSITIVE AIRWAY PRESSURE DEVICES

The present invention is generally related to a device and method for sanitizing a medical instrument with ozone, in particular the invention relates to a system, method and a device for sanitizing a continuous positive airway pressure (CPAP) device. The device has an ozone compartment, an ozone operating system and one or more ozone distribution lines that distribute ozone to a continuous positive airway pressure device. The device may further include a heater adapter unit to connect heating systems in CPAP devices while distributing ozone to sanitize the CPAP device in accordance with the present invention. 1. A system for sanitizing continuous positive airway pressure (CPAP) equipment , comprising:an ozone device comprising a housing, the housing comprising a compartment and an ozone operating system separate from the compartment, wherein:the compartment is configured to house at least a portion of a CPAP mask;the ozone operating system is configured to generate ozone gas and to convey at least a portion of the ozone gas outside of said ozone device; andthe compartment is configured to receive at least a portion of the ozone gas from outside said ozone device.2. The system of claim 1 , further comprising an air pump that is configured to cause ozone gas generated by said ozone operating system to flow outside said ozone device.3. The system of claim 2 , wherein said air pump is within said housing.4. The system of claim 1 , further comprising a CPAP part claim 1 , wherein the ozone device is configured such that at least a portion of the ozone gas generated by the ozone operating system can flow into the CPAP part.5. The system of claim 4 , further comprising an ozone distribution line claim 4 , wherein:the ozone distribution line is configured to fluidly couple to the ozone operating system and to the CPAP part; andthe ozone device is configured such that at least a portion of the ozone gas generated by the ozone operating system can flow into the CPAP part at ...

MOBILE STERILIZATION APPARATUS AND METHOD FOR USING THE SAME

A sterilization cabinet, comprising a top panel, at least two side panels, and a floor panel forming a part of a chamber of the sterilization cabinet; at least one door connected to at least one of the at least two side panels of the sterilization cabinet; a vent formed in at least one of the two side panels; at least one first filter covering the vent and a filter cover configured to hold the first filter against the vent; a drain positioned in the floor panel, wherein the floor panel has a slope configured to cause condensate within the chamber to flow into the drain and wherein the drain is the only outlet for the condensate along the floor panel; and a second filter covering the drain such that condensate flowing into the drain passes through the second filter. 1closing a sterilization container having at least one vented area that allows fluids to pass into and out of the sterilization container where the at least one vented area is located in a panel of the sterilization container;positioning a first filter to fully cover the at least one vented area and such that the first filter extends beyond a perimeter of the at least one vented area;engaging a portion of the first filter to the panel of the sterilization unit at an area beyond the perimeter of the at least one vented area;positioning a second filter over the first filter such that the second filter covers the at least one vented area;affixing an edge of a filter cover against the sterilization unit to engage the second filter directly against the first filter and the first filter against the panel such that the edge forms a seal with both the first filter and the second filter against the sterilization unit;initiating a sterilization cycle on the sterilization unit to sterilize an internal region of the sterilization unit;loosening the filter cover from the sterilization unit to disengage the seal of the edge from at least the second filter against the sterilization cabinet;detaching the second filter ...

APPARATUS AND METHOD FOR STERILIZING ENDOSCOPE

A method of sterilizing an article such as a flexible endoscope is performed in a sterilization chamber. A vacuum is applied in the sterilization chamber while the article is contained in the sterilization chamber. A sterilant is then introduced into the sterilization chamber. The pressure within the sterilization chamber is incrementally increased to provide a step-wise transition from a high vacuum state to atmospheric pressure. The article is thereby sterilized. 1. A method of sterilizing an article , the method comprising:(a) receiving the article in a sterilization chamber;(b) applying a vacuum to the sterilization chamber to reduce the pressure within the sterilization chamber to a first pressure, wherein the first pressure is less than atmospheric pressure;(c) introducing a sterilant into the sterilization chamber;(d) maintaining the first pressure in the sterilization chamber for a first period of time;(e) venting the sterilization chamber to increase the pressure within the sterilization chamber to a second pressure, wherein the second pressure is less than atmospheric pressure;(f) maintaining the second pressure in the sterilization chamber for a second period of time;(g) venting the sterilization chamber to increase the pressure within the sterilization chamber to a third pressure; and(h) maintaining the third pressure in the sterilization chamber for a third period of time.2. The method of claim 1 , wherein the article comprises a medical device.3. The method of claim 2 , wherein the medical device comprises an endoscope.4. The method of claim 3 , wherein the endoscope defines a lumen.5. The method of claim 4 , wherein the lumen has a length of at least 800 mm and an inner diameter less than 6 mm.6. The method of claim 1 , wherein the second period of time is longer than the first period of time.7. The method of claim 1 , wherein the first period of time is between approximately 5 seconds and approximately 5 minutes.8. The method of claim 1 , wherein the ...

APPARATUS AND METHOD FOR DISINFECTING AN ENDOSCOPE

Efficacy and efficiency of reprocessing a medical device having a restrictive channel and at least one less-restrictive channel, e.g., an endoscope, via disinfection may be improved by using a so-called “Purge-Then-Fill” technique in which channels are purged of disinfectant before refilling them with the disinfectant. Preferably, a less-restrictive channel is purged before the restrictive channel is purged, and then the less-restrictive channel or another less-restrictive channel is filled before the restrictive channel is filled. 1. A reprocessing method comprising:connecting a medical device to a reprocessing system, the medical device having a restrictive channel and a less-restrictive channel;initial filling the restrictive channel and the less-restrictive channel with a disinfectant;first purging the restrictive channel and the less-restrictive channel of the disinfectant;first filling the restrictive channel and the less-restrictive channel with the disinfectant; andfinal purging the restrictive channel and the less-restrictive channel of the disinfectant.2. The reprocessing method of claim 1 , wherein the first purging step includes ending the purging of the less-restrictive channel before beginning the purging of the restrictive channel.3. The reprocessing method of claim 2 , wherein the first filling step includes ending the filling of the less-restrictive channel before beginning the filling of the restrictive channel.4. The reprocessing method of claim 1 , wherein the less-restrictive channel is a first less-restrictive channel and the medical device further includes a second less-restrictive channel.5. The reprocessing method of claim 4 , wherein the initial filling step further includes filling the second less-restrictive channel with the disinfectant.6. The reprocessing method of claim 5 , further comprising:second purging the restrictive channel and the second less-restrictive channel of the disinfectant; andsecond filling the restrictive channel and ...

Ozone Sanitizing System and Method

The present disclosure generally relates to an ozone sanitizing system and method. In one embodiment, a system for sanitizing various objects using ozone gas is disclosed. The system comprises an ozone generating device configured to generate ozone gas for sanitizing one or more objects, and a vessel configured to couple with the ozone generating device for receiving the ozone gas to sanitize the one or more objects stored inside the vessel during an ozone sanitizing cycle. The system is configured to recirculate at least a gas mixture generated during the ozone sanitizing cycle to increase an ozone concentration inside the vessel. 1. A system for sanitizing various objects using ozone gas , the system comprising:an ozone generating device configured to generate ozone gas for sanitizing one or more objects; anda vessel configured to couple with the ozone generating device for receiving the ozone gas to sanitize the one or more objects stored inside the vessel during an ozone sanitizing cycle,wherein the system is configured to recirculate at least a gas mixture generated during the ozone sanitizing cycle to increase an ozone concentration inside the vessel.2. The system of claim 1 , further comprising:a first connecting means for coupling a first end of the ozone generating device and a first end of the vessel such that the ozone gas generated by the ozone generating device is directed into the vessel through the first connecting means; anda second connecting means for coupling a second end of the ozone generating device and a second end of the vessel such that the gas mixture inside the vessel during the ozone sanitizing cycle is directed through the second connecting means into the ozone generating device for additional ozone generation to be delivered via the first connecting means into the vessel.3. The system of claim 1 , wherein a first end of the ozone generating device and a first end of the vessel are configured to couple with each other directly without ...

Sterilization Container With Battery Powered Sensor Module For Monitoring The Environment In The Container

A sterilization container with a sensor module for monitoring the environmental characteristics internal to the container. The sensor module includes a normally closed end bore. A sensor is disposed in the closed end void space. Other sensors also part of the module monitor the pressure and temperature of the environment inside the container. Based on the measurements of the environment in the container and the environment within the closed end void space it is possible to determine the extent to which the container is filled with saturated steam.

Dialysis machine, method of controlling the dialysis machine, and computer program for implementing the control

In an embodiment, a dialysis machine includes a dialyser, a fluid line in fluid communication with the dialyser, an inlet valve enabling fluid to flow into the fluid line towards the dialyser during a dialysis treatment, a disinfectant line connected to the fluid line via a disinfectant valve upstream of the dialyser, the disinfectant valve enabling a disinfectant fluid to be provided to at least part of the fluid line during a disinfection procedure, and a controller programmed to open the inlet valve, while the disinfectant line is connected to a source of disinfectant fluid, to create a positive pressure gradient across the disinfectant valve as fluid flows into the fluid line towards the dialyser, the positive pressure gradient ensuring that the disinfectant fluid from the source of disinfectant fluid does not leak into the fluid line during the dialysis treatment.

DISPOSABLE CLEANING SYSTEM & METHOD FOR REUSABLE ENDOSCOPIC SYSTEMS

Systems and methods for cleaning a medical device include a disposable pouch having an interior surface defining a cavity and an agitator disposed within the cavity of the pouch. 1. A disposable cleaning system for a medical device , comprising:a pouch having an interior surface defining a cavity; andan agitator disposed within the cavity of the pouch, the agitator having an interior surface defining a channel along a length thereof, an exterior surface and the interior surface of the agitator defining an aperture in open communication with the channel, wherein the aperture is configured to slidably receive a portion of a medical device therethrough and permit the medical device to be advanced within the channel to disinfect the portion of the medical device disposed within the channel.2. The disposable cleaning system according to claim 1 , wherein the agitator includes a spiral configuration terminating at closed distal end portion.3. The disposable cleaning system according to claim 2 , wherein the agitator is formed from a resilient material claim 2 , such that as a medical device is advanced within the channel claim 2 , the agitator transitions from the spiral configuration to a configuration conforming to a profile of the medical device.4. The disposable cleaning system according to claim 1 , wherein the channel of the agitator includes a chemical disinfectant disposed therein.5. The disposable cleaning system according to claim 1 , wherein the aperture includes a penetrable seal configured to be penetrated by a portion of a medical device.6. The disposable cleaning system according to claim 1 , wherein the aperture includes a self-closing gland configured to be penetrated by a portion of a medical device.7. The disposable cleaning system according to claim 1 , further including a fluid reservoir disposed on the exterior portion of the agitator claim 1 , the fluid reservoir having an inner surface defining a cavity having a chemical disinfectant disposed ...

