СНИЖЕНИЕ КОЛИЧЕСТВА В-КЛЕТОК С ИСПОЛЬЗОВАНИЕМ CD37-СПЕЦИФИЧЕСКИХ И CD20-СПЕЦИФИЧЕСКИХ СВЯЗЫВАЮЩИХ МОЛЕКУЛ

Изобретение относится к области биотехнологии и иммунологии. Предложены варианты антитела, специфичного к CD37 человека, каждый из которых содержит вариабельный участок легкой и тяжелой цепи. Описана кодирующая нуклеиновая кислота и вектор экспрессии на ее основе. Раскрыты: клетка-хозяин, содержащая вектор, способ получения антитела с использованием клетки, а также композиция для снижения количества В-клеток и способ лечения заболеваний, связанных с аберрантной активностью В-клеток, с использованием СD37-специфических антител. Использование изобретения обеспечивает специфическую гибель 80% клеток BJAB при концентрации антитела 10 мкг/мл, а также увеличивает выживаемость мышей Daudi, по сравнению с обработкой ритуксимабом. Это может найти применение для лечения различных опухолей. 7 н. и 32 з.п. ф-лы, 52 ил., 7 табл.

ФАРМАЦЕВТИЧЕСКАЯ КОМПОЗИЦИЯ ДЛЯ ЛЕЧЕНИЯ И/ИЛИ ПРОФИЛАКТИКИ РАКА

Изобретение относится к области биохимии, в частности к антителу, которое специфически связывается с белком CAPRIN-1. Также раскрыты моноклональное антитело, которое обладает иммунологической реактивностью по отношению к белку CAPRIN-1, антитела, которые специфически связываются с белком CAPRIN-1, лекарственное средство, содержащее указанные антитела, для лечения или профилактики CAPRIN-1 экспрессирующего рака. Раскрыты способы лечения или профилактики CAPRIN-1 экспрессирующего рака, с применением заявленного антитела и вышеуказанного лекарственного средства. Изобретение обладает способностью специфически связываться с CAPRIN-1, что позволяет эффективно лечить заболевания, ассоциированные с экспрессией белка CAPRIN-1. 10 н. и 6 з.п. ф-лы, 2 ил, 7 пр.

ВАРИАНТЫ ИММУНОГЛОБУЛИНОВ И ИХ ПРИМЕНЕНИЕ

Описаны гуманизированные и химерные антитела к CD20, предназначенные для лечения СD20-позитивных злокачественных заболеваний и аутоиммунных заболеваний. Антитело обладает эффективностью в отношении истощения В-клеток приматов in vivo, содержит в вариабельной области Н-цепи CDR3-последовательность из антитела к человеческому CD20 и практически все остатки консенсусного каркасного участка (FR) человеческой Н-цепи подгруппы III. Антитело по изобретению используют в составе композиции и изделия, обладающих способностью связывать CD20. Антитело также используют в способах для индукции апоптоза, лечения СD20-позитивного рака, аутоиммунного заболевания, ревматоидного артрита. Изобретение включает нуклеиновую кислоту (НК), кодирующую антитело, экспрессионный вектор, содержащий указанную НК, и клетку-хозяин, продуцирующую рекомбинантное антитело, а также способ получения указанного антитела. Антитела по изобретению обладают минимальной антигенностью или не обладают ею вообще, что позволяет использовать ...

СПОСОБЫ РАЗРУШЕНИЯ КЛЕТОК С ИСПОЛЬЗОВАНИЕМ ЭФФЕКТОРНЫХ ФУНКЦИЙ АНТИ-EphA4 АНТИТЕЛ

Настоящее изобретение относится к иммунологии и биотехнологии. Предложен способ лечения или профилактики злокачественной опухоли, клетки которой экспрессируют EphA4. Способ включает введение анти-EphA4 антитела, где антитело имеет IgG1 человека, включает VH и VL области, каждая из которых содержит по три соответствующих CDR. Описана фармацевтическая композиция на основе антитела для применения в указанном способе. Предложенные изобретения могут найти применение в терапии рака поджелудочной железы. 2 н. и 9 з.п. ф-лы, 2 ил., 1 табл.

АНТИТЕЛО ПРОТИВ ГЛИПИКАНА 3

Изобретение относится к иммунологии и биотехнологии. Предложены варианты антител, способных связываться с глипиканом 3 на участке с аминокислотными остатками 1-563. Каждый вариант характеризуется тем, что содержит три CDRs легкой и три CDRs тяжелой цепи. Описаны кодирующий полинуклеотид, а также вектор экспрессии на его основе и клетка-хозяин на основе вектора. Раскрыты способ получения антитела с использованием клетки-хозяина, ингибитор клеточного роста на основе антитела, варианты применения антитела для лечения рака или гепатомы. Описан пептид для продуцирования антитела против глипикана 3, включающий остатки 546-551 глипикана 3. Предложенные новые антитела обладают более высокой цитотоксичностью по сравнению с известными антителами к глипикану 3 и специфичны к определенному участку глипикана 3. Использование изобретения может найти дальнейшее применение в терапии рака. 13 н. и 3 з.п. ф-лы, 20 ил., 2 табл.

САЙТ-СПЕЦИФИЧЕСКАЯ КОНЪЮГАЦИЯ АНТИТЕЛО-ЛЕКАРСТВЕННОЕ СРЕДСТВО ПОСРЕДСТВОМ ГЛИКОИНЖЕНЕРИИ

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая конъюгат антитела или его антигенсвязывающего фрагмента и цитотоксина для доставки цитотоксина субъекту (варианты), композицию для терапевтического применения, содержащую вышеуказанный конъюгат, способ лечения нуждающегося в этом пациента, включающий введение эффективного количества композиции, выделенный полинуклеотид, кодирующий антитело для получения вышеуказанного конъюгата, вектор экспрессии, клетку-хозяина для продуцирования вышеуказанного конъюгата, способ получения конъюгата, конъюгат антитело-лекарственное средство для доставки группы лекарственного средства субъекту. В одном из вариантов реализации конъюгат антитела или его антигенсвязывающего фрагмента и цитотоксина содержит по меньшей мере один гликан, содержащий по меньшей мере одну группу формулы -Gal-Sia-C(H)=N-Q-CON-X. Изобретение расширяет арсенал средств для доставки цитотоксинов субъекту. 13 н. и 29 з.п. ф-лы, 36 ил., 16 табл., 15 пр ...

ОДНОДОМЕННОЕ АНТИТЕЛО И ЕГО ПРОИЗВОДНЫЕ БЕЛКИ К ЛИГАНДУ-1 БЕЛКА ПРОГРАММИРУЕМОЙ СМЕРТИ КЛЕТОК (PDLI)

Изобретение относится к области биотехнологии. Предложена молекула, специфически связывающая лиганд-1 белка программируемой смерти (PDL1) и ее применение, например, в составе фармацевтической композиции для лечения или предупреждения рака. Также изобретение раскрывает молекулу нуклеиновой кислоты, кодирующую указанную PDL1-связывающую молекулу, экспрессирующий вектор и клетку-хозяина, предназначенные для получения PDL1-связывающей молекулы. Изобретение обеспечивает связывание с PDL1 с высокой аффинностью и специфичностью, которое приводит к блокированию связывания PDL1 с PD-1. 8 н. и 12 з.п. ф-лы, 24 ил., 7 табл., 6 пр.

ФАРМАЦЕВТИЧЕСКАЯ КОМПОЗИЦИЯ ДЛЯ ЛЕЧЕНИЯ И/ИЛИ ПРОФИЛАКТИКИ РАКА

Изобретение относится к области биохимии, в частности к лекарственному средству для лечения или профилактики рака, содержащему антитело в качестве активного ингредиента, которое обладает иммунологической реактивностью по отношению к белку CAPRIN-1. Также раскрыты антитело, которое обладает иммунологической реактивностью по отношению к белку CAPRIN-1, фармацевтическое сочетание, содержащее указанное лекарственное средство, для лечения или профилактики рака. Раскрыт способ лечения или профилактики рака с применением заявленного лекарственного средства и фармацевтического сочетания. Изобретение обладает способностью специфически связываться с CAPRIN-1, что позволяет эффективно лечить заболевания, ассоциированные с экспрессией полипептида CAPRIN-1. 5 н. и 3 з.п. ф-лы, 3 ил., 5 пр.

АНТИ-IFNAR1 АНТИТЕЛА С ПОНИЖЕННЫМ СРОДСТВОМ С ЛИГАНДОМ Fc

Предложенное изобретение относится к иммунологии. Предложено моноклональное анти-IFNAR1 антитело с мутациями L234F, L235E и P331S в области Fc человеческого IgG1, обладающее пониженным сродством в отношении Fcgamma RI, Fcgamma RIIIА и c1q рецепторов по сравнению с немодифицированным антителом. Описана выделенная нуклеиновая кислота, обеспечивающая экспрессию указанного антитела, содержащая кодирующую антитело нуклеотидную последовательность, и фармацевтическая композиция на основе указанного антитела. Использование изобретения обеспечивает антитело с пониженным сродством к рецепторам Fcgamma RI, Fcgamma RIIIА и c1q, что обеспечивает снижение нежелательных эффекторных функций при лечении хронического воспаления и аутоиммунных состояний. 3 н. и 6 з.п. ф-лы, 34 ил., 7 табл., 36 пр.

АНТИТЕЛА С РН-ЗАВИСИМЫМ СВЯЗЫВАНИЕМ АНТИГЕНА

Группа изобретений относится к области медицины и фармакологии и касается выделенного антитела, которое специфически связывает человеческий PCSK9, содержащее: гипервариабельный участок вариабельной области тяжелой цепи 1 (VH CDR1) с аминокислотной последовательностью, показанной в SEQ ID NO: 6; VH CDR2 с аминокислотной последовательностью, показанной в SEQ ID NO: 7; VH CDR3 с аминокислотной последовательностью, показанной в SEQ ID NO: 8 или 9, и дополнительно содержащее: CDR1 вариабельной области легкой цепи (VL) с аминокислотной последовательностью, показанной в SEQ ID NO: 10; VL CDR2 с аминокислотной последовательностью, показанной в SEQ ID NO: 11; и VL CDR3 с аминокислотной последовательностью, показанной в SEQ ID NO: 12, а также антитела, кодируемого плазмидами, депонированными в Американской коллекции типовых культур (АТСС) и имеющими номер в АТСС No. РТА-10547 или РТА-10548 и РТА-10549, где указанное антитело специфически связывает человеческий PCSK9, и способа снижения уровня холестерина ...

КОМПОЗИЦИИ, ВКЛЮЧАЮЩИЕ АНТИТЕЛА К CD38 И КАРФИЛЗОМИБ

Изобретение относится к области биохимии, в частности к способу лечения множественной миеломы у субъекта с помощью антитела к CD38. Также раскрыты композиция для лечения множественной миеломы, набор для лечения множественной миеломы у субъекта с помощью антитела к CD38, комбинация для лечения множественной миеломы у субъекта с помощью антитела к CD38. Изобретение обладает способностью эффективно лечить множественную миелому у субъекта с помощью антитела к CD38. 4 н. и 42 з.п. ф-лы, 3 пр., 1 табл., 22 ил.

НЕЙТРАЛИЗУЮЩИЕ АНТИТЕЛА К ВИРУСУ ГРИППА B И ПУТИ ИХ ПРИМЕНЕНИЯ

Изобретение относится к области биотехнологии. Описана группа изобретений, включающая выделенное антитело или его антигенсвязывающий фрагмент, которое способно к связыванию с гемагглютинином (HA) вируса гриппа B и нейтрализации вируса гриппа B в двух филогенетически разных линиях, выделенную нуклеиновую кислоту, кодирующую вышеуказанное антитело или его антигенсвязывающий фрагмент, вектор для получения антитела или его антигенсвязывающего фрагмента, клетку-хозяина, способ получения антитела или его антигенсвязывающего фрагмента, композицию для лечения вируса гриппа В, антитело или его антигенсвязывающий фрагмент для применения в профилактике или лечении инфекции, вызванной вирусом гриппа B, антитело или его антигенсвязывающий фрагмент, для применения в профилактике или лечении инфекции, вызванной вирусом гриппа A и вирусом гриппа B, применение антитела или его антигенсвязывающего фрагмента в получении лекарственного препарата для профилактики или лечения инфекции, вызванной вирусом гриппа ...

ПОЛИПЕПТИДЫ, СОДЕРЖАЩИЕ Fc-УЧАСТОК, КОТОРЫЕ ДЕМОНСТРИРУЮТ ПОВЫШЕННУЮ ЭФФЕКТОРНУЮ ФУНКЦИЮ БЛАГОДАРЯ ИЗМЕНЕНИЯМ СТЕПЕНИ ФУКОЗИЛИРОВАНИЯ, И СПОСОБЫ ИХ ПРИМЕНЕНИЯ

Изобретение относится к области биотехнологии и иммунологии. Описан способ ослабления посттрансляционного фукозилирования молекулы, содержащей модифицированный Fc-участок. Способ предусматривает модификацию Fc-участка, экспрессию молекулы-кандидата, оценку соотношения гликозилирования олигосохаридов с высоким содержанием маннозы к гликозилированию комплексных олигосахаридов и идентификацию молекулы-кондидата как подходящей при соотношении больше чем 0,2. Предложенное изобретение может быть использовано в медицине. 14 з.п.ф-лы, 95 ил., 35 табл., 7 пр.

ГУМАНИЗИРОВАННЫЕ АНТИТЕЛА К СD52

Изобретение относится к области биохимии. Предложено антитело к человеческому СD52. Антитело применяется для лечения или диагностики заболеваний, связанных с клетками СD52+, таких как ХЛЛ и другие лейкозы, аутоиммунные заболевания, отторжение трансплантата органа, реакция «трансплантат-против-хозяина». Изобретение позволяет эффективно связывать CD52. 7 н. и 13 з.п. ф-лы, 14 ил., 2 табл., 11 пр.

МОЛЕКУЛЯРНЫЕ КОНСТРУКЦИИ С НАЦЕЛИВАЮЩИМИ И ЭФФЕКТОРНЫМИ ЭЛЕМЕНТАМИ

Изобретение относится к области биотехнологии, конкретно к линкерному звену, и может быть использовано в качестве сшивающего средства для объединения различных антител или иных биологически активных агентов в конъюгаты и построения молекулярных конструкций с конкретной комбинацией нацеливающих и эффекторных элементов с применением химического синтеза, либо рекомбинантной технологии. 2 з.п. ф-лы, 4 ил., 72 пр.