CONTINUOUS POSITIVE AIRWAY PRESSURE (CPAP) MACHINE CLEANING SYSTEM

A continuous positive airway pressure (CPAP) machine cleaning system. The system may include a lower enclosure with an ozone generator and a fan all located therewithin. The system may also include an upper enclosure with a dehumidifier mechanism housed within a rear portion thereof, a CPAP hose and CPAP mask connection located within the rear portion thereof, capable of removable attachment to a CPAP hose and a filter located on a top of thereof and capable of being removable therefrom. 1. A continuous positive airway pressure (CPAP) machine cleaning system , comprising:a lower enclosure, having an ozone generator, and a fan all located therewithin; a dehumidifier mechanism housed within a rear portion thereof;', 'a CPAP hose and CPAP mask connection located within said rear portion thereof, capable of removable attachment to a CPAP hose;', 'a filter is located on a top of thereof and capable of being removable therefrom;, 'an upper enclosure, havingwherein during a cleaning operation, said fan generates a forced flow of air through said ozone generator to generate an ozone flow and an air flow bath;wherein said ozone air flow is directed towards said CPAP hose and CPAP mask connection; andwherein said air flow bath is directed to said filter.2. The continuous positive airway pressure (CPAP) machine cleaning system of wherein said lower enclosure further comprises a battery located therewithin.3. The continuous positive airway pressure (CPAP) machine cleaning system of wherein said upper enclosure further comprises:a power switch located on a front face thereof in electrical communication with said battery;a control knob located on said front face thereof in electrical communication with said power switch;a display screen located on said front face thereof in electrical communication with said control knob;a data access door located on a side face thereof; anda two-part access door located on said rear portion thereof.4. A continuous positive airway pressure (CPAP) ...

CONTINUOUS STERILIZING SYSTEM

The invention relates to a continuous sterilizing system comprising a sterilizing body into which a thermal fluid is introduced for sterilizing products, the products to be sterilized being arranged in containers that circulate inside the sterilizing body, said sterilizing body being divided into different sterilization zones by means of dividing walls, and each of said dividing walls having a through-opening that is substantially the same shape as a container, such that the containers close the through-openings of the dividing walls, rendering the sterilization zones thermally isolated from one another. 1. A piece of continuous sterilizing equipment comprising a sterilizing body into which a thermal fluid is introduced for sterilizing products , the products to be sterilized being arranged in containers circulating inside the sterilizing body which is divided by means of dividing walls in different sterilization zones , wherein each dividing wall has a through hole having a shape substantially identical to the shape of a container , such that the containers close the through holes of the dividing walls , the sterilization zones being thermally isolated from one another , and each container is formed by a vertical stack of receptacles , the sterilizing body incorporating an inlet for the introduction of receptacles , and an outlet for the removal of receptacles.2. The continuous sterilizing equipment according to claim 1 , wherein a respective pressurizing chamber is arranged in relation to the inlet and the outlet of the sterilizing body.3. The continuous sterilizing equipment according to claim 2 , wherein the pressurizing chambers can be filled with water to reduce the pressure rise and drop time.4. The continuous sterilizing equipment according to claim 1 , wherein the sterilizing body has at one of its ends a loading zone for containers claim 1 , and the sterilizing body has at the opposite end an unloading zone for containers.5. The continuous sterilizing ...

Method and System for Steam Sterilization of Endoscopes

A method and device for high-pressure, high-temperature steam sterilization of endoscopes includes pressure resistant fittings to attach a steam generator to the ports of an endoscope. The method and device allows for high-pressure, high-temperature steam to circulate throughout the endoscope, exposing various surfaces to steam for sterilization. The method and device also allows for high-pressure, high-temperature steam to circulate selectively through the channels of the endoscope, selectively sterilizing the channels and allowing for use of this method with current high-level disinfection methods. The method and device also allows for movement of the scope elevator channel during the sterilization process, allowing for steam to reach the crevices around the elevator and other moving parts of an endoscope. 1. A method of disinfecting or sterilizing an endoscope where the endoscope has an external surface and a lumen , said method comprising the steps of:attaching a pressure resistance fitting to the scope tip or one of the openings of the lumen; anddelivering super-heated steam through the pressure fitting.2. The method of claim 1 , further including the step of attaching a suction mechanism to one of the other openings of the lumen and suctioning the super-heated steam.3. The method of claim 1 , wherein the delivery of superheated steam and the rate of suction are controlled by a microprocessor.4. The method of claim 3 , wherein at least one temperature or pressure sensor is housed in a path of the superheated steam and wherein said method further comprises the step of using data from said at least one sensor to control the rate of flow of superheated steam or the rate of suction.5. The method of claim 3 , wherein said microprocessor includes a user interface to input data from an operator and provide progress information back to the operator.6. An apparatus for disinfecting or sterilizing an endoscope claim 3 , comprising:at least one pressure resistant ...

INSTRUMENT STERILIZATION CONTAINER

An instrument sterilization container may include a base, a lid, a retention mechanism extending out from a base floor of the base, a first support mechanism extending out from a lid top of the lid, and a second support mechanism extending out from the base floor. A reusable instrument handle may be disposed between the first support mechanism, the second support mechanism, the retention mechanism, and a portion of the base. The portion of the base and the retention mechanism may be configured to prevent an actuation structure of the reusable instrument handle from extending during a sterilization of the reusable instrument handle in a medical autoclave. The first support mechanism and the second support mechanism may be configured to prevent the actuation structure from expanding during a sterilization of the reusable instrument handle in a medical autoclave. 1. A method comprising:disposing a surgical instrument handle in a base of an instrument sterilization container;disposing the surgical instrument handle between a first retention mechanism and a second retention mechanism or the instrument sterilization container;disposing the surgical instrument handle between a portion of the base and at least one of the first retention mechanism and the second retention mechanism;sterilizing the surgical instrument handle in a medical autoclave; andpreventing an actuation structure distal end of an actuation structure of the surgical instrument handle from extending relative to an actuation structure proximal end of the actuation structure.2. The method of further comprising:disposing the surgical instrument handle below a first support mechanism.3. The method of further comprising:disposing the surgical instrument handle above a second support mechanism.4. The method of wherein the actuation structure has a plurality of actuation arms.5. The method of further comprising:preventing a surgical instrument handle distal end of the surgical instrument handle from extending ...

Adapter for a Robotic Surgical Tool Cleaning System

An adapter for a robotic surgical tool autowasher system includes a frame matable with a drive housing of the robotic surgical tool, a shoulder defined on the frame and at least partially circumscribing a basin defined in the frame, and one or more fluid apertures defined in the basin and extending through the frame from a top surface to a bottom surface. One or more alignment features protrude from the frame and are arranged to align with and extend into a corresponding one or more apertures defined in a bottom of the drive housing. At least one of the one or more alignment features only partially plugs an associated aperture of the corresponding one or more apertures.

BARRIER LAYER

A barrier layer and corresponding method of making provide anti-inflammatory, non-inflammatory, and anti-adhesion functionality for a medical device implantable in a patient. The barrier layer can be combined with a medical device structure to provide anti-adhesion characteristics, in addition to improved healing, non-inflammatory, and anti-inflammatory response. The barrier layer is generally formed of a naturally occurring oil, or an oil composition formed in part of a naturally occurring oil, that is at least partially cured forming a cross-linked gel. In addition, the oil composition can include a therapeutic agent component, such as a drug or other bioactive agent. 145-. (canceled)46. A method of making a barrier layer device , the method comprising the steps of:providing a medical device structure; andcreating a barrier layer formed on at least a portion of the medical device structure; wherein the barrier layer is formed of a biological oil or oil composition comprising a cured fish oil, wherein the cured fish oil comprises fatty acids and glycerides, wherein two or more of the fatty acids are cross-linked to each other by ester bonds in a substantially random configuration, wherein the barrier layer is solid but flexible and serves as a physical barrier, and wherein the barrier layer degrades into non-inflammatory substances.47. The method of claim 46 , wherein creating the barrier layer comprises:providing a biological oil or oil composition;applying the oil or oil composition to the medical device structure; andcuring the oil or oil composition on the medical device structure to form the barrier layer.48. The method of claim 47 , further comprising partially curing the biological oil or oil composition prior to applying the oil or oil composition to the medical device structure to thicken the oil or oil composition.49. The method of claim 46 , further comprising applying the oil or oil composition using multiple tiers.50. The method of claim 46 , further ...

SELF-STERILIZING DEVICE USING PLASMA FIELDS

Embodiments of the invention relate to a method and apparatus for self-sterilizing a surface or other portion of the apparatus and/or sterilizing other objects. Embodiments can utilize self-generated and/or remotely controlled plasma fields for the purpose of self-sterilization and/or sterilization of another object. Embodiments of the invention can have broad applications in procedures and equipment requiring the sterility of devices used for medical procedures, decontamination procedures, drug delivery, sterility of consumer products, and sterility of food preparation equipment and tools. 1. A device capable of sterilizing or decontaminating at least a portion of a surface of the device , comprising:a surface;a means for generating a plasma that sterilizes or decontaminates at least a portion of the surface.2. The device according to claim 1 , wherein the means for generating the plasma comprises:one or more first electrodes located proximate the surface;one or more second electrodes located proximate the one or more first electrodes;a power source for applying a voltage across at least one of the one or more first electrodes and at least one of the one or more second electrodes so as to generate the plasma that sterilizes or decontaminates at least a portion of the surface.3. The device according to claim 1 , wherein the means for generating the plasma comprises a means for resistive barrier discharge.4. The device according to claim 1 , wherein the means for generating the plasma comprises a means for dielectric barrier discharge.5. The device according to claim 1 , wherein the means for generating the plasma comprises a means for producing an atmospheric pressure plasma jet.6. The device according to claim 1 , wherein the means for generating the plasma comprises a means for floating electrode dielectric barrier discharge.7. The device according to claim 2 , wherein the device is a surgical surface.8. The device according to claim 2 , further comprising one or ...

MEDICAL DEVICE DISINFECTING SYSTEM AND METHOD

A system for disinfecting a medical device is provided. The system includes a light source that generates light having at least one wavelength between about 100 nm and about 500 nm. The system further includes at least one cylindrical optical diffuser disposed in optical communication with at least one interior channel of a medical device, the at least one cylindrical optical diffuser having an outer surface and an end optically coupled to the light source. The at least one cylindrical optical diffuser is configured to scatter guided light through the outer surface to form a light diffuser portion having a length that emits substantially uniform radiation over its length. 1. A system for disinfecting a medical device , the system comprising:a light source that generates light having at least one wavelength between about 100 nm and about 500 nm; andat least one cylindrical optical diffuser disposed in optical communication with at least one interior channel of a medical device, the at least one cylindrical optical diffuser having an outer surface and an end optically coupled to the light source,wherein the at least one cylindrical optical diffuser is configured to scatter guided light through the outer surface to form a light diffuser portion having a length that emits substantially uniform radiation over its length.2. The system of claim 1 , wherein the cylindrical optical diffuser has a scattering-induced attenuation greater than about 50 dB/km.3. The system of claim 1 , wherein the cylindrical optical diffuser radiation is substantially uniform claim 1 , such that the difference between the minimum and maximum scattering illumination intensity is less than about 30% of the maximum scattering illumination intensity.4. The system of claim 1 , wherein the at least one cylindrical optical diffuser comprises a light diffusing optical fiber having a core claim 1 , a primary cladding claim 1 , and a plurality of nano-sized structures claim 1 , and wherein the guided ...

Disinfection Scrub For Male And Female Luer Connectors

A disinfection device is disclosed having a container, a scrub element, a disinfectant or antimicrobial agent, and a removable seal. The scrub element may be disposed on a base scrub. The container configured to define a chamber to contain the base scrub, scrub element, and disinfectant or antimicrobial agent. The base scrub and/or scrub element(s) are adapted to compress and contact the distal tip and sidewall of a male Luer connector, female Luer connector or hemodialysis connector upon insertion of the connector into the chamber. The removable seal prevents the disinfectant or the antimicrobial agent from exiting the chamber. Also described are methods of disinfecting a medical connector, and an assembly comprising a device for disinfecting a medical connector.

METHOD FOR PRODUCING A STERILIZABLE STRAINER DISH HAVING A THREE-DIMENSIONALLY STRUCTURED BOTTOM

A method for producing a strainer dish for receiving medical objects to be disinfected or sterilized. A base surface is produced from a sheet metal blank in a first machining step. In a second machining step, the sheet metal blank or base surface is provided with holes to obtain a perforated starting shape. In a third machining step which takes place after the first and second machining steps, a perforated plane is produced, which can be divided into a flat inner section and an edge section. In a fourth machining step which takes place after the third machining step, a strainer dish shape is produced. The raw bottom corresponds to the flat inner section of the perforated plane. A fifth machining step, which takes place after the third machining step, at least partially produces a three-dimensionally structured bottom from the flat inner section. 1. A method for producing a sieve basket for receiving medical items to be disinfected or sterilized , the method comprising the steps of:in a first processing step producing a base plate or sieve basket base surface comprising a bottom and side walls of the sieve basket in one piece.in a second processing step, taking place prior to or after the first processing step, providing the plate blank, or the sieve basket base surface with apertures or holes in order to obtain a perforated initial shape;in a third processing step taking place after the first and second processing steps, producing a perforated or punched plane that is divided into a flat inner portion;in a fourth processing step taking place after the third processing step, producing a sieve basket shape with a raw bottom and side walls extending vertically thereto, the raw bottom corresponding to the flat inner portion and the side walls corresponding to the flat edge portions of the perforated or punched plane; andin a fifth processing step which takes place directly or indirectly after the third processing step at least partially producing a three-dimensionally ...

Hygienic Medical Devices Having Hydrophilic Coatings and Methods of Forming the Same

Hygienic Hydrophilic coatings, hydrophilic coating formulations and wetting fluids that include an anti-infective agent. 1. A lubricous hydrophilic catheter assembly , comprising:a gas impermeable and liquid impermeable package having a sealed cavity;a catheter having a hydrophilic coating located within the sealed cavity; anda wetting fluid comprising a wetting agent and mannose located within the sealed cavity.2. The catheter assembly of claim 1 , wherein the wetting fluid further includes a peroxide generating enzyme.3. The catheter assembly of claim 2 , wherein the enzyme comprises an oxidoreductase.4. The catheter assembly of claim 2 , wherein the enzyme comprises glucose oxidase.5. The catheter assembly of claim 2 , wherein the enzyme comprises peroxidase.6. The catheter assembly of wherein the peroxidase comprises lactoperoxidase.7. The catheter assembly of claim 1 , wherein the hydrophilic coating comprises a hydrophilic polymer matrix.8. The catheter assembly of claim 7 , wherein a hydrophilic polymer of the hydrophilic polymer matrix comprises polyvinylpyrrolidone.9. The catheter assembly of claim 1 , wherein the hydrophilic coating further comprises an antioxidant.10. The catheter assembly of wherein the hydrophilic coating further comprises a thixotropic agent.11. The catheter assembly of wherein the thixotropic agent comprises pectin claim 10 , agar and/or alginate.12. The catheter assembly of wherein the wetting fluid further comprises sugar alcohol.13. The catheter assembly of claim 12 , wherein the sugar alcohol is xylitol.14. The catheter assembly of wherein the hydrophilic coating or wetting fluid further comprises an organic acid.15. A method of forming a lubricous hydrophilic catheter assembly claim 1 , comprising:inserting a catheter having a hydrophilic coating into a gas impermeable and liquid impermeable package having a cavity;placing a wetting fluid comprising a wetting agent and mannose into the cavity; andsealing the cavity.16. The method ...

CAPPING DEVICE FOR DISINFECTING MEDICAL INJECTION MEMBRANES

A device for disinfection of a medical injection port is provided. The device includes a capping portion having an inner surface, a hollow portion having an inner surface, a proximal opening, and a distal opening, a connector coupling the capping portion of the device to the hollow portion thereof, and a disinfecting absorbent material disposed inside the capping portion of the device. The connector permits movement of the capping portion between a fully-seated position on the hollow portion of the device, and a position apart from the proximal opening thereof to permit ingress to the medical injection port. 1. A device for disinfection of a medical injection port , comprising:a capping portion comprising an inner surface;a hollow portion comprising an inner surface, a proximal opening, and a distal opening; a fully-seated position on the hollow portion of the device, and', 'a position apart from the proximal opening thereof to permit ingress to the medical injection port, and, 'a connector coupling the capping portion of the device to the hollow portion thereof in a manner which permits movement of the capping portion between'}a disinfecting absorbent material disposed inside the capping portion of the device.2. The device of claim 1 , wherein the device is configured for attachment to the medical injection port to bring the disinfecting absorbent material of the capping portion in contact with the medical injection port.3. The device of claim 1 , wherein the capping portion comprises a covering member and a sidewall disposed substantially perpendicular to and in contact with the covering member.4. The device of claim 1 , wherein the hollow portion comprises a supporting member having the proximal opening and a sidewall disposed substantially perpendicular to and in contact with the supporting member.5. The device of claim 4 , wherein the proximal opening is located approximately at the center of the supporting member.6. The device of claim 1 , wherein the proximal ...

APPARATUS FOR OPTICAL DETECTION OF BIO-CONTAMINANTS BASED UPON MEASUREMENT OF SATURATION OF LIGHT INTENSITIES AT FLUORESCENCE WAVELENGTH RELATIVE TO LIGHT INTENSITIES AT A PREDETERMINED WAVELENGTH

A method for optical detection of residual soil on articles (such as medical instruments and equipment), after completion of a washing or a rinsing operation by a washer. A soil detection system provides an indication of soil on the articles by detecting luminescent radiation emanating from the soil in the presence of ambient light. 1. A soil detection system for detecting presence of soil on an article treated with a fluorescent agent bound to soil present on the article , the soil detection system comprising: a light source for producing laser light at an excitation wavelength for the fluorescence wavelength to be incident on the article,', 'a light filter for filtering light emanating from said article at first and second predetermined wavelengths including the fluorescence wavelength, said light emanating from said article including ambient light reflected by the article and light emitted by exciting the fluorescent agent bound to the soil with the laser light;', 'a light detector for detecting the filtered light emanating from said article and generating light data corresponding thereto, and, 'a scanning unit for scanning the article, the fluorescent agent emitting fluorescent light at a fluorescence wavelength, the scanning unit includinga control unit for receiving the light data generated by the detector to determine the presence of soil on the article based upon features detected at the fluorescence wavelength by comparing intensities of the filtered light at the two predetermined wavelengths, thereby discriminating between soil fluorescence and ambient light reflections.2. A soil detection system according to claim 1 , wherein the first and second predetermined wavelengths comprise a red light wavelength and a green light wavelength corresponding to the fluorescence wavelength.3. A soil detection system according to claim 2 , wherein said light detector is an image sensor that acquires and transmits to the control unit detected light data indicative of an ...

APPARATUS AND METHOD TO REPEATEDLY FILL AND PURGE CHANNELS OF ENDOSCOPE

A medical device reprocessor is operable to perform a method of cleaning an internal channel of a medical device. The method entails activating a pump assembly to deliver a detergent to the internal channel for a first predetermined duration, activating the pump assembly to deliver water to the internal channel to rinse out the detergent for a second predetermined duration, and activating the pump assembly to deliver pressurized air to the internal channel to purge out the water or detergent contained within the internal channel for a third predetermined duration. Subsequently, the method involves activating the pump assembly to deliver a predetermined volume of disinfectant to the internal channel, and activating the pump assembly to deliver pressurized air to purge out the disinfectant into a chamber. The method repeats filling the internal channel with detergent, water and disinfectant and the subsequent purging of the internal channel with pressurized air. 121-. (canceled)22. A medical device reprocessor comprising:(a) a port that is configured to couple with an internal channel of a medical device;(b) a pump system, wherein the pump system is in fluid communication with a detergent, water, pressurized air, and a disinfectant, wherein the pump system is configured to deliver the detergent to the port, wherein the pump system is further configured to deliver the water to the port, wherein the pump system is further configured to deliver the pressurized air to the port, wherein the pump system is further configured to deliver the disinfectant to the port; and(c) a control module;wherein the control module is operable to execute a control algorithm to deliver the detergent from the pump system to the port and terminate delivery at a first predetermined time threshold;wherein the control module is operable to execute the control algorithm to deliver the water from the pump system to the port when the first predetermined time threshold is met and terminate delivery ...

CONTAINER FOR STORING A DENTAL, ESPECIALLY ENDODONTIC INSTRUMENT, KIT AND METHOD

The present invention relates to a kit comprising 1. Kit , comprising:{'b': 1', '3', '3', '3', '3, 'i': 'c', 'a single endodontic instrument () in the form of an endodontic file, which has a tool shaft (), on one upper axial end region of which tool shaft () a handle or a coupling section for connection to a motor-driven rotary tool is formed and on the other, lower end region of which tool shaft () an in particular conically tapered working section () is formed, and'}{'b': 2', '2', '3', '1', '2', '1, 'i': a', 'c', 'b, 'a container () that is designed as a disposable packaging for storing a single endodontic instrument and has a lower container part (), which is open at its top side for receiving the working section () of the instrument (), and has an upper container part (), which is open at its underside for receiving the upper axial end region of the instrument (),'}{'b': 5', '2', '5', '6', '3', '1', '2', '6', '1', '3', '1, 'i': a', 'c', 'a, 'wherein a holder () is provided on the upper side of the lower container part (), which holder () has an axial through-opening () through which the working section () of the instrument () is inserted into the lower container part () and in which through-hole () the instrument (), in particular the tool shaft () of the instrument (), is positioned radially and/or axially and is fixed in a clamping manner and/or by a latching connection,'}{'b': 2', '2', '2', '2', '1, 'i': b', 'a, 'wherein the upper container part () is connected to the lower container part () in an airtight manner to form the container (), and wherein the interior of the container () and the instrument () are sterile, and'}{'b': 2', '1', '2', '5', '2', '2', '3, 'i': a', 'a', 'a', 'a', 'c, 'wherein at least the lower container part () consists of a material dimensionally stable in such a way that the instrument () that is inserted into the lower container part () and positioned in the holder () can be gripped at its upper end region and pulled out of the lower ...