АНТИТЕЛА К ЛИМФОТОКСИНУ-АЛЬФА

Настоящее изобретение относится к области иммунологии. Предложено антитело к лимфотоксину-альфа (LTα), в том числе его химерные и гуманизированные варианты. Рассмотрены содержащие его композиции, его применение для получения лекарственного средства для лечения аутоиммунных нарушений, способ ингибирования активированной лимфотоксином-альфа клеточной пролиферации ex vivo с помощью антитела по изобретению, а также нуклеиновая кислота, экспрессирующий вектор, клетка-хозяин и основанный на их использовании способ продуцирования антитела. Настоящее изобретение может найти дальнейшее применение в терапии аутоиммунных заболеваний. 9 н. и 42 з.п. ф-лы, 27 ил., 7 табл., 21 пр.

АНТИТЕЛА ПРОТИВ БЕЛКА РЕЦЕПТОРА С-МЕТ

Изобретение относится к биохимии. Описано антитело или его антигенсвязывающий фрагмент, которое специфически связывается с белком c-Met человека. Также описан выделенный полинуклеотид, кодирующий данное антитело, вектор экспрессии, содержащий данный полинуклеотид, клетка-хозяин, содержащая данный вектор. Представлен способ получения рекомбинантного антитела путём культивирования описанной клетки-хозяина. Представлена фармацевтическая композиция для лечения рака и иммуноконъюгат, содержащие описанное антитело. Представлен способ лечения рака, включающий введение описанного антитела. Изобретение расширяет арсенал средств лечения рака. 9 н. и 6 з.п. ф-лы, 25 ил., 16 табл., 26 пр.

МУТАНТЫ АНТИ-CD40 АНТИТЕЛА

Настоящее изобретение относится к иммунологии и биотехнологии. Предложены варианты моноклонального антитела-антагониста к CD40, вариабельные области которых происходят из антитела, полученного из гибридомы 4D11 (FERM ВР-7758). Константные области антител происходят из IgG4 человека и имеют мутации S228P и L235E. Описаны соответствующие кодирующие полинуклеотиды и вектор экспрессии на их основе. Раскрыта клетка-хозяин, содержащая вектор. Описан способ получения моноклонального антитела и его использование в составе фармацевтической композиции. Использование изобретения обеспечивает сниженные активности ADCC и CDC, что может найти применение в терапии аутоиммунных заболеваний и отторжения трансплантанта. 10 н.п. ф-лы, 26 ил., 2 табл.

ТЕРАПИЯ ДЛЯ ЛЕЧЕНИЯ РАКА, ВКЛЮЧАЮЩАЯ АНТИТЕЛА ПРОТИВ КЛАУДИНА 18.2

Группа изобретений относится к медицине и предназначена для лечения рака. Пациенту вводят антитело, обладающее способностью связываться с CLDN18.2, причем антитело вводят таким образом, чтобы обеспечить уровни в сыворотке по меньшей мере 40 мкг/мл. Также описан вариант способа, в котором указанное антитело вводят в дозе по меньшей мере 300 мг/м. Группа изобретений позволяет расширить арсенал терапевтических средств. 2 н. и 25 з.п. ф-лы, 10 ил., 19 табл., 5 пр.

АНТИТЕЛА ЧЕЛОВЕКА К CD20 ЧЕЛОВЕКА И СПОСОБ ИХ ИСПОЛЬЗОВАНИЯ

Предложенное изобретение относится к иммунологии. Предложено антитело человека или антиген-связывающий фрагмент антитела, который специфически связывается с CD20 человека и содержит CDR1-3 легкой и CDR1-3 тяжелой цепи. Описан варианта антитела или антиген-связывающий фрагмент антитела, характеризующийся аминокислотными последовательностями легкой и тяжелой цепи. Предложены: кодирующая молекула нуклеиновой кислоты, экспрессионный вектор на ее основе, а также способ получения антитела или антиген-связывающий фрагмент антитела с использованием вектора. Раскрыта фармацевтическая композиция на основе антитела. Описан способ уменьшения тяжести или подавления заболевания или состояния, обусловленного CD20 и применение антитела или антиген-связывающего фрагмента антитела для получения лекарственного средства для уменьшения тяжести или подавления заболевания или состояния, опосредованного CD20 человека. Изобретение обеспечивает антитела, которые увеличивают время бессимптомного выживания приблизительно ...

АНТИТЕЛО К PD-L1, ЕГО АНТИГЕНСВЯЗЫВАЮЩИЙ ФРАГМЕНТ И ИХ ФАРМАЦЕВТИЧЕСКОЕ ПРИМЕНЕНИЕ

Группа изобретений относится к биотехнологии. Представлены: моноклональное антитело к PD-L1, его антигенсвязывающий фрагмент, способ его получения и его фармацевтическое применение, а также молекула нуклеиновой кислоты, кодирующая моноклональное антитело или его антигенсвязывающий фрагмент, рекомбинантный вектор, клетка-хозяин, фармацевтическая композиция для лечения заболеваний, ассоциированных с PD-L1 человека, способ лечения заболеваний, ассоциированных с PD-L1 человека. Изобретение позволяет получить антитело к PD-L1 и его антигенсвязывающий фрагмент, используемые для эффективного лечения заболеваний или нарушений, ассоциированных с PD-L1. 9 н. и 5 з.п. ф-лы, 5 ил., 16 табл., 10 пр.

ФАРМАЦЕВТИЧЕСКАЯ КОМПОЗИЦИЯ, СОДЕРЖАЩАЯ Fc-ОБЛАСТЬ ИММУНОГЛОБУЛИНА В КАЧЕСТВЕ НОСИТЕЛЯ

Настоящее изобретение относится к области биотехнологии и иммунологии. Описан способ увеличения продолжительности действия физиологически активного полипептида in vivo. Способ основан на том, что физиологически активный полипептид конъюгируют с Fc-фрагментом иммуноглобулина посредством полиэтиленгликоля. Использование изобретения, по сравнению с нативным физиологически активным полипептидом, обеспечивает повышенную физиологическую активность in vivo конструкции и/или увеличение времени полужизни в сыворотке физиологически активного полипептида с минимальным риском индуцирования нежелательных иммунных ответов. Это может найти применение при изготовлении различных полипептидных лекарственных препаратов пролонгированного действия. 10 з.п. ф-лы, 10 табл., 18 ил.

КОМБИНИРОВАННАЯ ТЕРАПИЯ С ИСПОЛЬЗОВАНИЕМ АНТИТЕЛ К КЛАУДИНУ 18.2 ДЛЯ ЛЕЧЕНИЯ РАКА

Группа изобретений относится к медицине и касается способа лечения или предотвращения ракового заболевания, где раковые клетки экспрессируют CLDN18.2, включающего введение пациенту антитела, обладающего способностью связываться с CLDN18.2, в комбинации со средством, стимулирующим γδ Т-клетки и интерлейкин-2, где средство, стимулирующее γδ Т-клетки, представляет собой бисфосфонат. Группа изобретений также касается медицинского препарата для лечения или предотвращения ракового заболевания, содержащего указанные вещества; набора для лечения или предотвращения ракового заболевания. Группа изобретений обеспечивает значительное увеличение общей ADCC-активности. 3 н. и 32 з.п. ф-лы, 26 ил., 1 табл., 17 пр.

ФАРМАЦЕВТИЧЕСКАЯ КОМПОЗИЦИЯ ДЛЯ ЛЕЧЕНИЯ И/ИЛИ ПРОФИЛАКТИКИ РАКА

Изобретение относится к области биохимии, в частности к антителу, которое специфично связывается с неполным полипептидом CAPRIN-1, а также фармацевтической композиции, конъюгату и комбинированному лекарственному средству, его содержащим. Изобретение также относится к способу лечения или профилактики CAPRIN-1 экспрессирующего рака с использованием вышеуказанного антитела, композиции или комбинированного лекарственного средства. Изобретение позволяет эффективно осуществлять лечение или профилактику CAPRIN-1 экспрессирующего рака. 5 н. и 5 з.п. ф-лы, 8 пр.

АНТИТЕЛА ДЛЯ ЛЕЧЕНИЯ РАКОВЫХ ЗАБОЛЕВАНИЙ, ПРИ КОТОРЫХ ЭКСПРЕССИРУЕТСЯ КЛАУДИН 6

Изобретение относится к области биохимии, в частности к антителу, связывающемуся с CLDN6. Также раскрыты: способ ингибирования роста клеток, способ уничтожения клетки, способ лечения или предотвращения заболевания или расстройства, способ ингибирования метастатического распространения клеток – с помощью указанного антитела. Раскрыты конъюгат, включающий указанное антитело, фармацевтическая композиция, содержащая указанное антитело. Изобретение позволяет эффективно лечить заболевания, ассоциированные с CLDN6. 9 н. и 21 з.п. ф-лы, 43 ил., 1 табл., 10 пр.

АНТИТЕЛО ПРОТИВ РЕЦЕПТОРА ЭПИДЕРМАЛЬНОГО ФАКТОРА РОСТА

Настоящее изобретение относится к иммунологии. Предложено антитело и его фрагмент, способные связываться с рецептором эпидермального фактора роста (EGFR) и содержащие гипервариабельные участки из антитела панитумумаб и константную область IgG1 человека. Также представлены: молекула нуклеиновой кислоты и комбинация молекул нуклеиновых кислот, кодирующие антитело или его фрагмент; иммуноконъюгат и фармацевтическая композиция для лечения или профилактики заболеваний или нарушений, связанных с аномальной экспрессией EGFR. Кроме того, рассмотрено применение антитела, его фрагмента, молекулы нуклеиновой кислоты, комбинации таких молекул, иммуноконъюгата и фармацевтической композиции при производстве лекарственных средств. Антитело по настоящему изобретению обладает оптимальной аффинностью в отношении EGFR, улучшенной биологической и противоопухолевой активностью, в связи с чем может найти применение в терапии рака. 6 н. и 8 з.п. ф-лы, 5 ил., 4 пр.

АНТИТЕЛА ПРОТИВ АЛЬФА5-БЕТА 1 И ИХ ПРИМЕНЕНИЕ

Настоящее изобретение относится к области иммунологии. Предложено выделенное моноклональное антитело к интегрину α5β1 человека. Антитело характеризуется тем, что содержит 6 CDR, 3 CDR из легкой цепи и 3 CDR из тяжелой цепи. Описана нуклеиновая кислота (НК), кодирующая антитело по изобретению, экспрессирующий вектор, содержащий молекулу НК; клетка-хозяин, содержащая вектор; и способ получения антитела на основе клетки. Раскрыты: композиция и способ для ингибирования роста опухолевых клеток, экспрессирующих интегрин α5β1 человека, на основе антитела. Описан вариант способа ингибирования роста опухолевых клеток, экспрессирующих интегрин α5β1 человека, использующий композицию. Изобретение обеспечивает новые антитела с высоким (порядка нм, как измерено FACS) сродством связывания с интегрином α5β1 человека, что может найти применение в медицине в терапии опухолей, опосредованных экспрессией интегрина α5β1. 7 н. и 6 з.п. ф-лы, 36 ил., 3 табл., 11 пр.

НЕЙТРАЛИЗУЮЩИЕ АНТИТЕЛА К ВИРУСУ ГРИППА А И ПУТИ ИХ ПРИМЕНЕНИЯ

Изобретение относится к биохимии. Описано выделенное антитело или его связывающий фрагмент, способные связываться с гемагглютинином вируса гриппа А и нейтрализовать по меньшей мере один подтип группы 1 и по меньшей мере 1 подтип группы 2 вируса гриппа A, которые содержат HCDR1 с последовательностью SEQ ID NO:113, HCDR2 с последовательностью SEQ ID NO:114, HCDR3 с последовательностью SEQ ID NO:115, LCDR1 с последовательностью SEQ ID NO:118, LCDR2 с последовательностью SEQ ID NO:119 и LCDR3 с последовательностью SEQ ID NO:120. Представлены применения данного антитела. Изобретение расширяет арсенал средств, нейтрализующих вирус гриппа А. 12 н. и 12 з.п. ф-лы, 15 ил., 13 табл., 11 пр.

АНТИТЕЛА ЧЕЛОВЕКА К ДЕЛЬТА-ПОДОБНОМУ ЛИГАНДУ-4 ЧЕЛОВЕКА

Изобретение относится к биохимии. Описано выделенное антитело человека или фрагмент антитела, которые специфическим образом связывают дельта-подобный лиганд-4 человека (hDII4), указанное антитело человека или фрагмент антитела содержит вариабельную область тяжелой цепи (HCVR), содержащую три определяющие комплементарность области (CDR) тяжелой цепи, и вариабельную область легкой цепи (LCVR), содержащую три CDR легкой цепи, где указанные три CDR тяжелой цепи содержат CDR1, CDR2 и CDR3 последовательности SEQ ID NO:429 или SEQ ID NO:901, а указанные три CDR легкой цепи содержат CDR1, CDR2 и CDR3 последовательности SEQ ID NO:437 или SEQ ID NO:903, и где указанное антитело или его фрагмент связывается с эпитопом в пределах N-концевого-DSL домена hDII4. Описана выделенная молекула нуклеиновой кислоты, кодирующая описанное антитело или его антигенсвязывающий фрагмент. Представлены вектор экспрессии, содержащий описанную молекулу нуклеиновой кислоты, и система «хозяин-вектор» для получения описанного ...

ФАРМАЦЕВТИЧЕСКАЯ КОМПОЗИЦИЯ ДЛЯ ЛЕЧЕНИЯ И ПРОФИЛАКТИКИ ЗЛОКАЧЕСТВЕННОЙ ОПУХОЛИ

Изобретение относится к области биохимии, в частности к антителу или его связывающему фрагменту, которые специфически связываются с белком CAPRIN-1 и обладают иммунологической реактивностью в отношении частичного полипептида CAPRIN-1. Также раскрыты конъюгат, а также фармацевтическая композиция и фармацевтическая комбинация для лечения или профилактики злокачественной опухоли, экспрессирующей CAPRIN-1. Изобретение также относится к способу лечения или профилактики злокачественной опухоли, экспрессирующей CAPRIN-1 с использованием вышеуказанного антитела или его фрагмента, конъюгата, композиции или комбинации. Изобретение позволяет эффективно осуществлять лечение или профилактику злокачественной опухоли, экспрессирующей CAPRIN-1. 14 н. и 5 з.п. ф-лы, 12 пр.

МОНОКЛОНАЛЬНОЕ АНТИТЕЛО К IL-5Rα

Изобретение относится к области биотехнологии и представляет собой антитела, которые специфично связываются с IL-5Rα. Изобретение также относится к ДНК, кодирующей указанные антитела, соответствующим экспрессионным векторам и способам продукции, а также к способам лечения с использованием указанных антител. 11 н. и 26 з.п. ф-лы, 12 ил., 5 табл., 20 пр.