Active Materials, Surfaces, Surface Treatments And Methods Using Inclusion Complex Formers For Pathogen Reduction

A complex or composition of a photosensitizer associated with an inclusion complex former for use in forming active surfaces and active materials to kill or render inactive pathogens. A composition having photosensitizer associated with an inclusion complex former, a nanoparticle and liquid. Treating a material, such as a fabric, fiber, product, surface, woven, and non-woven with a photosensitizer and nanoparticle whereby treated material is an active surface that kills or renders inactive pathogens upon illumination with sufficient light. 2. The compositions of any of claim 1 , wherein the photosensitizer is selected from the group consisting of methylene blue (CAS #61-73-4) claim 1 , Rose Bengal (CAS #632-69-9) claim 1 , Riboflavin (CAS #83-88-5) claim 1 , Toluidine Blue (CAS #92-31-9) claim 1 , Eosin Blue (CAS #16423-68-0) claim 1 , Curcumin claim 1 , Verteporfin claim 1 , Erythrosin B claim 1 , New MB claim 1 , Eosin Y claim 1 , Erythrosine claim 1 , PHOTOFRIM claim 1 , Photochlor (CAS #149402-51-7) claim 1 , IR700 Chlorin e6 claim 1 , Protoporphyrin IX claim 1 , NPe6PH claim 1 , Curcumin claim 1 , and combinations thereof.3. The composition of claim 1 , wherein the inclusion complex former is selected from the group consisting of cyclodextrins claim 1 , unsubstituted cyclodextrins claim 1 , alpha-cyclodextrin claim 1 , beta-cyclodextrin claim 1 , gamma-cyclodextrin claim 1 , calixarenes claim 1 , cryptands and crown ethers and derivatives of each of these claim 1 , and wherein the photosensitizer is associated with the inclusion complex former by Van der Waals forces.4. The composition of claim 1 , wherein the inclusion complex is covalently bonded to a nanoparticle selected from the group of PEG claim 1 , 8-PEGA claim 1 , and PAA.5. The composition of claim 1 , wherein said aqueous carrier comprises water and less than about 20% alcohol claim 1 , wherein said alcohol is a monohydric or polyhydric alcohol.6. The composition of claim 1 , wherein said composition ...

Automated Germicidal Inhibitor System and Method of Operation

An automated ultraviolet germicidal system sterilizes a sterilization area with an automated sterilization mechanism that is selectively actuated and terminated, depending on events in the sterilization area, and elapse of a predetermined time period. A sterilization mechanism selectively emits a germicide element in or near a sterilization area, so as to sterilize the sterilization area from germs. An actuation device operatively connects with the sterilization mechanism to regulate the actuation and termination of the germicide element generated by the sterilization mechanism. A command device, controlled by a user, transmits an actuation signal to the actuation device to actuate the sterilization mechanism, upon entry of a code. A termination device has a set of sensors that detects events near the sterilization area, and transmits a termination signal to the actuation device to terminate operation of the sterilization mechanism upon detection of the event, or after elapse of time period. 1. An automated germicidal inhibitor system , the system comprising:a sterilization mechanism operable to emit a germicide element;an actuation device detachably coupled to the sterilization mechanism, the actuation device comprising a plug operable to enable coupling to an external power outlet, whereby energy from the power outlet powers the sterilization mechanism,the actuation device further comprising an actuation transreceiver and a switch mechanism, the actuation transreceiver and the switch mechanism being operatively connected to the sterilization mechanism, the switch mechanism operable to actuate operation of the sterilization mechanism;a command device comprising a command transceiver, an entry key pad, and a timer, the entry key pad operable to enable entry of a code, the timer operable to count a predetermined time period, the command transreceiver operable to transmit an actuation signal to the actuation transreceiver of the actuation device when the code is ...

CONTAINER FOR CLEANING AND STERILIZING MENSTRUAL CUPS

A container for cleaning and sterilizing a menstrual cup includes a vessel with an inner cavity made of elastic material having a bell-shaped portion for collecting menses and gripping means for insertion and removal during menstrual cycle; a lid closing an open-top, the vessel and the lid being made of materials suitable for exposure to microwave radiation, holding means for connecting the menstrual cup to the lid with the gripping means, wherein the lid is reversible for fitting on the open-top in two mounting positions, the first mounting position with the holding means directed towards the inner cavity such that, when attached to the lid, the menstrual cup projects at least partially into the inner cavity, and the second mounting position with the lid reversed and the holding means directed away from the inner cavity such that, when attached to the lid, the menstrual cup projects outwardly. 1182528551652851625525. A container for cleaning and sterilizing a menstrual cup , comprising: a vessel () with an open-top having a bottom () , side walls defining an inner cavity () for holding a cleaning liquid and for receiving a menstrual cup having gripping means (); a lid () closing the open-top; the container being made of materials suitable for exposure to microwave radiation , wherein the lid () comprises holding means () for connecting the menstrual cup to the lid () with the gripping means () , wherein the lid () can be fitted on the open-top in the first mounting position with the holding means () directed towards the inner cavity () such that , when attached to the lid () , the menstrual cup projects at least partially into the inner cavity ().25516255. A container according to claim 1 , wherein the lid () can be fitted in the second mounting position with the lid () reversed and the holding means () directed away from the inner cavity () such that claim 1 , when attached to the lid () claim 1 , the menstrual cup projects outwardly.3. A container according to ...

INSTRUMENT STERILIZATION MONITORING SYSTEM AND METHOD

An instrument sterilization monitoring system and an instrument sterilization monitoring method are provided. The instrument sterilization monitoring system includes a server, a sterilization device, and a mobile device. An image capturing module of the mobile device is used to capture image information of a first sterilization device indication device in the sterilization device, image information of a first sterilization device indication label, image information of a second instrument indication device, and image information of a second instrument indication label which are disposed outside an instrument package. The image information is uploaded to the server. The server determines, according to the image information, whether or not the instrument package meets a sterilization standard. 1. An instrument sterilization monitoring system , comprising:a server; anda sterilization device being used to perform a sterilization procedure on a plurality of instruments to be sterilized;wherein a mobile device including an image capturing module is used by a user to log in to the server; andthe server determines, according to image information of a plurality of sterilization device indication devices of the sterilization device and image information of a plurality of instrument indication devices of the instruments to be sterilized, whether or not the sterilization device and the instruments to be sterilized reach a plurality of sterilization standards.2. The instrument sterilization monitoring system of claim 1 , wherein a first sterilization device indication device and a second sterilization device indication device are disposed in the sterilization device; at least one of the instruments to be sterilized and a first instrument indication device are placed together in a packaging material claim 1 , to form an instrument package; a second instrument indication device is disposed outside the instrument package; the plurality of instruments to be sterilized is packaged to ...

ANTIMICROBIAL COMPOSITION HAVING EFFICACY AGAINST ENDOSPORES

A sporicidal composition has a moderately low pH and includes at least one oxidizing acid and the dissociation product of at least one inorganic oxidizing agent. Very high effective solute concentrations can enhance the efficacy of the composition. Embodiments of the composition can be applied to a surface and allowed to absorb into the endospore, ultimately killing at least some of those bacteria in mature endospore form. The surface being treated can be an inanimate surface, particularly a hard surface, or a medical device. 116-. (canceled)17. A sporicidal composition having a pH of from 1.5 to 4 , inclusive , and an effective solute concentration of from 1.5 to 9 Osm/L , inclusive , said composition comprising , on a per liter basis:{'sub': 'p', 'sup': '1/2', 'claim-text': 1) 50-500 mL water and', '2) at least one organic liquid, and, 'a) a solvent component having a δvalue less than 15.6 MPathat comprises'} [{'sub': 'a', '1) dissociation product of an oxidizing acid having a pKvalue of greater than 3 and a standard potential of at least +0.5 V,'}, '2) dissociation product of from 4 to 20 g of an electrolyte oxidizing agent having a standard potential of at least +1.5 V, and', '3) dissociation product of at least one non-oxidizing electrolyte., 'b) a solute component that comprises'}18. The sporicidal composition of wherein said solute component further comprises wetting agent.19. The sporicidal composition of wherein said oxidizing acid is the reaction product of an organic acid and a peroxide.20. The sporicidal composition of having a pH of no more than 3 and an effective solute concentration of at least 2 Osm/L.21. The sporicidal composition of wherein said wetting agent comprises anionic surfactant.22. The sporicidal composition of wherein said wetting agent further comprises nonionic surfactant.23. The sporicidal composition of wherein said oxidizing acid is the reaction product of an organic acid and a peroxide.24. The sporicidal composition of having a pH ...

Sterilizing method and apparatus

Methods and apparatus for sterilization are presented. An apparatus includes a sterilizing cabinet assembly including a cabinet having an access port and a bottom, the bottom configurable to induce a condensate to flow on the bottom to a vent port. The apparatus further includes a door connected to the cabinet, the door moveable between an open position permitting passage through the access port to an interior of the cabinet and a closed position precluding passage through the access port. The apparatus also includes at least one of the cabinet and the door having the vent port, and a filter overlying the vent port and forming a sealed interface with an adjacent portion of the one of the cabinet and the door.

Condensation assembly and method

A condenser assembly for a chamber of a sterilization system is provided which includes a cooling apparatus operable within the chamber and external means for receiving exhaust air and vapors from the chamber and for separating vapors into water and air. The external means may include an air-water separator or a condenser. The cooling apparatus is operable during at least one phase or cycle of a sterilization process to reduce the temperature inside the chamber and increase the condensation of vapors inside the chamber. A method of treating articles in a sterilization system with the condenser assembly includes disinfecting the articles in a chamber and, after disinfecting, recondensing vapor within the chamber using the cooling apparatus.

METHODS AND APPARATUS TO DELIVER THERAPEUTIC, NON-ULTRAVIOLET ELECTROMAGNETIC RADIATION TO INACTIVATE INFECTIOUS AGENTS AND/OR TO ENHANCE HEALTHY CELL GROWTH VIA A CATHETER RESIDING IN A BODY CAVITY

Methods and apparatus provide therapeutic electromagnetic radiation (EMR) for inactivating infectious agents in, on or around a catheter residing in a patient's body cavity and/or for enhancing healthy cell growth. The method comprises transmitting non-ultraviolet therapeutic EMR substantially axially along an optical element in a lumen of the catheter body and/or the catheter body. Through delivery of the therapeutic EMR to particular infected areas and/or areas requiring tissue healing. The methods and apparatus of the present disclosure inactivate the major sources of infection in, on, and around catheters and/or enhance healthy cell growth around catheters. 1. A medical device assembly for insertion into a cavity of a patient's body and for delivery of a fluid to and/or retrieval of fluid from the patient's body , comprising:{'sup': 2', '2, 'an electromagnetic radiation (EMR) source for providing non-ultraviolet, therapeutic EMR having an intensity comprising a radiant exposure of at least 0.1 J/cmand up to 1.0 kJ/cmand power of at least 0.005 mW and up to 1 Watt, such intensity being sufficient to produce a therapeutic effect of at least one of inactivating one or more infectious agents and enhancing healthy cell growth;'}a catheter having an elongate catheter body with at least one internal lumen, a coupling end and an distal end, the distal end being insertable into the cavity of the patient's body, wherein the catheter body directs both the fluid and the therapeutic EMR axially relative to the catheter body, axial flow of the fluid within the catheter body facilitates at least one of delivery of fluid into the patient's body and retrieval of fluid from the patient's body;an optical element conducive to the axial propagation of the therapeutic EMR relative to the catheter body, the optical element having a position with respect to the catheter body of being at least one of in, on, or within a wall of the catheter body and within at least one internal lumen of ...