ВЫДЕЛЕННОЕ АНТИ-CD30 АНТИТЕЛО (ВАРИАНТЫ), ХОЗЯЙСКАЯ КЛЕТКА, СПОСОБ ПОЛУЧЕНИЯ ХИМЕРНОГО ИЛИ ГУМАНИЗИРОВАННОГО ВАРИАНТА АНТИ-CD30 АНТИТЕЛ (ВАРИАНТЫ), СПОСОБ ИНГИБИРОВАНИЯ РОСТА КЛЕТОК CD30+ И СПОСОБ ИНГИБИРОВАНИЯ РОСТА ОПУХОЛЕВЫХ КЛЕТОК, ЭКСПРЕССИРУЮЩИХ CD30

Настоящее изобретение относится к области иммунологии. Предложены варианты выделенного анти-CD30 антитела, по существу свободного от фукозильных остатков. Указанное антитело характеризуется тем, что содержит в одном варианте 3 CDR из тяжелой цепи и три CDR из легкой цепи, а в другом варианте характеризуется наличием вариабельной области тяжелой цепи и вариабельной области легкой цепи. Раскрыта хозяйская клетка, продуцирующая указанное антитело, по существу свободная от фукозилтрансферазы, описан способ ингибирования роста клеток CD30+ и способ ингибирования роста опухолевых клеток, экспрессирующих CD30, использующий антитело. Описаны варианты применения антител для получения химерного или гуманизированного варианта антитела. Антитела настоящего изобретения демонстрируют повышенную ADCC клеточную цитотоксичность, в отношении линий клеток ходжкинской лимформы человека: L428, L540, L1236 и линии T-клеточной лимформы человека: KARPAS, экспрессирующих CD30, которые не лизируются фукозилированной ...

АКТИВИРУЮЩИЙ NK-КЛЕТКИ СЛИТЫЙ БЕЛОК, NK-КЛЕТКИ И ФАРМАЦЕВТИЧЕСКАЯ КОМПОЗИЦИЯ, ВКЛЮЧАЮЩАЯ ИХ

Изобретение относится к области биотехнологии, конкретно к слитым белкам с противоопухолевой активностью, и может быть использовано в медицине для противораковой терапии. Слитый полипептид содержит антитело или его фрагмент, связывающиеся с опухолеспецифическим антигеном, выбранным из мезотелина, PD–L1 (лиганда программируемой гибели 1), Her2 (EGFR–родственного белка человека 2), CD19, MUC1, EGFR и VEGFR; линкер и белок, индуцирующий естественные киллеры (NK), из CXCL16. Слитый пептид может быть получен рекомбинантным путем. Предложены также фармацевтические композиции, содержащие указанный слитый пептид, и способ терапии рака. Изобретение обеспечивает противораковый эффект за счет индукции миграции NK-клеток. 7 н. и 5 з.п. ф-лы, 32 ил., 4 табл., 10 пр.

АНТИТЕЛО ПРОТИВ ОПУХОЛЕСПЕЦИФИЧНЫХ АНТИГЕНОВ В КАЧЕСТВЕ МИШЕНИ

... 1. Антитело, которое специфически связывается с человеческим белком окулоспанина и обладает цитотоксической активностью в отношении клетки, экспрессирующей указанный белок. 2. Антитело, которое специфически связывается с белком, имеющим аминокислотную последовательность, представленную SEQ ID NO:2 из списка последовательностей, и/или аминокислотную последовательность, представленную SEQ ID NO:4 из списка последовательностей, и которое обладает цитотоксической активностью в отношении клетки, экспрессирующей указанный белок/белки. 3. Антитело по п.1 или 2, отличающееся тем, что цитотоксическая активность является антитело-зависимой клеточно-опосредованной цитотоксичностью. 4. Антитело по п.1 или 2, отличающееся тем, что цитотоксическая активность является комплемент-зависимой цитотоксичностью. 5. Антитело по п.1 или 2, отличающееся тем, что цитотоксическая активность является комплемент-зависимой клеточно-опосредованной цитотоксичностью. 6. Антитело по п.1 или 2, отличающееся тем, что цитотоксичность ...

ФАРМАЦЕВТИЧЕСКАЯ КОМПОЗИЦИЯ ДЛЯ ЛЕЧЕНИЯ ПРОФИЛАКТИКИ РАКА

... 1. Антитело или его фрагмент, который обладает иммунологической реактивностью по отношению к неполному полипептиду CAPRIN-1, состоящему из аминокислотной последовательности, указанной в SEQ ID NO: 5, или аминокислотной последовательности, имеющей 80% или более высокую идентичность последовательности с данной аминокислотной последовательностью.2. Антитело или его фрагмент по п. 1, в котором антитело или его фрагмент обладает цитотоксической активностью, направленной против раковой клетки, экспрессирующей белок CAPRIN-1.3. Антитело или его фрагмент по п. 1 или 2, в котором антитело представляет собой моноклональное антитело или поликлональное антитело.4. Антитело или его фрагмент по п. 1, в котором антитело представляет собой человеческое антитело, гуманизированное антитело, химерное антитело, одноцепочечное антитело или полиспецифичное антитело.5. Антитело или его фрагмент по п. 1, в котором антитело или его фрагмент содержит вариабельную область тяжелой цепи, содержащую определяющие комплементарность ...

СПОСОБЫ И КОМПОЗИЦИИ ДЛЯ ПОВЫШЕНИЯ ЭФФЕКТИВНОСТИ АНТИТЕЛ ДЛЯ ЛЕЧЕБНЫХ ЦЕЛЕЙ С ИСПОЛЬЗОВАНИЕМ СОЕДИНЕНИЙ, ПОТЕНЦИИРУЮЩИХ NK-КЛЕТКИ

... 1. Способ лечения заболевания у субъекта-человека, нуждающегося в этом, включающий a) введение указанному субъекту соединения, блокирующего ингибирующий рецептор или стимулирующего активирующий рецептор N-клетки, и b) введение указанному субъекту антител для лечебных целей, которые могут связываться CD16. 2. Способ по п.1, где указанные антитела для лечебных целей содержат Fc-участок человеческого IgGI или IgG3. 3. Способ по п.1 или 2, где указанное соединение представляет собой антитело или содержит его антигенсвязывающий фрагмент, 4. Способ по п.1, где указанные антитела для лечебных целей являются моноклональными антителами или содержат их антигенсвязывающие фрагменты. 5. Способ по п.1, где указанные антитела для лечебных целей не конъюгированы с радиоактивной или токсичной группой. 6. Способ по п.1, где указанное соединение ингибирует ингибирующий рецептор N-клетки. 7. Способ по п.1, где указанное соединение стимулирует активирующий рецептор N-клетки. 8. Способ по п.1, где указанное ...

АНТИТЕЛА ПРОТИВ ИНТЕРЛЕЙКИНА-13 ЧЕЛОВЕКА И ИХ ПРИМЕНЕНИЕ

... 1. Антитело или его антигенсвязывающий фрагмент, которое связывается с IL-13 с Кменее чем 10М, и имеет одно или более из следующих свойств:(a) вариабельная область тяжелой цепи иммуноглобулина содержит последовательность CDR3 тяжелой цепи моноклонального антитела mAb 13.2 (SEQ ID NO:24) или последовательность CDR3 тяжелой цепи, которая отличается менее чем на три аминокислотных замены от соответствующей последовательности CDR3 тяжелой цепи моноклонального антитела mAb 13.2;(b) вариабельная область легкой цепи иммуноглобулина содержит последовательность CDR1 легкой цепи моноклонального антитела mAb 13.2 (SEQ ID NO:19) или последовательность CDR1 легкой цепи, которая отличается менее чем на 3 аминокислотные замены от соответствующей последовательности CDR1 легкой цепи моноклонального антитела mAb 13.2;(c) вариабельная область тяжелой цепи иммуноглобулина содержит последовательность, кодируемую нуклеиновой кислотой, которая гибридизуется в условиях высокой жесткости с последовательностью, ...

КОМБИНИРОВАННАЯ ТЕРАПИЯ С ИСПОЛЬЗОВАНИЕМ АНТИТЕЛ К КЛАУДИНУ 18.2 ДЛЯ ЛЕЧЕНИЯ РАКА

... 1. Способ лечения или предотвращения ракового заболевания, включающий введение пациенту антитела, обладающего способностью связываться с CLDN18.2, в комбинации со средством, стимулирующим γδ Т-клетки.2. Способ по п. 1, согласно которому γδ Т-клетки являются Vγ9Vδ2 Т-клетками.3. Способ по п. 1 или 2, согласно которому средство, стимулирующее γδ Т-клетки, является бисфосфонатом.4. Способ по п. 1 или 2, согласно которому средство, стимулирующее γδ Т-клетки, является азотсодержащим бисфосфонатом (аминобисфосфонатом).5. Способ по п. 1 или 2, согласно которому средство, стимулирующее γδ Т-клетки, выбирают из группы, состоящей из золедроновой кислоты, клодроновой кислоты, ибандроновой кислоты, памидроновой кислоты, ризедроновой кислоты, минодроновой кислоты, олпадроновой кислоты, алендроновой кислоты, инкадроновой кислоты и их солей.6. Способ по п. 1 или 2, согласно которому средство, стимулирующее γδ Т-клетки, вводится в комбинации с интерлейкином-2.7. Способ по п. 1 или 2, согласно которому ...

ШАТТЛ ДЛЯ ГЕМАТОЭНЦЕФАЛИЧЕСКОГО БАРЬЕРА

... 1. Шаттл для гематоэнцефалического барьера, содержащий эффекторный элемент для головного мозга, линкер и одновалентный связывающий элемент, который связывается с рецептором гематоэнцефалического барьера, в котором линкер соединяет эффекторный элемент с одновалентным связывающим элементом, который связывается с рецептором гематоэнцефалического барьера.2. Шаттл для гематоэнцефалического барьера по п. 1, в котором одновалентный связывающий элемент, который связывается с рецептором гематоэнцефалического барьера, выбирается из группы, состоящей из белков, полипептидов и пептидов.3. Шаттл для гематоэнцефалического барьера по п. 1 или 2, в котором одновалентный связывающий элемент, который связывается с рецептором гематоэнцефалического барьера, содержит молекулу, выбранную из группы, которая состоит из лиганда рецептора гематоэнцефалического барьера, scFv, Fv, sFab, VHH, предпочтительно sFab.4. Шаттл для гематоэнцефалического барьера по п. 1 или 2, в котором рецептор гематоэнцефалического барьера ...

АНТИТЕЛА ПРОТИВ РЕЦЕПТОРА ФОЛИЕВОЙ КИСЛОТЫ 1, ИХ ИММУНОКОНЪЮГАТЫ И ИСПОЛЬЗОВАНИЕ

... 1. Гуманизированное антитело или его антиген-связывающий фрагмент, специфически связывающиеся с человеческим рецептором фолиевой кислоты 1, содержащее:(а) CDR1 тяжелой цепи, содержащую GYFMN (SEQ ID NO:1); CDR2 тяжелой цепи, содержащую RIHPYDGDTFYNQXaaFXaaXaa(SEQ ID NO:56); и CDR3 тяжелой цепи, содержащую YDGSRAMDY (SEQ ID NO:3); и(б) CDR1 легкой цепи, содержащую KASQSVSFAGTSLMH (SEQ ID NO:7); CDR2 легкой цепи, содержащую RASNLEA (SEQ ID NO:8); и CDR3 легкой цепи, содержащую QQSREYPYT (SEQ ID NO:9);где Xaaвыбран из K, Q, Н и R; Хаавыбран из Q, И, N и R; и Хаавыбран из G, Е, T, S, A и V.2. Гуманизированное антитело или его антиген-связывающий фрагмент по п.1, отличающиеся тем, что последовательность CDR2 тяжелой цепи содержит RIHPYDGDTFYNQKFQG (SEQ ID NO:2).3. Гуманизированное антитело или его антиген-связывающий фрагмент по п.1 содержащие вариабельный домен тяжелой цепи, по меньшей мере приблизительно на 90%, приблизительно на 95%, приблизительно на 99%, приблизительно на 100% идентичный ...

АНТИТЕЛО ПРОТИВ РЕЦЕПТОРА ЭПИДЕРМАЛЬНОГО ФАКТОРА РОСТА

Слитый белок человеческого фактора свертывания IХ (FIX), способ его получения и применения

Изобретение относится к области биотехнологии, конкретно к получению слитого белка гипергликозилированного рекомбинантного человеческого фактора свертывания IX (FIX), и может быть использовано в медицине в терапии геморрагической болезни. Слитый белок состоит из последовательно от N-конца к С-концу, человеческого фактора коагуляции IX, гибкого пептидного линкера, по меньшей мере одного жесткого фрагмента, содержащего карбоксильный концевой пептид бета-субъединицы человеческого хорионического гонадотропина и Fc-сегмента иммуноглобулина. Изобретение позволяет получить слитый FIX, обладающий высокой биологической активностью, увеличенным периодом полувыведения in vivo и уменьшенной иммуногенностью. 7 н. и 9 з.п. ф-лы, 2 табл., 7 пр., 3 ил.

ПОСЛЕДОВАТЕЛЬНОСТИ ВАРИАБЕЛЬНЫХ ОБЛАСТЕЙ МОНОКЛОНАЛЬНЫХ АНТИТЕЛ ПРОТИВ IL-31 И СПОСОБЫ ИСПОЛЬЗОВАНИЯ

... 1. Моноклональное антитело или фрагмент антитела, которые конкурируют за специфическое связывание с полипептидом, включающим аминокислотную последовательность SEQ ID NO: 2, где моноклональное антитело включает вариабельную область легкой цепи и вариабельную область тяжелой цепи, выбранные из группы, состоящей из ! a) вариабельной области легкой цепи, включающей аминокислотную последовательность SEQ ID NO: 8, и вариабельной области тяжелой цепи, включающей аминокислотную последовательность SEQ ID NO: 9; ! b) вариабельной области легкой цепи, включающей аминокислотную последовательность SEQ ID NO: 10, и вариабельной области тяжелой цепи, включающей аминокислотную последовательность SEQ ID NO: 11; ! c) вариабельной области легкой цепи, включающей аминокислотную последовательность SEQ ID NO: 12, и вариабельной области тяжелой цепи, включающей аминокислотную последовательность SEQ ID NO: 13; ! d) вариабельной области легкой цепи, включающей аминокислотную последовательность SEQ ID NO: 14, и ...

ОДНОЦЕПОЧЕЧНЫЕ МУЛЬТИВАЛЕНТНЫЕ СВЯЗЫВАЮЩИЕ БЕЛКИ С ЭФФЕКТОРНОЙ ФУНКЦИЕЙ

... 1. Одноцепочечный мультиспецифический связывающий белок с эффекторной функцией, содержащий от аминоконца к карбоксиконцу: ! a. первый связывающий домен, содержащий вариабельные области из иммуноглобулина или иммуноглобулинподобной молекулы; ! b. первый линкерный пептид; ! c. константную субобласть иммуноглобулина, обеспечивающую эффекторную функцию; ! d. второй линкерный пептид и ! e. второй связывающий домен, содержащий вариабельные области из иммуноглобулина или иммуноглобулинподобной молекулы; ! где первый и второй связывающие домены узнают разные молекулярные мишени и имеют аффинность связывания, составляющую по меньшей мере 10-6 M. ! 2. Белок по п.1, в котором первый связывающий домен и второй связывающий домен специфически связывают разные молекулярные мишени, локализованные на одной и той же клетке. !3. Белок по п.1, в котором первый связывающий домен и второй связывающий домен специфически связывают разные молекулярные мишени, локализованные на физически различных клетках. ! 4.

ПРИМЕНЕНИЕ АНТИ-CD40-АНТИТЕЛ

... 1. Способ лечения человека, страдающего воспалительным заболеванием или аутоиммунным заболеванием, ассоциированным с CD40-экспрессирующими клетками, где указанный пациент является гетерозиготным или гомозиготным по FcγRIIIa-158F (генотип V/F или F/F) и где указанный способ включает в себя введение пациенту терапевтически или профилактически эффективного количества анти-CD40-антитела. ! 2. Способ по п.1, где указанное воспалительное заболевание или аутоиммунное заболевание выбрано из группы, состоящей из системной красной волчанки (СКВ), дискоидной волчанки, волчаночного нефрита, саркоидоза, воспалительного артрита, включая ювенильный артрит, ревматоидный артрит, псориатический артрит, синдром Рейтера, анкилозирующий спондилит и подагрический артрит; отторжения трансплантата органов или тканей, сверхострого, острого или хронического отторжения трансплантата и/или реакции “трансплантат против хозяина”, рассеянного склероза, гипер-IgЕ-синдрома, нодозного полиартериита, первичного билиарного ...

МОНОКЛОНАЛЬНЫЕ АНТИТЕЛА К КЛАУДИНУ-18 ДЛЯ ЛЕЧЕНИЯ РАКА

... 1. Антитело, обладающее способностью к связыванию с CLD18 и опосредующее лизис клеток, экспрессирующих CLD18. ! 2. Антитело по п.1, которое связывается с CLD18A1 и CLD18A2. ! 3. Антитело по п.1, которое связывается с CLD18A2, но не с CLD18A1. ! 4. Антитело по п.1, где указанный лизис клеток индуцируют с помощью связывания указанного антитела с CLD18, экспрессируемым указанными клетками. ! 5. Антитело по п.1, где указанный лизис клеток индуцируют с помощью связывания указанного антитела с CLD18A2, экспрессируемым указанными клетками. ! 6. Антитело по п.1, где указанный лизис клеток не индуцируется с помощью связывания указанного антитела с CLD18A1, экспрессируемым указанными клетками. ! 7. Антитело по любому из пп.1-6, где указанные клетки, экспрессирующие CLD18, являются раковыми клетками. ! 8. Антитело по п.7, где раковые клетки выбирают из группы, состоящей из онкогенных клеток рака желудка, пищевода, поджелудочной железы и легких. ! 9. Антитело по любому из пп.1-6, которое опосредует ...

Анти-PD-L1 и IL-2 цитокины

СВЯЗЫВАЮЩИЕ МОЛЕКУЛЫ, СОЕДИНЯЮЩИЕ PD-L1 и LAG-3

МНОГОКЛОНАЛЬНЫЕ АНТИТЕЛА ЧЕЛОВЕКА К БЕЛКУ ПРОГРАММИРУЕМОЙ СМЕРТИ 1 (PD) И СПОСОБЫ ЛЕЧЕНИЯ РАКА С ИСПОЛЬЗОВАНИЕМ АНТИ-PD-1-АНТИТЕЛ САМОСТОЯТЕЛЬНО ИЛИ В КОМБИНАЦИИ С ДРУГИМИ ИММУНОТЕРАПЕВТИЧЕСКИМИ СРЕДСТВАМИ

... 1. Способ ингибирования роста опухолевых клеток у индивида, включающий: ! (a) введение моноклонального антитела против PD-1 индивидууму, и ! (b) введение моноклонального антитела против CTLA-4 индивидууму. ! 2. Способ по п.1, где опухолевыми клетками являются клетки злокачественной опухоли, выбранной из группы состоящей из меланомы, рака почки, рака предстательной железы, рака молочной железы, рака толстой кишки и рака легкого. ! 3. Способ по п.1, где опухолевыми клетки являются клетки злокачественной опухоли, выбранной из группы, состоящей из рака костей, рака поджелудочной железы, рака кожи, рака головы и шеи, кожной или внутриглазной злокачественной меланомы, рака матки, рака яичника, рака прямой кишки, рака анальной области, рака желудка, рака яичек, рака матки, рака фаллопиевых труб, рака эндометрия, рака шейки матки, рака влагалища, рак вульвы, болезни Ходжкина, не-Ходжкинской лимфомы, рака пищевода, рака тонкой кишки, рака эндокринной системы, рака щитовидной железы, рака паращитовидной ...

АНТИТЕЛА ПРОТИВ CD70

... 1. Связывающееся с CD70 человека антитело или его антигенсвязывающий фрагмент, включающее(ий) по крайней мере один вариабельный домен тяжелой цепи (VH) и по крайней мере один вариабельный домен легкой цепи (VL), причем указанные VH- и VL-домены, при исследовании в виде Fab-фрагмента, демонстрируют скорость диссоциации (k, измеряемую с использованием Biacore) от CD70 человека, составляющую менее 7×10сек.2. Антитело или антигенсвязывающий фрагмент по п.1, в котором указанные VH- и VL-домены, при исследовании в виде Fab-фрагмента, демонстрируют скорость диссоциации от CD70 человека, составляющую 5×10секили менее, и предпочтительно находящуюся в диапазоне от 0,4×10секдо 4,8×10сек.3. Антитело или антигенсвязывающий фрагмент по п.2, которое представляет собой антитело, включающее две Fab-области, причем каждая из Fab-областей связывается с CD70 человека и демонстрирует скорость диссоциации от CD70 человека, находящуюся в диапазоне от 0,4×10секдо 4,8×10сек, при исследовании в виде Fab-фрагмента ...

СПЕЦИФИЧЕСКИЕ АНТИТЕЛА К PD-L1 И СПОСОБЫ ИХ ПРИМЕНЕНИЯ

ПРИМЕНЕНИЕ АНТИТЕЛА К CD20 ТИПА II, ОБЛАДАЮЩЕГО ПОВЫШЕННОЙ АНТИТЕЛО-ОБУСЛОВЛЕННОЙ КЛЕТОЧНОЗАВИСИМОЙ ЦИТОТОКСИЧНОСТЬЮ (ADCC), В СОЧЕТАНИИ С ЦИКЛОФОСФАМИДОМ, ВИНКРИСТИНОМ И ДОКСОРУБИЦИНОМ ДЛЯ ЛЕЧЕНИЯ НЕ-ХОДЖКИНСКИХ ЛИМФОМ

... 1. Применение антитела к CD20 типа II, обладающего повышенной антитело-обусловленной клеточнозависимой цитотоксичностью (ADCC), для приготовления лекарственного средства, предназначенного для лечения рака, при котором происходит экспрессия CD20, в сочетании с одним или несколькими химиотерапевтическими средствами, выбранными из группы, включающей циклофосфамид, винкристин и доксорубицин. ! 2. Применение антитела к CD20 типа II, обладающего повышенной антитело-обусловленной клеточнозависимой цитотоксичностью (ADCC), для приготовления лекарственного средства, предназначенного для лечения пациента, страдающего раком, при котором происходит экспрессия CD20, в сочетании с одним или несколькими химиотерапевтическими средствами, выбранными из группы, включающей циклофосфамид, винкристин и доксорубицин. ! 3. Применение по одному из п.1 или 2, отличающееся тем, что лечение с использованием антитела к CD20 типа II осуществляют в сочетании с циклофосфамидом и винкристином. ! 4. Применение по одному ...

МОНОКЛОНАЛЬНЫЕ АНТИТЕЛА ЧЕЛОВЕКА К БЕЛКУ ПРОГРАММИРУЕМОЙ СМЕРТИ 1 (PD-1) И СПОСОБЫ ЛЕЧЕНИЯ РАКА С ИСПОЛЬЗОВАНИЕМ АНТИ-PD-1-АНТИТЕЛ САМОСТОЯТЕЛЬНО ИЛИ В КОМБИНАЦИИ С ДРУГИМИ ИММУНОТЕРАПЕВТИЧЕСКИМИ СРЕДСТВАМИ

АНТИГЕНСВЯЗЫВАЮЩИЕ БЕЛКИ

... 1. Антигенсвязывающий белок, содержащийа) две модифицированные тяжелые цепи антитела, которое специфически связывается с антигеном, где VH каждой тяжелой цепи заменен на VL указанного антитела, причем указанные модифицированные тяжелые цепи связаны друг с другом через свои СН3-домены Fc-части;б) две модифицированные тяжелые цепи указанного антитела, где СН1 каждой тяжелой цепи заменен на CL указанного антитела, причем указанные модифицированные тяжелые цепи связаны друг с другом через свои СН3-домены Fc-части;и где VL-домены тяжелых цепей а) связаны с VH-доменами тяжелых цепей б), и СН1-домены тяжелых цепей а) связаны с CL-доменами тяжелых цепей б).2. Антигенсвязывающий белок по п.1, который характеризуется тем, чтоСН3-домены Fc-части модифицированных тяжелых цепей а) и СН3-домены Fc-части модифицированных тяжелых цепей б) имеют один и тот же изотип.3. Антигенсвязывающий белок по п.2, который характеризуется тем, чтоСН2- и СН3-домены Fc-части модифицированных тяжелых цепей а) и СН2- и СН3 ...

ФАРМАЦЕВТИЧЕСКАЯ КОМПОЗИЦИЯ ДЛЯ ЛЕЧЕНИЯ И/ИЛИ ПРЕДОТВРАЩЕНИЯ ЗЛОКАЧЕСТВЕННЫХ ОПУХОЛЕЙ

СВЯЗЫВАЮЩИЕСЯ С CD38 И PD-L1 МОЛЕКУЛЫ

ДИАГНОСТИКА И ЛЕЧЕНИЕ РАКА, СВЯЗАННОГО С РАКОВЫМИ СТВОЛОВЫМИ КЛЕТКАМИ

Нейтрализующие антитела к вирусу гриппа B и пути их применения

БИСПЕЦИФИЧЕСКИЕ CD3 и CD19 АНТИГЕНСВЯЗЫВАЮЩИЕ КОНСТРУКЦИИ

АНТИТЕЛО ПРОТИВ ПРОТЕИНТИРОЗИНФОСФАТАЗЫ σ РЕЦЕПТОРНОГО ТИПА ЧЕЛОВЕКА

КОМБИНИРОВАННАЯ ТЕРАПИЯ, ВКЛЮЧАЮЩАЯ ПРИМЕНЕНИЕ АГОНИСТОВ, СВЯЗЫВАЮЩИХСЯ С ОХ40, И ИНГИБИТОРОВ TIGIT

МУТАНТНЫЕ ВАРИАНТЫ Fc IgG1, ЛИШЕННЫЕ ЭФФЕКТОРНЫХ ФУНКЦИЙ

АНТИТЕЛА ПРОТИВ ЧЕЛОВЕЧЕСКОГО HER3, ИМЕЮЩИЕ НИЗКОЕ СОДЕРЖАНИЕ ФУКОЗЫ, И ОБЛАСТИ ИХ ПРИМЕНЕНИЯ

КОМБИНИРОВАННАЯ ТЕРАПИЯ С ИСПОЛЬЗОВАНИЕМ АНТИТЕЛ К КЛАУДИНУ 18.2 ДЛЯ ЛЕЧЕНИЯ РАКА

МОНОКЛОНАЛЬНОЕ АНТИТЕЛО ПРОТИВ CXCR5

КОМБИНИРОВАННАЯ ТЕРАПИЯ ПРИ В-КЛЕТОЧНЫХ ЛИМФОМАХ

... 1. Способ лечения В-клеточной лимфомы, включающий введение пациенту, нуждающемуся в этом, комбинированной терапии, включающей антитело к CD19 и антитело к CD20, где указанная комбинированная терапия обеспечивает противоопухолевую активность более продолжительное время, чем либо указанное антитело к CD19, либо указанное антитело к CD20, введенные по отдельности в сопоставимом режиме дозирования.2. Способ лечения В-клеточной лимфомы, включающий введение пациенту, нуждающемуся в этом, комбинированной терапии, включающей антитело к CD19 и антитело к CD20, где доза указанной комбинированной терапии обладает более сильной противоопухолевой активностью, чем доза указанного антитела к CD19, которая по меньшей мере в два раза больше дозы комбинированной терапии.3. Способ по п.1 или 2, где указанную B-клеточную лимфому выбирают из острого лимфобластного лейкоза (ALL), хронического лимфобластного лейкоза (CLL) или неходжкинской лимфомы (NHL).4. Способ по п.1, где комбинированная терапия обеспечивает ...

АНТИТЕЛО К CD38 И ЛЕНАЛТДОМИД ИЛИ БОРТЕЗОМИБ ДЛЯ ЛЕЧЕНИЯ МНОЖЕСТВЕННОЙ МИЕЛОМЫ И NHL

... 1. Синергическая комбинация антитела, специфичного к CD38, содержащего HCDR1 участок с последовательностью GFTFSSYYMN (SEQ ID NO: 1) или SYYMN (SEQ ID NO: 14), HCDR2 участок с последовательностью GISGDPSNTYYADSVKG (SEQ ID NO: 2), HCDR3 с последовательностью DLPLVYTGFAY (SEQ ID NO: 3), LCDR1 участок с последовательностью SGDNLRHYYVY (SEQ ID NO: 4), LCDR2 участок с последовательностью GDSKRPS (SEQ ID NO: 5) и LCDR3 участок с последовательностью QTYTGGASL (SEQ ID NO: 6), и(a) талидомида или его аналога или(b) ингибитора протеасомдля применения при лечении множественной миеломы и/или неходжкинской лимфомы.2. Комбинация по п.1, где антитело содержит вариабельный участок тяжелой цепи с последовательностьюQVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMNWVRQAPGKGLEWVSGISGDPSNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDLPLVYTGFAYWGQGTLVTVSS (SEQ ID NO: 10) и вариабельный участок легкой цепи с последовательностьюDIELTQPPSVSVAPGQTARISCSGDNLRHYYVYWYQQKPGQAPVLVIYGDSKRPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCQTYTGGASLVFGGGTKLTVLGQ ...