MOBILE STERILIZATION APPARATUS AND METHOD FOR USING THE SAME

A sterilization cabinet, comprising a top panel, at least two side panels, and a floor panel forming a part of a chamber of the sterilization cabinet; at least one door connected to at least one of the at least two side panels of the sterilization cabinet; a vent formed in at least one of the two side panels; at least one first filter covering the vent and a filter cover configured to hold the first filter against the vent; a drain positioned in the floor panel, wherein the floor panel has a slope configured to cause condensate within the chamber to flow into the drain and wherein the drain is the only outlet for the condensate along the floor panel; and a second filter covering the drain such that condensate flowing into the drain passes through the second filter. 1closing a sterilization container having at least one vented area that allows fluids to pass into and out of the sterilization container where the at least one vented area is located in a panel of the sterilization container;positioning a first filter to fully cover the at least one vented area and such that the first filter extends beyond a perimeter of the at least one vented area;engaging a portion of the first filter to the panel of the sterilization unit at an area beyond the perimeter of the at least one vented area;positioning a second filter over the first filter such that the second filter covers the at least one vented area;affixing an edge of a filter cover against the sterilization unit to engage the second filter directly against the first filter and the first filter against the panel such that the edge forms a seal with both the first filter and the second filter against the sterilization unit;initiating a sterilization cycle on the sterilization unit to sterilize an internal region of the sterilization unit;loosening the filter cover from the sterilization unit to disengage the seal of the edge from at least the second filter against the sterilization cabinet;detaching the second filter ...

Biofilm inhibiting compositions enhancing weight gain in livestock

A method of enhancing the growth of an animal, as well as treating or preventing antimicrobial infections is provided. The method includes causing the animal to ingest or absorb an effective amount of one or more Fe III complex compounds, including but not limited to Fe III complexes comprising ligands bound to the iron center such as amino acids or α-hydroxy acids. The compounds are also useful for inhibiting, reducing, or preventing biofilm formation or buildup on a surface; the treatment of, inhibition of growth of, and inhibition of colonization by, bacteria, both in biological and non-biological environments; disinfecting surfaces, potentiating the effects of antibiotics and other anti-microbial agents, and increasing the sensitivity of bacteria and other microorganisms, to anti-microbial agents are also provided.

Wipe for killing spores

This invention relates to a wipe for killing spores comprising an absorbent sheet holding an aqueous composition and a sealed package containing the absorbent sheet, wherein the aqueous composition comprises water, an antimicrobial agent and a peroxide. The invention also relates to a process for killing spores using the above-indicated wipe.

Systems and Methods for Tagging and Tracking Surgical Devices and Surgical Accessories Using Radio Frequency Identification Tags

Various systems and methods are provided for tagging and tracking surgical devices using radio frequency identification (RFID) tags. In general, the systems and methods allow for tracking surgical devices throughout distribution and sterilization thereof. In an exemplary embodiment, the system includes a tray configured to seat a plurality of surgical devices and having a parent RFID tag attached thereto that contains information and/or facilitates access to information about the tray and each of the surgical devices seated therein. Each of the surgical devices seated in the instrument tray can have attached thereto a child RFID tag containing information and/or facilitating access to information about the surgical device. 118.-. (canceled)19. A radio frequency identification (RFID) assembly , comprising: an annular disc including a proximal surface and a distal surface;', 'a protrusion extending from the proximal surface; and', 'a threaded distal portion extending from the distal surface; and, 'a thumb grip, comprisinga RFID tag rotatably secured to the threaded distal portion.20. The RFID assembly of claim 19 , whereinthe RFID tag is disposed within a casing having a bore extending therethrough.21. The RFID assembly of claim 20 , whereinthe threaded distal portion includes a rod extending from a distal end of the threaded distal portion; andthe rod is disposed within the bore of the casing to rotatably secure the RFID tag to the thumb grip.22. The RFID assembly of claim 21 , whereina knob having a diameter greater than the bore is disposed at the distal most end of the rod and is configured to retain the RFID tag on the rod.23. The RFID assembly of claim 19 , wherein the thumb grip and the RFID tag are non-removably mated to one another such that they can be installed in a surgical instrument or implant as a single assembly.24. The RFID assembly of claim 19 , wherein the threaded distal portion is cylindrical and includes threads that extend around the threaded ...

CONTAINER FOR STERILISING OBJECTS AND STERILISING SYSTEM COMPRISING SAID CONTAINER

A container for sterilising objects, includes: a hollow body with mainly longitudinal development and closed at one end by a bottom, the hollow body being provided at the opposite end with an opening in proximity to which there is a first connection area; a substantially tubular body provided, in proximity to its ends, respectively with a second and a third connection area, each one of which is suited to be alternatively coupled with the first connection area of the hollow body. The container furthermore includes a shaped cover provided, at the level of its inner side walls, with a fourth connection area suited to be coupled with one of the connection areas of the tubular body and with the hollow body; a support is arranged inside the tubular body and in proximity to one of its ends, the support being configured so as to support one or more objects to be sterilised; a maximum pressure valve applied to the hollow body. 1. A container for sterilising objects , comprising:a hollow body with mainly longitudinal development, closed at one end by a bottom, said hollow body being provided at the opposite end with an opening in proximity to which there is a first connection area;a substantially tubular body provided, in proximity to its ends, respectively with a second and a third connection area, each one of which is suited to be alternatively coupled with said first connection area of said hollow body;a shaped cover provided, at the level of its inner side walls, with a fourth connection area suited to be alternatively coupled with one of said connection areas of said tubular body and with said hollow body;supporting means arranged inside said tubular body and in proximity to one of its ends, said supporting means being configured so as to support one or more objects to be sterilised;a maximum pressure valve applied to said hollow body, wherein said container is suitable to assume:a sterilization configuration in which said tubular body is coupled to said shaped cover ...

APPARATUS FOR DECONTAMINATING EQUIPMENT HAVING INTERNAL CHANNELS (LUMENS)

A method of cleaning an endoscope in a computer-controlled washer/disinfector comprising the steps of connecting each lumen of an endoscope to a fluid distribution system for selectively conveying pressurized air or pressurized fluids through lumens in an endoscope; identifying the type of endoscope to be cleaned in said washer/disinfector; determining a blockage threshold flow coefficient for each lumen for said endoscope to be cleaned; pressurizing each lumen in said endoscope individually and determining an actual flow coefficient through said lumen; determining whether said endoscope is suitable for cleaning by comparing said actual flow coefficients for a lumen in said endoscope to said blockage threshold flow coefficient for said lumen; and determining whether a connection to a lumen in said endoscope is properly connected based upon said flow coefficient through said lumen. 1. A method for operating a computer-controlled washer/disinfector for cleaning a medical endoscope , said method comprising the steps of:storing in memory identification and operating characteristics for a plurality of clean endoscopes, said operating characteristics including flow characteristics for each lumen within an endoscope and a blockage threshold flow coefficient for each lumen within an endoscope;connecting each lumen of an endoscope to be cleaned to a fluid distribution system for selectively conveying pressurized air or pressurized fluids through lumens in an endoscope;identifying the type of endoscope to be cleaned in said washer/disinfector;determining said blockage threshold flow coefficient for each lumen for said endoscope to he cleaned;pressurizing each lumen in said endoscope individually and determining an actual flow coefficient through said lumen;determining whether said endoscope is suitable for cleaning by comparing said actual flow coefficients for a lumen in said endoscope to said blockage threshold flow coefficient, for said lumen; anddetermining whether a ...

ENDOSCOPE CLEANING AND FLUSHING ACCESSORY

An endoscope cleansing accessory is described for use at the bedside, manual cleaning sink, or prior to decontamination of the endoscope with an automatic endoscope reprocessing (AER) apparatus. The cleansing accessory includes a cleansing pod or bulbous package filled with a cleaning composition, such as a foam, fluid or powder, and a blocking mechanism located at or near an opening of the cleansing pod. The blocking mechanism is configured to block a suction channel once the cleansing pod is tightly fitted over a distal end of the endoscope. External pressure applied to the outside of the cleansing pod in the form of repeated compression or squeezing drives the cleaning fluid through an elevator platform or forceps raiser bridge mechanism within the endoscope's distal end to loosen tissue and other particles, which can then be flushed out during manual cleaning or by the flowing cleansing fluid of an AER. 1. An endoscope accessory for use in endoscope reprocessing , the endoscope having at a distal end an elevator platform or forceps raiser assembly and a suction channel inlet disposed adjacent the elevator platform , the endoscope accessory assembly comprising:a cleansing bulbous member configured to be located over the distal end of the endoscope, the bulbous member having an opening configured to be removably fitted over the distal end of the endoscope;a cleaning composition disposed within the bulbous member; anda blocking mechanism configured to block the inlet of the suction channel, wherein pressure applied to an external surface of the bulbous member drives the cleansing composition through elevator platform or forceps raiser within the distal end of the endoscope to loosen tissue and other particles,wherein the bulbous member has a shape which facilitates collection of loose tissue and other particles on an internal surface located longitudinally below the bulbous member opening.2. The endoscope accessory of claim 1 , the blocking mechanism located at or ...

ENERGY RECOVERY DEVICE

An energy production device for a chargeable energy storage is arranged on a fluid conduit of an existing fluid circuit in a device through which a fluid flows. The fluid flow in the fluid conduit primarily serves a predetermined purpose different from that of the energy production device. The energy production device is arranged to produce energy from the kinetic energy of the fluid flow to charge the chargeable energy storage. A module insertable into the device may include the energy production device. The device may be a washer disinfector for processing medical instruments, systems and/or products that include at least one handpiece having a chargeable energy storage. The energy storage is configured as a rechargeable battery or as a power cell and is adapted to be processed together with the handpiece in the washer disinfector. 116.-. (canceled)17. A module for use in a processing process for a medical product , system and/or instrument having an integrated or connectable , exchangeable and chargeable energy storage , the module being configured to be held or supported during the processing process in a washer disinfector as a processing device , the module comprising:a connection for connecting the module to an existing fluid circuit of the processing device;a conduit as a fluid conduit for guiding a fluid flow as a fluid flowing at the connection into the module, through the module;a port portion;at least one connection port provided at the port portion and configured to hold the medical product, system and/or instrument such that the medical product, system and/or instrument can be flushed by fluid flowing in through the connection port;an energy production device configured to be arranged on or in the fluid conduit of a fluid circuit of the washer disinfector, and arranged to produce energy from kinetic energy of the fluid flow for charging the energy storage; andan induction device arranged in an area in which the energy storage of the medical product, ...

ANTIVIRAL METHODS AND COMPOSITIONS

A method of inactivating an enveloped ssRNA virus, such as SARS-CoV-2. The method involves contacting the enveloped ssRNA virus with an antiviral polyelectrolyte compound and/or a conjugated aromatic compound effective to inactivate the virus. The disclosure also provides a method of reducing the period of viability of enveloped ssRNA virus, such as SARS-CoV-2, on personal protective equipment, in air, in water, and/or on surfaces that have come into contact with the virus. 2. The method of claim 1 , wherein the enveloped ssRNA virus is SARS-CoV-2.3. The method of claim 1 , wherein the contacting is in the presence of visible light and/or UV light.4. The method of claim 1 , wherein the compound has a molecular weight of less than 2000 Da.5. The method of claim 1 , wherein the compound has the structure of formula I and n=1.6. The method of claim 1 , wherein the compound has the structure of Formula II claim 1 , and wherein:each of X and Y is independently H or COOR;{'sub': 2', 'm, 'each of Za is O—(CH)-T;'}{'sup': '1', 'sub': 6', '4, 'Gis CH;'}{'sup': '2', 'Gis a bond;'}J and Q are each CH so as to provide a benzene ring;n is 1;p is 1 to 10,000;m is 2 to 3;each of R is methyl or ethyl;{'sub': '3', 'sup': '−', 'each of T is SO, N-hexyl DABCO, or N-methyl imidazolyl;'}L1 is —C≡C—;L2 is unsubstituted phenylene; andL3 is —C≡C—.7. The method of claim 1 , wherein the method is a method of reducing SARS-CoV-2 viability on a substrate claim 1 , the method further comprising treating a substrate with the composition and exposing the substrate to SARS-CoV-2 in the presence of light.8. The method of claim 1 , wherein the substrate is a wipe claim 1 , a tissue claim 1 , a bandage claim 1 , a medical device claim 1 , a surgical instrument claim 1 , a sponge claim 1 , a textile claim 1 , a diaper claim 1 , a counter-top claim 1 , a food preparation surface claim 1 , a wound dressing claim 1 , a dressing for surgical incisions claim 1 , a keyboard surface claim 1 , a packing for ...

CONTAINER FOR TREATMENT OF ENDOSCOPES

A container for endoscopes, usable for the containment of endoscopes during washing, sterilization, drying and for the subsequent storage of endoscopes subjected to such operations, characterized in that it is provided with signaling means () applied to said container () and adapted to emit a signal if the pressure inside the same container () is below a pre-established value. 1. A container Container for endoscopes , usable for the containment of endoscopes during washing , sterilization , drying and for the subsequent storage of endoscopes subjected to such operations , characterized in that it is provided with signaling means applied to said container and adapted to emit a signal if the pressure inside the same container is below a pre-established value.2. The container Container for endoscopes claim 1 , according to claim 1 , wherein said signaling means are of visual and/or acoustic type.3. The container for endoscopes claim 1 , according to claim 1 , wherein said container comprises two complementary and separable parts suitable for defining an internal compartment in which an endoscope can be positioned claim 1 , one of the parts or base being provided with a multiple connector which allows to connect the channels of the endoscope with a system of external pumps through which washing and sterilization fluids are fed into the same channels.4. The container for endoscopes claim 1 , according to claim 1 , wherein said container comprises a plurality of openings to allow the entry and exit of fluids inside the container.5. The container for endoscopes claim 1 , according to claim 1 , wherein said container comprises a plurality of openings to allow the entry and exit of fluids inside the container and means for diverting the fluids at the entry opening to increase the efficiency of the treatment.6. The container for endoscopes claim 1 , according to claim 1 , wherein it is provided with a supporting structure provided with supporting elements suitable for ...

APPARATUS FOR OPTICAL DETECTION OF BIO-CONTAMINANTS BY COMPARING INTENSITIES OF FILTERED LIGHT AT TWO PREDETERMINED WAVELENGTHS

A method for optical detection of residual soil on articles (such as medical instruments and equipment), after completion of a washing or a rinsing operation by a washer. A soil detection system provides an indication of soil on the articles by detecting luminescent radiation emanating from the soil in the presence of ambient light. 1. A soil detection system for detecting presence of soil on an article , the soil detection system comprising: a light source for producing incident light on the article, the incident light having an excitation wavelength for producing the fluorescent light at the fluorescence wavelength,', 'a light filter for filtering the light emanating from said article at the fluorescence wavelength and a second predetermined wavelength,', 'a light detector for detecting the filtered light emanating from said article and generating light data corresponding thereto, said light emanating from said article including ambient light reflected by the article and light emitted by exciting the fluorescent agent bound to the soil, and, 'a scanning unit for scanning the article treated with a fluorescent agent bound to soil present on the article, the fluorescent agent emitting fluorescent light at a fluorescence wavelength, said scanning unit includinga control unit for receiving the light data generated by the detector to determine the presence of soil on the article by spectrally discriminating between the fluorescent light and the ambient light reflections based upon a measure of saturation of light intensities of combined fluorescent light and ambient light at the fluorescence wavelength relative to light intensities of ambient light at the second predetermined wavelength.2. A soil detection system according to claim 1 , wherein the light source for producing incident light comprises a device able to emit a monochromatic electromagnetic field in an ambient light environment.3. A soil detection system according to claim 2 , wherein the light source is a ...

Antimicrobial Backlit Device

Antimicrobial backlit devices and methods are provided. In one example embodiment, a device can have an antimicrobial lighting system. The antimicrobial lighting system includes a light source associated with a display device. The light source includes a plurality of lighting elements. One or more of the lighting elements of the plurality of lighting elements can be configured to emit high intensity narrow spectrum (HINS) light proximate the display device (e.g., onto or through the display device). 120-. (canceled)21. An electronic device , comprising:a display device; anda backlight system configured to provide backlight for the display device, the backlight system including one or more high intensity narrow spectrum (HINS) light sources configured to emit HINS light, the backlight system further comprising one or more non-HINS light sources configured to emit non-HINS light; andone or more control devices configured to control an operational state of said backlight system, wherein controlling the operational state of said backlight system includes controlling an aspect of light delivered by the HINS light sources and controlling an aspect of light delivered by the non-HINS light sources.22. The electronic device claimed in claim 21 , wherein said one or more control devices control the operational state of said backlight system based at least in part on a predefined timing schedule.23. The electronic device claimed in claim 21 , further comprising one or more sensors configured to detect microbes within an area.24. The electronic device claimed in claim 23 , wherein said one or more control devices control the operational state of said backlight system based at least in part on a trigger event determined by an output of said one or more sensors.25. The electronic device claimed in claim 24 , wherein said trigger event includes a detection of microbes.26. The electronic device claimed in claim 25 , wherein said trigger event includes a detection of an amount or ...

STERILIZATION DEVICE

Described herein generally are sterilization devices that can allow sterilization of luminal connection ports. Methods of using these devices are also described. 1. A sterilization device comprising:a body comprising at least one indicator light, a battery, and a light source; andan adapter cap;wherein the adapter cap is inserted into a luminal connection port.2. The sterilization device of claim 1 , wherein the battery is at least 6 volts.3. The sterilization device of claim 1 , wherein the indicator lights turn green after the luminal connection port is sterilized.4. The sterilization device of claim 1 , wherein the light source is a light emitting diode.5. The sterilization device of claim 1 , wherein the light source emits ultraviolet C light.6. The sterilization device of claim 1 , wherein the light source has a wavelength of about 275 nm.7. The sterilization device of claim 1 , wherein the light source has a power of about 30 mW.8. The sterilization device of claim 1 , wherein the adapter cap is sterile.9. The sterilization device of claim 1 , wherein the adapter cap is disposable.10. The sterilization device of claim 1 , wherein the adapter cap is a male luer.11. The sterilization device of claim 1 , further including a switch claim 1 , at least one or more sensors claim 1 , or a multi-sensor to activate the sterilization device.12. The sterilization device of claim 1 , wherein sterilization occurs in less than about 10 sec.13. The sterilization device of claim 1 , wherein sterilization occurs in less than about 5 sec.14. The sterilization device of claim 1 , wherein microbial reduction is a 7-log microbial reduction.15. A method of sterilization claim 1 , the method comprising:inserting a luminal connection port into a sterilization device to apply sterilizing light to the luminal connection port,wherein the device sterilizes the surface of the luminal connection port.16. The method of claim 15 , wherein the sterilizing light is ultraviolet light.17. The ...

DISINFECTING APPARATUS

An apparatus uses disinfecting ultraviolet light in the C spectrum (UVC) within a housing having an interior chamber. The exterior surfaces of the apparatus are provided in stainless steel suitable for a health care environment. The housing is configured to receive a variety of large devices such as walkers and wheel chairs. Once placed in the interior chamber, first and second offset sanitizing lights are turned on to sanitize the item or items disposed in the interior chamber. The offset lights provide light coverage to both ends of an item such as a wheel chair placed in the interior chamber. The interior of the chamber is lined with reflective, noduled material, to reflect light in a scattered pattern to increase coverage for the item being sanitized. A door closes the interior chamber when the lights are turned on. An interlock is used with the door to turn the lights off when the door is open. 1. An apparatus for disinfecting an item; the apparatus comprising:a housing defining an interior chamber; the housing having an opening that allows the item to be sanitized to be placed into the interior chamber of the housing;the chamber being partially defined by first and second side walls and a ceiling;first and second UVC lamps disposed above the ceiling; the first and second lamps selectively providing UVC light to the interior chamber of the housing;the first lamp being spaced from the first side wall by a first distance;the second lamp being spaced from the second side wall by a second distance;the first limo being spaced from the second lamp by a third distance; andeach of the first and second distances being less than the third distance.2. The apparatus of claim 1 , wherein the housing has an interior surface; the interior surface being a reflective and irregular surface.3. The apparatus of claim 2 , wherein the reflective and irregular surface interior surface of the housing is a surface of a section of polished aluminum tread.4. The apparatus of claim 2 , ...