БИСПЕЦИФИЧЕСКИЙ РЕКОМБИНАНТНЫЙ БЕЛОК И ЕГО ПРИМЕНЕНИЕ

БИСПЕЦИФИЧЕСКОЕ АНТИТЕЛО ПРОТИВ OX40 И CTLA-4

АНТИ-CDH6-АНТИТЕЛО И КОНЪЮГАТ АНТИ-CDH6-АНТИТЕЛО-ЛЕКАРСТВЕННОЕ СРЕДСТВО

КОНЪЮГАТЫ АНТИТЕЛА К CCR7 И ЛЕКАРСТВЕННОГО СРЕДСТВА

АНТИ-GITR АНТИТЕЛА И СПОСОБЫ ИХ ИСПОЛЬЗОВАНИЯ

АФУКОЗИЛИРОВАННЫЕ АНТИТЕЛА К РЕЦЕПТОРУ ФАКТОРА РОСТА ФИБРОБЛАСТОВ FGFR2IIIB

ТЕРАПЕВТИЧЕСКИЕ И ДИАГНОСТИЧЕСКИЕ СПОСОБЫ С ПРИМЕНЕНИЕМ АНТИ-CD200 АНТИТЕЛ

... 1. Способ лечения человека, страдающего раком, включающий введение человеку анти-CD200 антитела или его CD200-связующего фрагмента в количестве, достаточном для лечения рака, где рак является устойчивым или, как подозревается, является устойчивым к лечению анти-CD20 терапевтическим средством.2. Способ по п.1, дополнительно включающий идентификацию человека как имеющего рак, который является устойчивым или, как подозревается, является устойчивым к лечению анти-CD20 терапевтическим средством.3. Способ по п.1, в котором рак включает раковые клетки, экспрессирующие CD5.4. Способ по п.3, дополнительно включающий идентификацию рака как включающего клетки, экспрессирующие CD5.5. Способ по п.1, в котором рак представляет собой солидную опухоль.6. Способ по п.1, в котором рак представляет собой «жидкую» опухоль.7. Способ по п.6, в котором «жидкая» опухоль представляет собой хронический лимфолейкоз или множественную миелому.8. Способ по п.7, в котором хронический лимфолейкоз представляет собой B-клеточный ...

ФАРМАЦЕВТИЧЕСКАЯ КОМПОЗИЦИЯ ДЛЯ ЛЕЧЕНИЯ И/ИЛИ ПРОФИЛАКТИКИ РАКА

... 1. Фармацевтическая композиция для лечения и/или профилактики рака, содержащая антитело или его фрагмент в качестве активного ингредиента, который обладает иммунологической реактивностью по отношению к неполному полипептиду CAPRIN-1, при этом CAPRIN-1 представлен любой из последовательностей, пронумерованных четными числами среди последовательностей SEQ ID NO: 2-30, и при этом неполный полипептид содержит аминокислотную последовательность, представленную в SEQ ID NO: 37, или аминокислотную последовательность, имеющую 80% или более высокую идентичность последовательности с аминокислотной последовательностью SEQ ID NO: 37.2. Фармацевтическая композиция по п.1, в которой раком является рак молочной железы, опухоль головного мозга, лейкоз, лимфома, рак легкого, мастоцитома, рак почек, рак шейки матки, рак мочевого пузыря, рак пищевода, рак желудка или рак прямой и ободочной кишки.3. Фармацевтическая композиция по п.1, в которой антитело является моноклональным антителом или поликлональным антителом ...

АНТИТЕЛА ПРОТИВ РЕЦЕПТОРА TFR И ИХ ПРИМЕНЕНИЕ ПРИ ЛЕЧЕНИИ ПРОЛИФЕРАТИВНЫХ И ВОСПАЛИТЕЛЬНЫХ РАССТРОЙСТВ

НЕЙТРАЛИЗУЮЩИЕ АНТИТЕЛА К ВИРУСУ ГРИППА А И ПУТИ ИХ ПРИМЕНЕНИЯ

АНТИ-PRE-S1 HBV АНТИТЕЛА

САЙТ-СПЕЦИФИЧЕСКИЕ КОНЪЮГАТЫ АНТИТЕЛА К HER2 И ЛЕКАРСТВЕННОГО СРЕДСТВА

АНТИТЕЛА, СВЯЗЫВАЮЩИЕ CD3

Полипептиды и полинуклеотиды и их применение для лечения иммунологических нарушений и рака

Human monoclonal antibody against a costimulatory signal transduction molecule ailim and pharmaceutical use thereof

Immunization of human antibody-producing transgenic mice, which have been created using genetic engineering techniques, with AILIM molecule as an antigen resulted in various human monoclonal antibodies capable of binding to AILIM and capable of controlling a variety of biological reactions (for example, cell proliferation, cytokine production, immune cytolysis, cell death, induction of ADCC, etc.) associated with AILIM-mediated costimulatory signal (secondary signal) transduction. Furthermore, it has been revealed that the human monoclonal antibody is effective to treat and prevent various diseases associated with AILIM-mediated costimulatory signal transduction, being capable of inhibiting the onset and/or advancement of the diseases.

ANTI-lgSF4 ANTIBODY AND UTILIZATION OF THE SAME

It is intended to clarify a molecule which is available as a target in treating or diagnosing cancer and utilize the molecule in the medical field or the research field. By treating IgSF4, which has been identified as a molecule specifically expressed in lung cancer cells, with an antibody, and ADCC activity is exerted. Based on this finding, an anti-IgSF4 antibody is provided as a means efficacious in treating cancer, etc.

Psca: prostate stem cell antigen and uses thereof

The invention provides a novel prostate cell-surface antigen, designated Prostate Stem Cell Antigen (PSCA), which is widely over-expressed across all stages of prostate cancer, including high grade prostatic intraepithelial neoplasia (PIN), androgen-dependent and androgen-independent prostate tumors.

Therapeutic use of anti-cs1 antibodies

The present invention is directed to antagonists of CS1 that bind to and neutralize at least one biological activity of CS1. The invention also includes a pharmaceutical composition comprising such antibodies or antigen-binding fragments thereof. The present invention also provides for a method of preventing or treating disease states, including autoimmune disorders and cancer, in a subject in need thereof, comprising administering into said subject an effective amount of such antagonists.

Cd33 binding agents

The present invention relates to immunotherapies that are based on myeloid cell depletion. In particular, the present invention relates to CD33 binding agents for use in such therapies, e.g. in the treatment of myeloid cell malignancies and myelodysplastic syndrome (MDS).

Anti-human cd52 immunoglobulins

The present invention relates to humanized immunoglobulins, mouse monoclonal antibodies and chimeric antibodies that have binding specificity for human CD52. The present invention further relates to a humanized immunoglobulin light chain and a humanized immunoglobulin heavy chain. The invention also relates to isolated nucleic acids, recombinant vectors and host cells that comprise a sequence which encodes a humanized immunoglobulin or immunoglobulin light chain or heavy chain, and to a method of preparing a humanized immunoglobulin. The humanized immunoglobulins can be used in therapeutic applications to treat, for example, autoimmune disease, cancer, non-Hodgkin's lymphoma, multiple sclerosis and chronic lymphocytic leukemia.

Diagnosis and treatment of cancer using anti-tmprss11e antibody

[Problem to be Solved] An object of the present invention is to provide novel means for the treatment and diagnosis of cancer. [Solution] The present inventors have obtained a monoclonal antibody against TMPRSS11E and found that this antibody binds to a native form of TMPRSS11E, and TMPRSS11E is highly expressed on the cell membranes of cancer cell lines in flow cytometry. This antibody exhibits antibody-dependent cell-mediated cytotoxicity activity (ADCC activity) and antitumor effect based on internalization activity and is promising as a therapeutic target. Moreover, this antibody has neutralization activity against protease activity and is also expected to have effect brought about by the inhibition of TMPRSS11E functions.

Human cdr-grafted antibody and antibody fragment thereof

A human CDR-grafted antibody or the antibody fragment thereof which specifically reacts with the extracellular region of human CC chemokine receptor 4 (CCR4) but does not react with a human blood platelet; a human CDR-grafted antibody or the antibody fragment thereof which specifically reacts with the extracellular region of CCR4 and has a cytotoxic activity against a CCR4-expressing cell; and a medicament, a therapeutic agent or a diagnostic agent comprising at least one of the antibodies and the antibody fragments thereof as an active ingredient.

Monoclonal antibody capable of binding to heparin-binding epidermal growth factor-like growth factor

Medicaments for treating diseases related to HB-EGF escalation are in demand. The present invention provides a monoclonal antibody or an antibody fragment thereof which binds to a cell membrane-bound HB-EGF, a membrane type HB-EGF and a secretory HB-EGF.

Methods and compositions for making antibodies and antibody derivatives with reduced core fucosylation

The invention provides methods and compositions for preparing antibodies and antibody derivatives with reduced core fucosylation.

Antibodies against extended type 1 chain antigens, derivatives thereof and use

Disclosed herein are antibodies or antigen-binding portions thereof directed against extended Type I chain antigens, in particular extended Type I chain glycosphingolipids, and the uses of the antibodies or antigen-binding portions thereof in the diagnosis, amelioration, treatment or prevention of diseases or disorders in mammals, including humans, resulting from or associated with the improper activity/metabolism or the presence of extended Type I chain antigens, in particular extended Type I chain glycosphingolipids.

Monoclonal Antibodies Against Claudin-18 For Treatment of Cancer

The present invention provides antibodies useful as therapeutics for treating and/or preventing diseases associated with cells expressing CLD18, including tumor-related diseases such as gastric cancer, esophageal cancer, pancreatic cancer, lung cancer, ovarian cancer, colon cancer, hepatic cancer, head-neck cancer, and cancer of the gallbladder.

Fc Region-Containing Polypeptides That Exhibit Improved Effector Function Due To Alterations Of The Extent Of Fucosylation, And Methods For Their Use

The present invention relates to Fc region-containing polypeptides that exhibit improved effector function due to alterations of the extent of fucosylation, and to methods of using such polypeptides for treating or preventing cancer and other diseases. The Fc region-containing polypeptides of the present invention are preferably immunoglobulins (e.g., antibodies), in which the Fc region comprises at least one amino acid substitution relative to the corresponding amino acid sequence of a wild type Fc region, and which is sufficient to attenuate post-translational fucosylation and mediate improved binding to an activating Fc receptor and reduced binding to an inhibitory Fc receptor. The methods of the invention are particularly useful in preventing, treating, or ameliorating one or more symptoms associated with a disease, disorder, or infection where either an enhanced efficacy of effector cell function mediated by FcγR is desired (e.g., cancer, infectious disease) or an inhibited effector cell response mediated by FcγR is desired (e.g., inflammation, autoimmune disease).

Antigen Binding Proteins

The present invention relates to antigen binding proteins comprising two Fc parts, methods for their production, pharmaceutical compositions containing said antigen binding proteins, and uses thereof.

Anti-Mesothelin Antibodies

This invention relates to the use of monoclonal and polyclonal antibodies that specifically bind to and become internalized by mesothelin-positive cells and also induce an immune effector activity such as antibody dependent cellular cytotoxicity. The antibodies are useful in specific delivery of pharmacologic agents to mesothelin expressing cells as well as eliciting an immune-effector activity particularly on tumor cells and precursors. The invention is also related to cells expressing the monoclonal antibodies, polyclonal antibodies, antibody derivatives, such as human, humanized, and chimeric monoclonal antibodies, antibody fragments, mammalian cells expressing the monoclonal antibodies, derivatives and fragments, and methods of treating cancer using the antibodies, derivatives and fragments.

Method of treatment of philadelphia chromosome positive leukaemia

The invention provides a method for the treatment of Ph+ leukemia in a patient comprising administering to the patient (i) a BCR-ABL tyrosine kinase inhibitor, and (ii) an agent which selectively binds to a cell surface receptor expressed on Ph+ leukemic stem cells. The invention further provides for the use of (i) and (ii) in, or in the manufacture of a medicament for, the treatment of Ph+ leukemia in a patient; and a composition for the treatment of Ph+ leukemia in a patient comprising (i) and (ii); and kits comprising (i) and (ii). In some embodiments, the tyrosine kinase inhibitor is or is not imatinib; or is selected from the group consisting of dasatinib, nilotinib, bosutinib, axitinib, cediranib, crizotinib, damnacanthal, gefitinib, lapatinib, lestaurtinib, neratinib, semaxanib, sunitinib, toceranib, tyrphostins, vandetanib, vatalanib, INNO-406, AP24534, XL228, PHA-739358, MK-0457, SGX393 and DC2036; or is selected from the group consisting of dasatinib and nilotinib. In some embodiments, the agent binds to a receptor involved in signalling by at least one of IL-3, G-CSF and GM-CSF. In some embodiments, the agent is a mutein selected from the group consisting of IL-3 muteins, G-CSF muteins and GM-CSF muteins. In some embodiments, the mutein is an IL-3 mutein. In some embodiments, the agent is a soluble receptor which is capable of binding to IL-3.

Antibody-drug conjugates

Disclosed are anti-5T4 antibody drug conjugates and methods for preparing and using the same.

Anti-d monoclonal antibodies

The invention concerns a method for obtaining and selecting monoclonal antibodies by an ADDC-type test, said antibodies capable of activating type III Fcγ receptors and having a particular glycan structure. The inventive anti-D antibodies can be used for preventing Rhesus isoimmunisation in Rh negative persons, in particular for haemolytic disease in a new-born baby or for uses such as idiopathic thrombocytopenic purpura (ITP).

Production of low fucose antibodies in h4-ii-e rat cells

The invention concerns the field of cell culture technology. It specifically concerns a rat hepatoma cell, preferably a H4-II-E rat hepatoma cell, carrying a DNA encoding an antibody or Fc-fusion protein and having low fucosylation activity for adding fucose to glycosidic structures such as biantennary glycans, e.g. N-acetylglucosamine. The invention furthermore concerns a method for producing low fucose glycoproteins especially antibodies or Fc-fusion proteins in rat hepatoma cells, preferably in H4-II-E rat hepatoma cells. It further concerns the identification and generation of new host cell lines which are capable of synthetizing glycoproteins with beneficial properties, improving the therapeutic efficacy and/or serum half-life of the product compared to products from commonly used host cell lines.