DEVICES, SYSTEMS, AND METHODS FOR STERILIZATION, DISINFECTION, SANITIZATION AND DECONTAMINATION

A sterilization, disinfection, sanitization, or decontamination system having a chamber defining a region, and a generator for creating a free radical effluent with reactive oxygen, nitrogen, and other species and/or a vaporizer. A closed loop circulating system without a free-radical destroyer is provided for supplying the mixture of free radicals from the generator mixed with the hydrogen peroxide solution in the form of the effluent to the chamber. The system is used in sterilizing, disinfecting, sanitizing, or decontaminating items in the chamber or room and, with a wound chamber, in treating wounds on a body. The wound chamber may be designed to maintain separation from wounds being treated. Various embodiments can control moisture to reduce or avoid unwanted condensation. Some embodiments can be incorporated into an appliance having a closed space, such as a washing machine. Some embodiments may include a residual coating device that deposits a bactericidal coating on sterilized items. 150-. (canceled)51. A method for sterilizing or disinfecting at least one item , the method comprising:placing the at least one item into a chamber configured to contain the at least one item;activating a conditioning phase, the conditioning phase comprising activating a blower to circulate air in a closed loop to dry the chamber; pumping sterilant with a peristaltic pump from a sterilant reservoir to a nebulizer;', 'converting sterilant into a vapor with the nebulizer;', 'activating the blower to circulate air, including the vapor, in the closed loop between the nebulizer and the chamber;', 'activating an ozone generator to generate ozone;', 'activating the blower to circulate air, including the ozone, in the closed loop between the ozone generator and the chamber;', 'activating a purging phase, the purging phase comprising:', 'activating a valve to allow air to flow into the system through an inlet;', 'activating a valve to allow air to flow out of the system through an ...

STERILIZING METHOD AND APPARATUS

A sterilization container for retaining surgical instruments in a sterilizer comprising a plurality of walls defining an interior volume sized to receive at least one instrument tray, least one of the walls defining a venting pass through area, and a filter occluding the venting passage area, wherein a ratio of the venting pass through area to the interior volume is at least 1 square inch:125 cubic inches. 120-. (canceled)21. A sterilization container for sterilizing instruments in a sterilizer using a sterilizing agent , the sterilization container comprising:(a) an opening defined by a perimeter of an enclosing wall, the enclosing wall defining an interior volume sized to receive a plurality of instrument trays;(b) a door moveable between an open position and a closed position, wherein the interior volume is accessible through the opening when the door is in the open position; and(c) a filter cartridge having a gasket surrounding a first filter comprising a porous material wherein the filter cartridge is removably secured to the door when the door is in the open position, and wherein the gasket is positioned between the door and the enclosing wall to form a sealed interface between at least one of the door and the enclosing wall when the door is in the closed position.22. The sterilization container of further comprising a filter support overlapping at least a portion of the filter cartridge.23. The sterilization container of wherein the filter support is a vented area of the door.24. The sterilization container of wherein the filter support is a set of bars traversing the opening.25. The sterilization container of wherein the door and the enclosing wall define a total surface area claim 23 , and wherein the first filter and filter support define a venting pass through area claim 23 , wherein the venting pass through area is at least 5.7% of the total surface area.26. The sterilization container of wherein the filter cartridge further comprises a second filter ...

Technologies for sanitizing reservoirs

Technologies (e.g., devices, systems and methods) for sanitizing reservoirs are described. In some embodiments, the technologies include a sanitization gas system and a connector unit or a hole in the reservoir wall, configured to connect a supply line to the reservoir. The connector unit may include an inlet passageway for supplying sanitizing gas (e.g., ozone) into the reservoir.

Antibacterial method

The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, wherein the bacteria is selected from E. faecium, E. faecalis, E. hirae, S. pseudointermedius and/or S. hemolyticus; and/or in said method said bacteria are subjected to a stress condition. Also provided are related methods and uses such as methods of treatment. Also provided are novel truncation and fusion proteins variants such as MIKKFPNPYTLAAKLTTYEINVVYKQQYGRYPWERPVA and MKFKFNPTGTIVKKLTQYEINVVYKQQYGRYPWERPVA and their use as bacteriocins in various methods and uses.

Interior energy-activation of photo-reactive species inside a medium or body

A method and a system for producing a change in a medium. The method places in a vicinity of the medium an energy modulation agent. The method applies an initiation energy to the medium. The initiation energy interacts with the energy modulation agent to directly or indirectly produce the change in the medium. The energy modulation agent has a normal predominant emission of radiation in a first wavelength range outside of a second wavelength range (WR 2 ) known to produce the change, but under exposure to the applied initiation energy produces the change. The system includes an initiation energy source configured to apply an initiation energy to the medium to activate the energy modulation agent.

Autoclave for sterilisation

Provided is an autoclave for sterilisation including a sterilisation chamber, a tank of water, connection means configured to connect the tank to the sterilisation chamber in a fluidic through connection, heating means configured to heat and to pressurise the water and to supply the sterilisation chamber to perform sterilisation cycles, in which the tank includes a filter, the tank is in addition divided into a high potential portion and a low potential portion, the portions being in reciprocal fluidic through connection through the filter, the filter comprising a plurality of filtering layers including distribution layers configured to slow down and improve the distribution of the water along the entire area of the layers and active layers configured to perform purification functions of the water.

Apparatus for the Disinfection of Medical Instruments

Devices, methods and systems of disinfecting medical instruments, more particularly blood glucose meters. A disinfection cradle including a flat base for positioning the cradle on a surface, the cradle having a receptacle configured to receive the diagnostic apparatus, and a UV source positioned in the receptacle that is configured to administer a disinfection cycle to the diagnostic apparatus by directing UV light outward at the diagnostic apparatus received in the receptacle, the UV light being able to act as a disinfecting agent to the disinfection cradle and diagnostic apparatus.

System for spent nuclear fuel storage

The system for storage includes spent nuclear fuel arranged in a drift and at least one first mechanical structure configured to cause a target material to move in the drift. The at least one first mechanical structure is configured to at least assist in actively controlling an exposure rate of the target material to the spent nuclear fuel while the target material is being exposed to the spent nuclear fuel. The system includes at least one second mechanical structure configured to remove the target material from the drift after the target material is exposed to the spent nuclear fuel.

MIST GENERATOR FOR STERILIZING FORCED HOT AIR INTRAOPERATIVE PATIENT WARMER WITH IMPROVED STERILITY

A mist generator improves sterility of blowers having controlled forced air for patient warmers and lifters. The mist generator has a main body including a top wall with an opening, that traverses into a chamber adapted to receive a disinfectant, side walls and a bottom wall. The main body further includes an inlet duct adapted for attachment to a first hose which, in turn, is adapted for attachment to an output opening of the blower for delivery into the chamber of forced air carrying misted disinfectant. The main body also includes an output duct adapted for attachment to a second hose which, in turn, is adapted for attachment to an inlet opening of the blower for delivery of disinfectant misted air through internal components of the blower. The mist generator improves sterility of the blower, thereby mitigating microbial contamination of patient warmers and lifters, and hospital environments. 2) The mist generator as recited by claim 1 , wherein said blower is part of a non-closed circuit.3) The mist generator as recited by claim 1 , wherein said blower has microprocessor controlled air heating capability for delivery of heated forced air claim 1 , and said disinfectant is adapted to evaporate due to the heated forced air to yield misted air containing disinfectant.4) The mist generator as recited by claim 3 , wherein said disinfectant is a volatile liquid component that is adapted to vaporize as forced air blows over said disinfectant.5) The mist generator as recited by claim 3 , wherein said disinfectant is a volatile liquid component saturated within a substrate and said liquid vaporizes and escapes said substrate as forced air blows over said substrate.6) The mist generator as recited by comprising a transducer facilitating formation of said disinfectant mist.7) The mist generator as recited by claim 1 , wherein said disinfectant is an aqueous solution.8) The mist generator as recited by claim 1 , wherein said disinfectant is an alcohol solution.9) The mist ...

TRAY FOR HOLDING STERILIZATION TARGETS

Disclosed embodiments include a tray configured for holding various sterilization targets. The tray may include a perforated floor member connected to a plurality of vertically oriented walls, which may also be perforated. Together, the floor member and walls define an internal cavity that includes at least one wire support for removably holding at least one sterilization target, such as a medical instrument and/or implant or components thereof, within the internal cavity. Each wire support may include two end inserts and a middle portion, the two inserts secured via connection means to one or more walls of the tray. The connection means may comprise mounting fixtures that further include a plurality of receiving slots or holes each configured to receive an insert. The wire supports may increase sterilant flow and circulation, thereby improving sterilization of instruments and/or implants held within the tray disclosed herein. 1. A tray for holding sterilization targets comprising:a perforated floor member;a plurality of vertically oriented walls connected to the floor member around a perimeter of the floor member such as to define an internal cavity, wherein one or more of the walls may be perforated;at least one wire support for removably holding and supporting against lateral or longitudinal movement at least one sterilization target within the internal cavity, wherein each wire support comprises two ends and a middle portion, the middle portion comprising at least two bends in a wire from which the support is made; andconnection means associated with at least one of the plurality of vertically oriented walls for securing each end of the at least one wire support to the tray.2. The tray of claim 1 , further comprising a cover piece removably attached to the vertically oriented walls and positioned opposite the floor member.3. The tray of claim 2 , wherein the cover piece is configured to snap onto the plurality of vertically oriented walls.4. The tray of claim 1 ...

RADIODIAGNOSTIC APPARATUS AND METHOD OF OPERATING RADIODIAGNOSTIC APPARATUS

A breast imaging apparatus includes a radiation source that irradiates a breast of a subject with radiation, a radiation detector that detects the radiation transmitted through the breast to output a radiographic image, an ultraviolet light source that performs irradiation of ultraviolet light, and a controller that controls an operation of the ultraviolet light source. The controller prohibits the irradiation of the ultraviolet light by the ultraviolet light source in a case where a predetermined set condition is satisfied. The controller determines that the set condition is satisfied, for example, in a case where a person is shown in a captured image of a camera. 1. A radiodiagnostic apparatus comprising:a radiation source that irradiates an imaging part of a subject with radiation;a radiation detector that detects the radiation transmitted through the imaging part to output a radiographic image;an ultraviolet light source that performs irradiation of ultraviolet light; anda controller that prohibits the irradiation of the ultraviolet light by the ultraviolet light source in a case where a predetermined set condition is satisfied.2. The radiodiagnostic apparatus according to claim 1 , further comprising:a camera,wherein the controller determines that the set condition is satisfied in a case where a person is shown in a captured image of the camera.3. The radiodiagnostic apparatus according to claim 1 , further comprising:a moving body detection sensor that detects a moving body,wherein the controller determines that the set condition is satisfied in a case where the moving body detection sensor detects the moving body.4. The radiodiagnostic apparatus according to claim 1 , further comprising:a reception unit that receives an imaging menu indicating an imaging content,wherein the controller determines that the set condition is satisfied in a case where the reception unit receives the imaging menu.5. A radiodiagnostic apparatus according to claim 1 , further ...

METHODS FOR DETECTING A MEDICAL INSTRUMENT IN A DISINFECTION SYSTEM AND DISINFECTION SYSTEMS IMPLEMENTING THE METHODS

The present description relates to a disinfection system () configured to implement a disinfection cycle of a medical instrument () by UV radiation. The disinfection system () includes a disinfection chamber () configured to receive at least one portion of the medical instrument (), a suspension means () for suspending said at least one portion of the medical instrument () in said disinfection chamber (), a detection device () configured to detect, in a predetermined detection area of the disinfection system (), a marker () integral with said medical instrument (), and a controller () configured to generate a non-detection signal in case of non-detection of said marker () in said predetermined detection area. 1. A disinfection system configured to implement a disinfection cycle of a medical instrument by UV radiation , the disinfection system comprising:a disinfection chamber configured to receive at least one portion of the medical instrument;a suspension means for suspending said at least one portion of the medical instrument in said disinfection chamber;a detection device configured to detect a marker integral with said medical instrument, in a predetermined detection area of the disinfection system; anda controller configured to generate a non-detection signal in case of non-detection of said marker in said predetermined detection area.2. The disinfection system according to claim 1 , wherein the detection device comprises an optical detection device.3. The disinfection system according to claim 2 , wherein the detection device further comprises a source for emitting light radiation configured to illuminate said predetermined detection area.4. The disinfection system according to claim 2 , wherein the detection device comprises a barcode reader.5. The disinfection system according to claim 1 , wherein the detection device comprises radio frequency acquisition means.6. The disinfection system according to claim 1 , comprising at least one source of UV radiation.7 ...