Interleukin-21 receptor binding proteins

The present invention provides binding proteins and antigen-binding fragments thereof that specifically bind to the human interleukin-21 receptor (IL-21R). The binding proteins can act as, e.g., antagonists of IL-21R activity, thereby modulating immune responses in general, and those mediated by IL-21R in particular. The disclosed compositions and methods may be used, e.g., in diagnosing and/or treating IL-21R-associated disorders, e.g., inflammatory disorders, autoimmune diseases, allergies, transplant rejection, cancer, and other immune system disorders.

Dac hyp compositions and methods

The present disclosure relates to compositions of daclizumab suitable for subcutaneous administration and methods of manufacturing thereof.

Anti-cd40 antibodies and methods of use

The present invention provides high affinity anti-CD40 monoclonal antibodies and related compositions, which may be used in any of a variety of therapeutic methods for the treatment of cancer and other diseases.

Antibodies specific for claudin 6 (cldn6)

The present invention provides antibodies useful as therapeutics for treating and/or preventing diseases associated with cells expressing Claudin-6 (CLDN6), including tumor-related diseases such as ovarian cancer, lung cancer, gastric cancer, breast cancer, hepatic cancer, pancreatic cancer, skin cancer, malignant melanoma, head and neck cancer, sarcoma, bile duct cancer, cancer of the urinary bladder, kidney cancer, colon cancer, placental choriocarcinoma, cervical cancer, testicular cancer, and uterine cancer.

Crystal structures and methods using same

The present invention relates generally to the fields of molecular biology and growth factor regulation. More specifically, the invention concerns modulators of FGFR3 function, and the identification and uses of said modulators.

Anti-c4.4a antibodies and uses thereof

The present invention provides recombinant antigen-binding regions and antibodies and functional fragments containing such antigen-binding regions that are specific for the membrane-anchored, 29 kDa C4.4a polypeptide, which is over expressed in several tumors, e.g. lung, colorectal, pancreas, prostate, renal and breast cancer. These antibodies, accordingly, can be used to treat these and other disorders and conditions. Antibodies of the invention also can be used in the diagnostics field, as well as for further investigating the role of C4.4a in the progression of disorders associated with cancer. The invention also provides nucleic acid sequences encoding the foregoing antibodies, vectors containing the same, pharmaceutical compositions and kits with instructions for use.

Trispecific Therapeutics Against Acute Myeloid Leukaemia

The present invention relates to a molecule having binding specificities for (a) CD123; (b) CD16 and (c) CD33. The present invention further relates to the molecule of the invention, wherein the molecule comprises a first immunoglobulin domain comprising a V L domain linked to a V H domain, wherein the immunoglobulin domain specifically binds to CD123; a second immunoglobulin domain comprising a V L domain linked to a V H domain, wherein the immunoglobulin domain specifically binds to CD16; and a third immunoglobulin domain comprising a V L domain linked to a V H domain, wherein the immunoglobulin domain specifically binds to CD33. The present invention furthermore relates to a nucleic acid molecule encoding the molecule of the invention. In addition, the present invention relates to diagnostic and pharmaceutical compositions and the use of the molecule or the nucleic acid molecule of the invention in the treatment of acute myeloid leukaemia and/or myelodysplastic syndrome.

Antagonist anti-cd40 monoclonal antibodies and methods for their use

Compositions and methods of therapy for treating diseases mediated by stimulation of CD40 signaling on CD40-expressing cells are provided. The methods comprise administering a therapeutically effective amount of an antagonist anti-CD40 antibody or antigen-binding fragment thereof to a patient in need thereof. The antagonist anti-CD40 antibody or antigen-binding fragment thereof is free of significant agonist activity, but exhibits antagonist activity when the antibody binds a CD40 antigen on a human CD40-expressing cell. Antagonist activity of the anti-CD40 antibody or antigen-binding fragment thereof beneficially inhibits proliferation and/or differentiation of human CD40-expressing cells, such as B cells.

Anti-fgfr3 antibodies and methods using same

The invention provides FGFR3 antibodies, and compositions comprising and methods of using these antibodies.

Anti-alpha2 integrin antibodies and their uses

The invention relates to antibodies directed to α2β1 integrin and their uses, including humanized anti-alpha 2 (α2) integrin antibodies and methods of treatment with anti-α2integrin antibodies. More specifically the present invention relates to humanized anti-α2 integrin antibodies comprising a heavy chain variable region, a light chain variable region, a human light chain constant region and a variant human IgG1 heavy chain constant region which exhibit altered effector function.

Methods and Compositions for Treatment of Human Immunodeficiency Virus Infection with Conjugated Antibodies or Antibody Fragments

The present invention concerns methods and compositions for treatment of HIV infection in a subject. The compositions may comprise a targeting molecule against an HIV antigen, such as an anti-HIV antibody or antibody fragment. The anti-HIV antibody or fragment may be conjugated to a variety of cytotoxic agents, such as doxorubicin. In a preferred embodiment, the antibody or fragment is P4/D10. Other embodiments may concern methods of imaging, detection or diagnosis of HIV infection in a subject using an anti-HIV antibody or fragment conjugated to a diagnostic agent. In alternative embodiments, a bispecific antibody with at least one binding site for an HIV antigen and at least one binding site for a carrier molecule may be administered, optionally followed by a clearing agent, followed by administration of a carrier molecule conjugated to a therapeutic agent.

Structural Variants of Antibodies for Improved Therapeutic Characteristics

Substituted humanized, chimeric or human anti-CD20 antibodies or antigen binding fragments and bispecific antibodies or fusion proteins comprising the substituted antibodies or antigen binding fragments are disclosed. They are useful for treatment of B-cell disorders, such as B-cell malignancies and autoimmune diseases, as well as GVHD, organ transplant rejection, and hemolytic anemia and cryoglobulinemia. Substitution of an aspartate residue at Kabat position 101 of CDR3 V H (CDRH3), produces improved therapeutic properties, including decreased dissociation rates and improved CDC activity, apoptosis, B-cell depletion and therapeutic efficacy at very low dosages. Veltuzumab, a humanized antibody that incorporates such sequence variation, exhibits improved therapeutic efficacy compared to similar antibodies of different CDRH3 sequence, allowing therapeutic effect at dosages as low as 200 mg or less, preferably 100 mg or less, preferably 80 mg or less, preferably 50 mg or less, most preferably 30 mg or less of naked antibody administered i.v. or s.c.

Cd27l antigen binding proteins

The present invention relates to CD27L antigen binding proteins, such an antibodies, polynucleotides encoding said CD27l antigen binding proteins, antibody drug conjugate compositions, and methods for diagnosing and treating diseases associated with CD27L expression.

New Humanized Anti-CD20 Monoclonal Antibody

The present invention discloses methods of design and preparation for a new humanized anti-CD20 monoclonal antibody, related genes, protein sequence, and the use of said antibody. Comparing to murine-derived antibodies and human-mouse chimeric antibodies, said humanized anti-CD20 antibody maintains or improves high binding activity of the variable regions, meanwhile reduces the immunogenicity of chimeric antibodies, consequently achieves the effect of reducing medicine side effects and improving clinical treatment. The antibody disclosed by the present invention is efficiently expressed in animal cells, can be used for industrial production. It could be used in treating B cell lymphoma, leukaemia, or B cell-associated autoimmune disease with a wide application prospect.

Antibodies with Enhanced or Suppressed Effector Function

Rationally designed antibodies and polypeptides that comprise multiple Fc region amino acid substitutions that synergistically provide enhanced selectivity and binding affinity to a target Fc receptor are provided. The polypeptides are mutated at multiple positions to make them more effective when incorporated in antibody therapeutics than those having wild-type Fc components.

Antibodies specific for trop-2 and their uses

The present invention provides antibodies that specifically bind to trophoblast cell-surface antigen-2 (Trop-2). The invention further provides antibody conjugates comprising such antibodies, antibody encoding nucleic acids, and methods of obtaining such antibodies. The invention further relates to therapeutic methods for use of these antibodies and Trop-2 antibody conjugates for the treatment of a condition associated with Trop-2 expression (e.g., cancer), such as colon, esophageal, gastric, head and neck, lung, ovarian, or pancreatic cancer.

ANTI-CD154 ANTIBODIES HAVING IMPAIRED FcR BINDING AND/OR COMPLEMENT BINDING PROPERTIES AND RELATED THERAPIES

Improved anti-CD154 antibodies are provided herein which have ablated FcR binding and/or complement binding/activation. The use of these antibodies for inducing tolerance and treating immune diseases including autoimmunity, inflammation and allergic disorders is disclosed herein.

Optimized Fc Variants and Methods For Their Generation

The present invention relates to optimized Fc variants, methods for their generation, and antibodies and Fc fusions comprising optimized Fc variants.

Monoclonal Antibodies for Treatment of Cancer

The present invention provides antibodies useful as therapeutics for treating and/or preventing diseases associated with cells expressing GT468, including tumor-related diseases such as breast cancer, lung cancer, gastric cancer, ovarian cancer, and hepatocellular cancer.

Compositions and Methods for the Therapy and Diagnosis of Influenza

The present invention provides novel human anti-influenza antibodies and related compositions and methods. These antibodies are used in the diagnosis and treatment of influenza infection.

Anti-human folate receptor beta antibodies and methods of use

Human anti-human folate receptor beta antibodies and antigen-binding fragments thereof are described, as well as methods of using such antibodies and fragments to treat inflammatory disorders or cancers expressing cell surface FRβ.

Antibodies that bind to OX40 and their uses

The present invention relates to antagonist antibodies or fragments thereof that bind to human OX40. More specifically, the present invention relates to an antagonist antibody or fragment thereof that binds to human OX40 comprising a heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO: 1, and/or a heavy chain CDR2 comprising the amino acid sequence of SEQ ID NO: 2, and/or a heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO: 3; and/or comprising a light chain CDR1 comprising the amino acid sequence of SEQ ID NO: 4, and/or a light chain CDR2 comprising the amino acid sequence of SEQ ID NO: 5 and/or a light chain CDR3 comprising the amino acid sequence of SEQ ID NO: 6.

Optimized Fc Variants

The present invention relates to Fc variants having decreased affinity for FcγRIIb, methods for their generation, Fc polypeptides comprising optimized Fc variants, and methods for using optimized Fc variants.

Optimized Fc Variants and Methods for Their Generation

The present invention relates to optimized Fc variants, methods for their generation, and antibodies and Fc fusions comprising optimized Fc variants.

Variable region sequences of il-31 monoclonal antibodies and methods of use

Novel compositions derived from antigen-binding sites of immunoglobulins having affinity for IL-31 are provided. The compositions exhibit immunological binding properties of antibody molecules capable of binding specifically to a human IL-31. CDR regions derived from same or different immunoglobulin moieties are provided. Also provided are single chain polypeptides wherein V H and V L domains are attached. The sFv molecules can include ancillary polypeptide moieties which can be bioactive, or which provide a site of attachment for other useful moieties. The compositions are useful in specific binding assays, affinity purification schemes, drug or toxin targeting, imaging, and genetic or immunological therapeutics for inflammatory diseases. The invention thus provides novel polypeptides, the DNAs encoding those polypeptides, expression cassettes comprising those DNAs, and methods of inducing the production of the polypeptides. The invention further provides the amino acid sequences of the variable regions of the monoclonal antibodies and use of these monoclonal antibody or antibody fragment in conjunction with an human IgG4 Fc molecule.

Compositions and methods for diagnosing and treating cancer

An isolated antibody that specifically binds to an extracellular domain of human DLL4 and affects growth of a tumor comprising cancer stem cells is described. Also described is a method of treating cancer comprising administering a therapeutically effective amount of an anti-DLL4 antibody.

Targeted/immunomodulatory fusion proteins and methods for making same

The present invention relates generally to the field of generating fusion proteins to be used in cancer therapy, and more specifically, to nucleotide sequences encoding the fusion proteins, wherein the chimeric fusion proteins comprises at least one targeting moiety and at least one immunomodulatory moiety that counteracts the immune tolerance of cancer cells.

Anti-glypican-3 antibody having improved kinetics in plasma

A method of modulating the plasma half-life of anti-glypican 3 antibody, a pharmaceutical composition comprising as an active ingredient the anti-glypican 3 antibody that has a plasma half-life that has been modulated, a method of preparing the anti-glypican 3 antibody and a pharmaceutical composition comprising the anti-glypican 3 antibody as an active ingredient are provided. Disclosed is a method of modulating the plasma half-life of anti-glypican 3 antibody by modifying an amino acid residue that is exposed on the surface of the anti-glypican 3 antibody; and anti-glypican 3 antibody that has a plasma half-life that has been modulated by amino acid residue modification, a pharmaceutical composition comprising as an active ingredient the anti-glypican 3 antibody, and a method of preparing the anti-glypican 3 antibody and producing a pharmaceutical composition comprising the anti-glypican 3 antibody as an active ingredient.

Anti-c epsilon mx antibodies capable of binding to human mige on b lymphocytes

The invention pertains to the generation and utility of antibodies that can bind effectively to CεmX domain on membrane-bound IgE (mIgE) expressed on the surface of human B lymphocytes. The CεmX domain of 52 amino acid residues, located between the CH4 domain and the C-terminal membrane-anchor peptide on human membrane-bound epsilon chain, had been suggested as an antigenic site for immunological targeting of B cells expressing mIgE. Previous reported monoclonal antibodies, including a20, which bind to RADWPGPP (SEQ ID NO:1) peptide at the C-terminal of CεmX, have now been found to bind poorly to mIgE on human B cells. We have discovered that only monoclonal antibodies specific for certain segments, such as GLAGGSAQSQRAPDRVL (SEQ ID NO:2) and HSGQQQGLPRAAGGSVPHPR (SEQ ID NO:3), of CεmX can bind effectively to mIgE on human B cells and hence have the utility for targeting those B cells for the treatment of diseases mediated by IgE.

Sparc binding peptides and uses thereof

The invention provides SPARC and Albumin binding peptides for the targeting of disease sites, such as tumors, with therapeutic and diagnostic agents. In particular, compositions comprising SPARC binding peptide-Antibody Fc domain fusion proteins and methods of their use are disclosed.

Antibodies that bind the glutamate ligand binding region of notch3

Isolated antibodies that specifically binds to an extracellular conserved ligand binding region of a human Notch receptor and inhibits growth of a tumor are described. Also described are methods of treating cancer, the method comprising administering an anti-Notch antibody in an amount effective to inhibit tumor growth.

Monoclonal antibody capable of binding to heparin-binding epidermal growth factor-like growth factor

Medicaments for treating diseases related to HB-EGF escalation are in demand. The present invention provides a method for producing a monoclonal antibody or an antibody fragment thereof which binds to a cell membrane-bound HB-EGF, a membrane type HB-EGF and a secretory HB-EGF.