Biological indicator for disinfection process challenge device

A method of verifying the efficacy of a disinfection process is provided. The method includes flowing a liquid disinfectant into an indicator device that has a plurality of indicator microorganisms disposed therein, the indicator microorganisms comprising or capable of producing a detectable enzyme activity; contacting the indicator microorganisms with the liquid disinfectant for a predetermined minimum first period of time at a first temperature; after contacting the indicator microorganisms with the liquid disinfectant for the first period of time at the first temperature, contacting the indicator microorganisms for a second period of time with a detection medium comprising a detection reagent; and during or after the second period of time, detecting a quantity of the detectable enzyme activity that was not inactivated by the contact with the disinfectant. The indicator device is also provided.

Systems and methods for onsite sorbent material reuse

Methods, sorbent cartridges and cleaning devices are disclosed for refurbishing sorbent materials. In one implementation among multiple implementations, a medical fluid delivery method includes: providing a sorbent cartridge including H + ZP within a casing for a treatment; and after the treatment, refurbishing the H + ZP while maintained within the casing via (i) regenerating the non-disinfected H + ZP by flowing an acid solution through the casing, (ii) rinsing the regenerated H + ZP while maintained within the casing, (iii) disinfecting the regenerated and rinsed H + ZP by flowing a disinfecting agent through the casing, and (iv) rinsing the regenerated and disinfected H + ZP while maintained within the casing. Multiple batch sorbent refurbishing implementations are also disclosed.

MOBILE STERILIZATION APPARATUS AND METHOD FOR USING THE SAME

A sterilization cabinet, comprising a top panel, at least two side panels, and a floor panel forming a part of a chamber of the sterilization cabinet; at least one door connected to at least one of the at least two side panels of the sterilization cabinet; a vent formed in at least one of the two side panels; at least one first filter covering the vent and a filter cover configured to hold the first filter against the vent; a drain positioned in the floor panel, wherein the floor panel has a slope configured to cause condensate within the chamber to flow into the drain and wherein the drain is the only outlet for the condensate along the floor panel; and a second filter covering the drain such that condensate flowing into the drain passes through the second filter. 1closing a sterilization container having at least one vented area that allows fluids to pass into and out of the sterilization container where the at least one vented area is located in a panel of the sterilization container;positioning a first filter to fully cover the at least one vented area and such that the first filter extends beyond a perimeter of the at least one vented area;engaging a portion of the first filter to the panel of the sterilization unit at an area beyond the perimeter of the at least one vented area;positioning a second filter over the first filter such that the second filter covers the at least one vented area;affixing an edge of a filter cover against the sterilization unit to engage the second filter directly against the first filter and the first filter against the panel such that the edge forms a seal with both the first filter and the second filter against the sterilization unit;initiating a sterilization cycle on the sterilization unit to sterilize an internal region of the sterilization unit;loosening the filter cover from the sterilization unit to disengage the seal of the edge from at least the second filter against the sterilization cabinet;detaching the second filter ...

ENCOSCOPE-CLEANING DEVICE

An endoscope-cleaning device ensures effective cleaning of an endoscope. The endoscope-cleaning device includes a long flexible core member inserted into a twisted tubular body including a weft yarn including a microfiber yarn, wherein the microfiber yarn is made of polyester and the tubular body is twisted at 5 twists/5 cm to 15 twists/5 cm. 14-. (canceled)5. An endoscope-cleaning device comprising a long flexible core member inserted into a twisted tubular body comprising a weft yarn comprising a microfiber yarn.6. The endoscope-cleaning device according to claim 5 , wherein the microfiber yarn is made of polyester.7. The endoscope-cleaning device according to claim 5 , wherein the tubular body is twisted at 5 twists/5 cm to 15 twists/5 cm.8. The endoscope-cleaning device according to claim 6 , wherein the tubular body is twisted at 5 twists/5 cm to 15 twists/5 cm.9. The endoscope-cleaning device according to claim 5 , wherein the microfiber yarn has a diameter of 2 μm to 8 μm.10. The endoscope-cleaning device according to claim 6 , wherein the microfiber yarn has a diameter of 2 μm to 8 μm.11. The endoscope-cleaning device according to claim 7 , wherein the microfiber yarn has a diameter of 2 μin to 8 μm.12. The endoscope-cleaning device according to claim 8 , wherein the microfiber yarn has a diameter of 2 μm to 8 μm. This disclosure relates to a cleaning device for use with medical devices, and more specifically to a cleaning device for cleaning endoscopes.During use in endoscopic examinations or surgical procedures, an endoscope typically becomes soiled with biological and other materials from a patient body (e.g., biliary fluids, saliva, feces, blood, pieces of tissue and the like) and potentially from other devices or materials used in conjunction with the endoscope. Because endoscopes are used multiple times, it is important that they are completely cleaned between uses to avoid cross-contamination between devices used with them, and between different ...

Modular Post and Partition Assembly for Equipment Sterilization

The present disclosure provides advantageous post and partition assembly that is configured and adapted to promote modularity and withstand the harsh environment of central sterile processing processes. Modular post assembly may be removed and relocated on tray without additional fasteners or components. Tray and bracket assembly may further provide identification features to correctly associate cataloged reusable medical devices to identified trays.

MOBILE STERILIZATION APPARATUS AND METHOD FOR USING THE SAME

A sterilization cabinet, comprising a top panel, at least two side panels, and a floor panel forming a part of a chamber of the sterilization cabinet; at least one door connected to at least one of the at least two side panels of the sterilization cabinet; a vent formed in at least one of the two side panels; at least one first filter covering the vent and a filter cover configured to hold the first filter against the vent; a drain positioned in the floor panel, wherein the floor panel has a slope configured to cause condensate within the chamber to flow into the drain and wherein the drain is the only outlet for the condensate along the floor panel; and a second filter covering the drain such that condensate flowing into the drain passes through the second filter. 1. A method of sterilizing medical instruments using immediate use sterilization , comprising:positioning at least one medical instrument within an enclosed sterilization area of a sterilization cabinet, the sterilization cabinet includes a plurality of walls and a floor, an opening to permit access to the enclosed sterilization area, a door configured to close the sterilization cabinet by forming a seal that closes the opening, at least one vent in the sterilization cabinet, a filter covering the vent on an exterior of the sterilization cabinet;closing door on the sterilization cabinet to seal the enclosed sterilization area;positioning the sterilization cabinet in an autoclave;initiating a sterilization cycle to sterilize the medical instruments within the sterilization cabinet by subjecting the sterilization cabinet to at least one steam application within the autoclave;drawing a vacuum within the enclosed sterilization area to pull condensate away from the medical instruments wherein any condensate remaining within the enclosed sterilization area is driven by gravity to a region of the cabinet that prevents flowing of the condensate out of the opening when the door is opened;ending the sterilization ...

STERILIZATION SYSTEM WITH INTEGRATED INSTRUMENT RECALL CAPABILITIES AND RELATED METHODS

A sterilization system with integrated instrument recall capabilities and related methods is disclosed. In one aspect, the sterilization system is adapted to determine a failed sterilization cycle of a sterilizer in response to failure of a biological indicator test for the sterilizer, identify sterilization cycles to be recalled based on the failed sterilization cycle, identify one or more patients for whom an item in a recalled sterilization cycle was used, and initiate a patient notification routine comprising at least one of outputting of identifying information of the one or more patients for whom an item in the recalled sterilization cycle was used and notifying the one or more patients for whom an item in the recalled sterilization cycle was used about the recalled sterilization cycle. 1. A sterilization system , comprising:a controller comprising a processor and a memory coupled to the processor;one or more sterilizers coupled to the controller;a printer coupled to the controller; receive, by the controller, first sterilization cycle data for the sterilization cycle, the first sterilization cycle data comprising one or more mechanical indicator values for the sterilization cycle;', 'receive, by the controller, second sterilization cycle data for the sterilization cycle; and', automatically generate a sterilization record in accordance with the first sterilization cycle data and second sterilization cycle data,', 'automatically store, by the controller, the sterilization record in a sterilization database, the sterilization record comprising a number of fields, the fields comprising a date of sterilization identifying a date upon which a sterilization cycle was performed, a sterilizer identifier (ID) identifying a sterilizer used in the sterilization cycle, a load type, a number of items sterilized in the load for which all of the chemical indicators matched predetermined criteria and which passed a visual inspection, an ID of a staff member who inspected and ...

Hollow Fiber Membrane Having Improved Diffusion Properties

The invention relates to an undulated thermostable hollow fiber membrane of reduced wall thickness, wherein the wall thickness amounts to 20 μm or greater and 30 μm or less and the waveform of the hollow fiber membrane exhibits a wavelength in the range of from more than 1 mm and less than 5 mm. In particular, the invention relates to a method for producing an undulated thermostable hollow fiber membrane of lower wall thickness. 1. An undulated hollow fiber membrane , comprising at least one first hydrophobic polymer , having a wall thickness of 20 μm or greater and 30 μm or less , whereinthe waveform of the hollow fiber membrane exhibits a wavelength in the range of from greater than 1 mm and less than 5 mm.2. The hollow fiber membrane according to claim 1 , wherein the waveform has an amplitude in the range of from 0.005 to 0.15 mm.3. The hollow fiber membrane according to claim 1 , wherein the hollow fiber membrane has a luminal diameter of from 160 to 230 μm.4. The hollow fiber membrane according to claim 1 , wherein the waveform is substantially sinusoidal.5. The hollow fiber membrane according to claim 1 , wherein the at least one first hydrophobic polymer is selected from the polyarylether claim 1 , polyamide claim 1 , polyester claim 1 , polycarbonate claim 1 , polyacrylate and methacrylate claim 1 , polymethacrylimide claim 1 , polyvinylidenfluoride claim 1 , polyimide or polyacrylnitrile group or the copolymers comprising corresponding monomer units of the cited polymers or the compounds of the cited polymers.6. The hollow fiber membrane according to claim 1 , wherein the hollow fiber membrane comprises at least one second hydrophilic polymer and that the at least one second polymer is selected from the polyvinylpyrrolidone or polyethylene glycol group or compounds thereof.7. The hollow fiber membrane according to claim 1 , wherein the porosity of the hollow fiber membrane is greater than 65%.8. A method for producing an undulated hollow fiber membrane ...