Method of treating malignant mesothelioma

The present invention relates to a therapeutic agent for malignant mesothelioma comprising a substance which inhibits binding of CD26 to extracellular matrix such as an siRNA targeting CD26 cDNA or an anti-CD26 antibody. The present invention also relates to a method of treating malignant mesothelioma, which comprises administering the substance to a patient in need thereof.

Anti-mesothelin binding proteins

The present disclosure provides compositions and methods relating to antigen binding proteins, in particular, antibodies and bispecific antibodies which specifically bind to mesothelin. The disclosure provides nucleic acids encoding such antigen binding proteins and antibodies and methods of making and using such antibodies, including methods of treating and preventing cancer or other hypoproliferative disorders and related disorders by administering such antigen binding proteins and antibodies to a subject in need of such treatment.

Notch1 receptor binding agents and methods of use thereof

The present invention relates to compositions and methods for characterizing, diagnosing, and treating cancer. In particular the invention provides the means and methods for the diagnosis, characterization, prognosis and treatment of cancer and specifically targeting cancer stem cells. The present invention provides an antibody that specifically binds to a non-ligand binding membrane proximal region of the extracellular domain of a human Notch receptor and inhibits tumor growth. The present invention further provides a method of treating cancer, the method comprising administering a therapeutically effective amount of an antibody that specifically binds to a non-ligand binding membrane proximal region of the extracellular domain of a human Notch receptor protein and inhibits tumor growth.

Methods of Improving the Therapeutic Efficacy and Utility of Antibody Fragments

The present disclosure relates to methods and uses of improving the therapeutic efficacy and utility of antibody fragments by employing anti-epitope-tagging technologies.

Antibodies with enhanced antibody-dependent cellular cytotoxicity activity, methods of their production and use

The invention relates, in part, to antibodies with increased ADCC activity. Methods of producing such antibodies are also provided. The antibodies of the invention are produced in mammary epithelial cells, such as those in a non-human transgenic animal engineered to express and secrete the antibody in its milk. The antibodies or compositions comprising the antibodies can be used to treat disease in which ADCC activity provides a benefit. In one embodiment, therefore, the antibodies or compositions comprising the antibodies can be used to treat cancer, lymphoproliferative disease or autoimmune disease.

OPTIMIZED Fc VARIANTS

The present invention relates to Fc variants having decreased affinity for FcγRIIb, methods for their generation, Fc polypeptides comprising optimized Fc variants, and methods for using optimized Fc variants.

Humanized anti-interleukin 3 receptor alpha chain antibodies

The present disclosure provides antibodies that bind to interleukin-3 receptor alpha chain and uses thereof.

CEACAM1 BASED CANCER THERAPY AND DIAGNOSIS

The invention relates to methods and compositions for the treatment and diagnosis of cancers. At least one aspect of the present invention relates to methods and compositions for enhancing the efficacy of tumor-infiltrating lymphocyte (TIL) therapy in the treatment of cancer by negatively modulating the activity of the CEACAM1 protein. 1. A method for enhancing the efficacy of Tumor Infiltrating Lymphocyte cancer therapy comprising the modulation of CEACAM1 protein function.2. The method of claim 1 , wherein said modulation of CEACAM1 protein function comprises the disruption of a target CEACAM1 homotypic or heterotypic protein-protein interaction.3. The method of claim 2 , wherein the disruption of said target CEACAM1 homotypic or heterotypic protein-protein interaction comprises contacting at least one protein involved in said protein-protein interaction with an inhibitory agent that partially or completely inhibit or disrupt said protein-protein interaction claim 2 , said inhibitory agent comprising an amino acid sequence claim 2 , nucleic acid sequence claim 2 , small molecule compound claim 2 , or combinations thereof.4. The method of claim 2 , wherein the disruption of said target CEACAM1 homotypic or heterotypic protein-protein interaction comprises contacting at least one protein involved in said protein-protein interaction with an inhibitory agent that partially or completely inhibits or disrupts said protein-protein interaction claim 2 , said inhibitory agent comprising an amino acid sequence derived from a CEACAM family protein sequence.5. The method of claim 2 , wherein the disruption of said target CEACAM1 homotypic or heterotypic protein-protein interaction comprises contacting at least one protein involved in said protein-protein interaction with an inhibitory agent that partially or completely inhibits or disrupts said protein-protein interaction claim 2 , said inhibitory agent comprising an immunoglobulin or fragment thereof.6. The method of claim 2 ...

COMBINATION THERAPY INVOLVING ANTIBODIES AGAINST CLAUDIN 18.2 FOR TREATMENT OF CANCER

The present invention provides a combination therapy for effectively treating and/or preventing diseases associated with cells expressing CLDN18.2, including cancer diseases such as pancreatic cancer and metastases thereof. 1. A method of treating or preventing pancreatic cancer in a patient comprising administering to the patient (i) an antibody having the ability of binding to CLDN18.2 and (ii) an agent stabilizing or increasing expression of CLDN18.2.2. The method of claim 1 , wherein expression of CLDN18.2 is at the cell surface of a cancer cell.3. The method of or claim 1 , wherein the agent stabilizing or increasing expression of CLDN18.2 comprises an agent which induces a cell cycle arrest or an accumulation of cells in one or more phases of the cell cycle claim 1 , preferably in one or more phases of the cell cycle other than the G1-phase claim 1 , more preferably in the G2-phase and/or the S-phase.4. The method of any one of to claim 1 , wherein the agent stabilizing or increasing expression of CLDN18.2 comprises an agent selected from the group consisting of nucleoside analogs claim 1 , platinum compounds claim 1 , camptothecin analogs claim 1 , taxanes claim 1 , prodrugs thereof claim 1 , salts thereof claim 1 , and combinations thereof.5. The method of any one of to claim 1 , wherein the agent stabilizing or increasing expression of CLDN18.2 comprises an agent selected from the group consisting of gemcitabine claim 1 , 5-fluorouracil claim 1 , oxaliplatin claim 1 , irinotecan claim 1 , paclitaxel claim 1 , prodrugs thereof claim 1 , salts thereof claim 1 , and combinations thereof.6. The method of any one of to claim 1 , wherein the agent stabilizing or increasing expression of CLDN18.2 comprises an agent inducing immunogenic cell death.7. The method of claim 6 , wherein the agent inducing immunogenic cell death comprises oxaliplatin.8. The method of any one of to claim 6 , wherein the method comprises administering a combination of gemcitabine and ...

Compositions and Production of Recombinant AAV Viral Vectors Capable of Glycoengineering In Vivo

The disclosure provides an expression vector (e.g., AAV vector) comprising a nucleic acid sequence encoding (1) the heavy and/or light chain of an antibody and (2) one or more shRNA sequences targeting fucosyltransferase-8 (FUT8). 1. An expression vector comprising a nucleic acid sequence encoding (1) the heavy and/or light chain of an antibody and (2) one or more shRNA sequences targeting fucosyltransferase-8 (FUT8).2. The expression vector of claim 1 , wherein the expression vector encodes both the heavy chain and the light chain of an antibody.3. The expression vector of claim 1 , wherein the expression vector is an adeno-associated viral (AAV) vector.4. The expression vector of claim 1 , wherein the heavy chain comprises one or more mutations in the Fc region which enhances antibody-dependent cell cytotoxicity.5. The expression vector of claim 4 , wherein mutation is an LS mutation (M428L/N434S) claim 4 , a LALA mutation (L234A claim 4 , L235A) claim 4 , a S239 (DFL) mutation (S239D/1332F/A330L) a C6A-74 mutation (V259I/N315D/N434Y) claim 4 , a HN mutation (H433K/N434F) claim 4 , K392D/K409D/A330M/K334V claim 4 , E356K/D399K/L234Y/Y296W claim 4 , K392D/K409D/S239D/A330M/K334V claim 4 , E356K/D399K/L234Y/K290Y/Y296W claim 4 , K392D/K409D/A330M/K334V claim 4 , E356K/D399K/L234Y/K290Y/Y296W claim 4 , K392D/K409D/A330F/K334V claim 4 , E356K/D399K/L234Y/K290Y/Y296W claim 4 , K392D/K409D/A330M/K334V claim 4 , or E356K/D399K/K290Y/Y296W.6. A composition comprising (a) an expression vector comprising a nucleic acid sequence encoding a heavy chain of an antibody and (b) an expression vector comprising a nucleic acid sequence encoding a light chain of an antibody claim 4 , wherein (a) claim 4 , (b) claim 4 , or (a) and (b) further comprises one or more shRNA sequences targeting fucosyltransferase-8 (FUT8).7. The composition of claim 6 , wherein the expression vector is an adeno-associated viral (AAV) vector.8. The composition of claim 6 , wherein the heavy chain comprises ...

CD19 BINDING AGENTS AND USES THEREOF

This invention, inter alia, relates to CD19 binding agents and methods of using such CD19 binding agents for treating disease. 1. A method for treating a CD19-associated disorder in a mammalian subject comprising administering an antibody or antigen-binding fragment that specifically binds to human CD19 in an amount effective to treat the disorder in the mammalian subject; the antibody or antigen-binding fragment comprising a heavy chain variable region amino acid sequence as set forth in SEQ ID NO:29 with 0 , 1 or 2 substitutions relative to SEQ ID NO:9 and a light chain variable region amino acid sequence as set forth in SEQ ID NO:30 with 0 , 1 or 2 substitutions relative to SEQ ID NO:17; wherein the antibody or antigen-binding fragment binds to CD19 with a dissociation constant of 1×10M.2. The method of claim 1 , wherein the CD19-associated disorder is a CD19 expressing cancer.3. The method of claim 1 , wherein the heavy chain variable region has the amino acid sequence of SEQ ID NO:9.4. The method of claim 1 , wherein the light chain variable region has the amino acid sequence of SEQ ID NO:24.5. The method of claim 1 , wherein the antibody comprises a human IgG constant region and is administered.6. The method of claim 5 , wherein the isotype of the IgG constant region is IgG1 claim 5 , IgG2 claim 5 , or IgG1V1.7. The method of claim 1 , wherein the antibody or antigen-binding fragment is conjugated to an anti-tubulin agent.8. The method of claim 7 , wherein the anti-tubulin agent is an auristatin.9. The method of claim 1 , wherein the antibody or antigen-binding fragment as a ligand-drug conjugate compound claim 1 , wherein the ligand drug conjugate compound is of the following formula:{'br': None, 'sub': 'p', 'L-(LU-D)\u2003\u2003(I)'}or a pharmaceutically acceptable salt or solvate thereof;wherein:L is a ligand unit wherein the ligand unit is the antibody or antigen-binding fragment; and(LU-D) is a Linker unit-Drug unit moiety, wherein:LU- is a Linker unit, ...

Bispecific CD33 and CD3 Binding Proteins

Described herein are binding proteins that specifically bind to human CD33, and in particular to bispecific binding proteins that specifically bind to human CD33 and human CD3. Also described herein are bispecific tandem diabodies that bind to CD33 and CD33, and their uses for immunotherapy of CD33 + cancers, diseases and conditions such as acute myeloid leukemia (AML).

THERAPEUTIC USE OF ANTI-CS1 ANTIBODIES

The present invention is directed to antagonists of CS1 that bind to and neutralize at least one biological activity of CS1. The invention also includes a pharmaceutical composition comprising such antibodies or antigen-binding fragments thereof. The present invention also provides for a method of preventing or treating disease states, including autoimmune disorders and cancer, in a subject in need thereof, comprising administering into said subject an effective amount of such antagonists. 1. An antibody or an antigen-binding fragment thereof , wherein said antibody binds to CS1 and inhibits immunoglobulin secretion.2. The antibody or the antigen-binding fragment according to claim 1 , wherein said antibody inhibits the proliferation of leukocytes.3. The antibody or the antigen-binding fragment according to claim 1 , wherein said antibody inhibits the proliferation of cancer cells.4. The antibody or the antigen-binding fragment according to claim 1 , wherein said antibody triggers cytotoxic effects on cells expressing CS1 or enhances cytotoxicity mediated by immune cells.5. The antibody or antigen binding fragment of claim 4 , wherein said antibody triggers ADCC-mediated cytotoxicity of cells expressing CS1.6. The antibody or the antigen-binding fragment according to claim 1 , wherein said antibody binds to substantially the same eptitope as the antibody produced by a hybridoma cell line having ATCC accession number PTA-5091 or a Luc63 antibody.7. The antibody or antigen-binding fragment according to claim 1 , wherein said antibody is produced by a hybridoma cell line having ATCC accession number PTA-5091.8. The antibody or the antigen-binding fragment according to claim 1 , wherein said antibody is produced by a hybridoma cell line expressing Luc63 antibody.9. The antibody according to claim 1 , wherein said antibody is a monoclonal antibody.10. The antibody according to claim 9 , wherein said monoclonal antibody is a chimeric antibody claim 9 , a humanized ...

A compound that specifically binds to kir3dl2 for use in the treatment of peripheral t cell lymphoma

The present disclosure relates to methods for the treatment, prevention and diagnostic of peripheral T cell lymphoma using compounds that specifically bind KIR3DL2. The disclosure also relates to use of antibodies that specifically bind KIR3DL2 in diagnostic and theranostic assays in the detection and treatment of peripheral T cell lymphoma.

ANTIBODIES TO BONE MARROW STROMAL ANTIGEN 1

The invention provides antibodies which bind to the ADP-ribosyl cyclase 2. Nucleic acid molecules encoding the antibodies, expression vectors, host cells and methods for expressing the antibodies are also provided. The antibodies may be used for the treatment of human cancers, including acute myeloid leukemia (AML), B-cell chronic lymphocytic leukemia, breast cancer, colorectal cancer, kidney cancer, head and neck cancer, lung cancer, ovarian cancer and pancreatic cancer and human inflammatory diseases, including asthma, gout, crohns, lupus, multiple sclerosis, rheumatoid arthritis, psoriasis, diabetes and atherosclerotic. 1. A method of treating a disease in a patient comprising administering to the patient an antibody , or antigen binding portion thereof , wherein the antibody , or antigen binding portion thereof , comprises a heavy chain variable region CDR1 comprising SEQ ID NO:10 , a heavy chain variable region CDR2 comprising SEQ ID NO: 12 or SEQ ID NO: 51 , a heavy chain variable region CDR3 comprising SEQ ID NO:14 , a light chain variable region CDR1 comprising SEQ ID NO:16 , a light chain variable region CDR2 comprising SEQ ID NO: 18 , and a light chain variable region CDR3 comprising SEQ ID NO:20.2. A method of treating a disease in a patient comprising administering to the patient an antibody , or antigen binding portion thereof , wherein the antibody , or antigen binding portion thereof , comprises: (A) a heavy chain variable region comprising SEQ ID NO: 2 and/or a light chain variable region comprising SEQ ID NO: 4 or (B) an antibody , or an antigen binding portion thereof , which competes for binding to BST1 with an antibody comprising SEQ ID NO: 2 and a light chain variable region comprising SEQ ID NO: 4.3. A method of treating a disease in a patient comprising administering to the patient an antibody , or antigen binding portion thereof , wherein the antibody , or antigen binding portion thereof , comprises (A) a heavy chain variable region ...

BISPECIFIC HETERODIMERIC DIABODIES AND USES THEREOF

Bispecific heterodimeric diabody molecules and uses thereof in the treatment of cancer. The bispecific heterodimeric diabody molecules comprise two polypeptide chains that associate to form two epitope binding sites recognizing the P-cadherin tumor cell associated antigen and the CD3 T cell antigen. 1. A bispecific heterodimeric diabody capable of specific binding to an epitope of P-cadherin and to an epitope of CD3 comprising a first polypeptide chain and a second polypeptide chain , wherein: i. a Domain 1, comprising a sub-Domain 1A and a sub-Domain 1B, and', 'ii. a first heterodimer-promoting domain; and, 'a. the first polypeptide comprises, in the N-terminal to C-terminal direction i. a Domain 2, comprising a sub-Domain 2A and a sub-Domain 2B and', 'ii. a second heterodimer-promoting domain, and, 'b. the second polypeptide chain comprises, in the N-terminal to C-terminal directionwherein sub-Domain 1A and sub-Domain 2A form a P-cadherin VL/VH binding domain comprising a variable heavy (VH) domain of an anti-P-cadherin antibody (P-CAD VH) and a variable light (VL) domain of an anti-P-cadherin antibody (P-CAD VL), and sub-Domain 1B and sub-Domain 2B form a CD3 VL/VH binding domain comprising a VL domain of an anti-CD3 antibody (CD3 VL) and a VH binding domain of an anti-CD3 antibody (CD3 VH); orwherein sub-Domain 1A and sub-Domain 2A form a CD3 VL/VH binding domain comprising a CD3 VL and a CD3 VH, and sub-Domain 1B and sub-Domain 2B form a P-cadherin VL/VH binding domain comprising a P-CAD VH and a P-CAD VL.2. The bispecific heterodimeric diabody of claim 1 , wherein the sub-Domain 1A comprises a P-CAD VL or a CD3 VL claim 1 , and the sub-Domain 1B comprises a P-CAD VH claim 1 , if the sub-Domain 1A comprises CD3 VL claim 1 , or aCD3 VH claim 1 , if the sub-Domain 1A comprises P-CAD VL; and wherein the sub-Domain 2B comprises a P-CAD VL or a CD3 VL depending on the VL domain selected for sub-Domain 1A claim 1 , and the sub-Domain 2A comprises P-CAD VH claim 1 , ...

Antibody against the csf-1r

The present invention provides antibodies specific for the CSF-1R, compositions comprising said antibodies and methods of treatment using such compositions.

MONOCLONAL ANTIBODIES DIRECTED TO CD20

The invention provides antibody to canine or feline or equine antigens. Specifically, antibodies directed to canine CD20 which have been caninized or felinized are provided. Also provided are methods for preparing high affinity antibodies to canine and feline CD20 as well as methods for treating B cell disorders in companion animals. 1. An antibody or antibody fragment thereof recognizing a canine or feline CD20 wherein the antibody reduces the percentage of CD20-expressing cells in a companion animal host.2. The antibody or antibody fragment of which reduces B-cell lymphoma cells in a companion animal host.3. The antibody or antibody fragment of which depletes B-cell lymphoma cells in a companion animal host.4. An antibody or antibody fragment recognizing a canine or feline CD20 claim 1 , and comprising at least one of the CDR regions from SEQ ID NOS 17-43.5. An antibody or antibody fragment according to recognizing a canine or feline CD20 claim 4 , and comprising a sequence selected from SEQ ID NOS 17-43.6. An antibody or antibody fragment having the binding characteristics of an antibody selected from mAb CD20-1 claim 4 , CD20-2 claim 4 , CD20-3 claim 4 , CD20-4 claim 4 , CD20-5 claim 4 , and CD20-6.7. An antibody or antibody fragment according to comprising a variable domain structure selected from AVD-1 through AVD-13.8. An antibody or antibody fragment comprising a light chain selected from SEQ ID NOs: 20 claim 1 , 21 claim 1 , 22 claim 1 , 24 claim 1 , 25 claim 1 , 26 claim 1 , 28 claim 1 , 32 claim 1 , 33 claim 1 , 36 claim 1 , 37 claim 1 , 38 claim 1 , 39 claim 1 , 41 claim 1 , and 43 and a heavy chain selected from SEQ ID NOs:17 claim 1 , 18 claim 1 , 19 claim 1 , 23 claim 1 , 27 claim 1 , 29 claim 1 , 30 claim 1 , 31 claim 1 , 34 claim 1 , 35 claim 1 , 38 claim 1 , 40 claim 1 , and 42.9. The antibody or antibody fragment according to which is a heterochimeric antibody.10. The antibody or antibody fragment according to which binds to canine CD20 and ...

CONSTRUCTION OF CHIMERIC ANTIGEN RECEPTOR TARGETING CD20 ANTIGEN AND ACTIVITY IDENTIFICATION OF ENGINEERED T CELLS THEREOF

Provided are a chimeric antigen receptor targeting CD20 antigen and a preparation method thereof. The extracellular antigen binding domain of the chimeric antigen receptor includes an antibody heavy chain variable region shown in SEQ ID NO: 7 or 9 or 33 and an antibody light chain variable region shown in SEQ ID NO: 11 or 13 or 35, and is capable of killing tumor cells. 1. A chimeric antigen receptor (CAR) wherein the CAR has an antigen binding domain which comprises an antibody heavy chain variable region as shown in SEQ ID NO: 7 or 9 or 33 and an antibody light chain variable region as shown in SEQ ID NO: 11 or 13 or 35.2. The chimeric antigen receptor of claim 1 , whose antigen binding domain is as follows:{'br': None, 'sub': H', 'L, 'V-V'}{'sub': H', 'L, 'wherein Vis an antibody heavy chain variable region; Vis an antibody light chain variable region; and “-” is a linker peptide or a peptide bond.'}3. The chimeric antigen receptor of claim 2 , wherein the amino acid sequence of Vis as shown in SEQ ID NO: 7 claim 2 , and the amino acid sequence of Vis as shown in SEQ ID NO: 11; or{'sub': H', 'L, 'the amino acid sequence of Vis as shown in SEQ ID NO: 9, and the amino acid sequence of Vis as shown in SEQ ID NO: 13, or'}{'sub': H', 'L, 'the amino acid sequence of Vis as shown in SEQ ID NO: 33, and the amino acid sequence of Vis as shown in SEQ ID NO: 35.'}4. A nucleic acid molecule encoding the chimeric antigen receptor (CAR) of .5. The nucleic acid molecule of claim 4 , which comprises a nucleic acid sequence encoding hinge region selected from the group consisting of:(a) a polynucleotide encoding a polypeptide as shown in SEQ ID NO: 17 or 19;(b) a polynucleotide having a sequence as shown in SEQ ID NO: 18 or 20;(c) a polynucleotide having a nucleotide sequence with ≥90% (preferably ≥95%) homologous to the sequence of SEQ ID NO: 18 or 20 and encoding the amino acid sequence of SEQ ID NO: 17 or 19;(d) a polynucleotide complementary to the polynucleotide of any of (a ...

PD-L1-SPECIFIC ANTIBODIES AND METHODS OF USING THE SAME

The present disclosure relates generally to antibodies and functional binding fragments thereof that bind to programmed death-ligand 1 (PD-L1). In particular, the disclosed antibodies and fragments bind to human PD-L1 and comprise novel complementary determining regions (CDRs) also disclosed herein. Finally, the present disclosure relates to administering the disclosed antibodies and fragments to subjects with cancer, thereby treating or slowing the progression or proliferation of the cancer. 1. An antibody or a functional fragment thereof that binds to human programmed death-ligand 1 (PD-L1) , wherein the antibody or functional fragment thereof comprises:a heavy chain comprising: CDRH1 comprising amino acids 1-3 and 7-9 of SEQ ID NO: 1, wherein amino acids 4-6 are not SSY; CDRH2 comprising amino acids 9-17 of SEQ ID NO: 8; and CDRH3 comprising SEQ ID NO: 15; anda light chain comprising CDRL1 comprising SEQ ID NO: 20; CDRL2 comprising SEQ ID NO: 21; and CDRL3 comprising SEQ ID NO: 22, SEQ ID NO: 75, or SEQ ID NO: 76.2. The antibody or functional fragment thereof according to claim 1 , wherein the CDRH1 region comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 2 claim 1 , 3 claim 1 , 4 claim 1 , 5 claim 1 , 6 and 7.3. The antibody or functional fragment thereof according to claim 1 , wherein the CDRH2 region comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 8 claim 1 , 9 claim 1 , 10 claim 1 , 11 claim 1 , 12 claim 1 , 13 and 14.4. The antibody or functional fragment thereof according to claim 1 , wherein the variable heavy framework region 1 comprises SEQ ID NO. 26.5. The antibody or functional fragment thereof according to claim 1 , wherein the variable heavy framework region 1 comprises SEQ ID NO. 27.6. The antibody or functional fragment thereof according to claim 1 , wherein the variable heavy framework region 2 comprises SEQ ID NO. 28.7. The antibody or functional fragment thereof according to ...

ANTI-CXCR4 ANTIBODIES AND ANTIBODY-DRUG CONJUGATES

The present invention provides antibodies and related molecules that bind to chemokine receptor 4 (CXCR4). The invention further provides antibody-drug conjugates comprising such antibodies, antibody encoding nucleic acids, and methods of obtaining such antibodies. The invention further relates to therapeutic methods for use of these antibodies and anti-CXCR4 antibody-drug conjugates for the treatment of a disorder associated with CXCR4 function or expression (e.g., cancer), such as colon, RCC, esophageal, gastric, head and neck, lung, ovarian, pancreatic cancer or hematological cancers. 139-. (canceled)40. An isolated polynucleotide comprising a nucleotide sequence encoding an antibody , or an antigen binding fragment thereof , that binds to chemokine receptor 4 (CXCR4) and comprises:a) a heavy chain variable (VH) region comprising (i) a VH CDR1 comprising SEQ ID NO:107, 113, or 114; (ii) a VH CDR2 comprising SEQ ID NO: 162 or 128; and (iii) a VH CDR3 comprising SEQ ID NO: 112; and;b) a light chain variable region (VL) region comprising (i) a VL CDR1 comprising SEQ ID NO: 144; (ii) a VL CDR2 comprising 145; and (iii) a VL CDR3 comprising SEQ ID NO: 139.41. A vector comprising the polynucleotide of .42. An isolated host cell that recombinantly produces the antibody or antigen binding fragment thereof of .43. A method of producing an antibody or antigen binding fragment thereof claim 42 , comprising culturing the host cell of under conditions that result in production of the antibody or antigen binding fragment thereof claim 42 , and isolating the antibody or antigen binding fragment thereof from the host cell or culture medium.4454-. (canceled) This application is a Divisional of U.S. application Ser. No. 14/449,478, filed Aug. 1, 2014, which claims the benefit of U.S. Provisional Application No. 61/861,706 filed on Aug. 2, 2013, which is hereby incorporated by reference in its entirety.This application is being filed electronically via EFS-Web and includes an ...

ANTI HUMAN INTERLEUKIN-1 RECEPTOR ACCESSORY PROTEIN (IL1 RAP) ANTIBODIES AND USES THEREOF

The present invention provides an antibody or an antigen-binding fragment thereof with binding specificity for human interleukin-1 receptor accessory protein (IL1RAP) wherein the antibody or antigen-binding fragment is capable of inhibiting the binding of antibody ‘CAN04’ to human IL1RAP. The invention further provides the use of such antibodies or an antigen-binding fragments in the treatment and/or diagnosis of IL-1 associated diseases and conditions, including cancers such as acute myeloid leukemia and melanoma. 1. An antibody or an antigen-binding fragment thereof with binding specificity for human interleukin-1 receptor accessory protein (IL1RAP) wherein the antibody or antigen-binding fragment is capable of inhibiting the binding of reference antibody ‘CAN04’ to human IL1RAP.2. An antibody or antigen-binding fragment thereof according to wherein the antibody or antigen-binding fragment exhibits one or more of the following properties:{'sub': 'D', 'a) a binding affinity (K) for human IL1RAP of 200 pM or greater;'}{'i': 'Macaca fascicularis;', 'b) cross-reactivity with IL1RAP from'}c) an inhibitory action on IL1 signalling;d) capability of inducing ADCC in one or more cancer cell lines (such as a CML, AML and/or melanoma cell line); and/ore) capability of internalisation upon binding to one or more cancer cell lines (such as a CML, AML and/or melanoma cell line).3. An antibody or antigen-binding fragment thereof according to wherein the antibody or antigen-binding fragment exhibits all of the following properties:{'sub': 'D', 'a) a binding affinity (K) for human IL1RAP of 200 pM or greater;'}{'i': 'Macaca fascicularis;', 'b) cross-reactivity with IL1RAP from'}c) an inhibitory action on IL1 signalling;d) capability of inducing ADCC in one or more cancer cell lines (such as a CML, AML and/or melanoma cell line); ande) capability of internalisation upon binding to one or more cancer cell lines (such as a CML, AML and/or melanoma cell line).4. An antibody or antigen ...

ANTIBODIES AGAINST GLUCOCORTICOID-INDUCED TUMOR NECROSIS FACTOR RECEPTOR (GITR) AND USES THEREOF

Provided herein are antibodies, or antigen binding portions thereof, that bind to glucocorticoid-inducible TNF receptor (GITR). Also provided are uses of these proteins in therapeutic applications, such as in the treatment of cancer. Further provided are cells that produce the antibodies, polynucleotides encoding the heavy and/or light chain variable region of the antibodies, and vectors comprising the polynucleotides encoding the heavy and/or light chain variable region of the antibodies. 1. An isolated antibody which binds to human glucocorticoid-inducible TNF receptor (GITR) , comprising:(a) heavy chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 20, 21, and 22, respectively, and light chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 23, 24, and 25, respectively;(b) heavy chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 33, 34, and 35, respectively, and light chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 36, 37, and 38, respectively;(c) heavy chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 46, 47, and 48, respectively, and light chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 49, 50, and 51, respectively;(d) heavy chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 62, 63, and 64, respectively, and light chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 65, 66, and 67, respectively;(e) heavy chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 62, 63, and 64, respectively, and light chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 68, 69, and 70, respectively;(f) heavy chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 78, 79, and 80, respectively, and light chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 81, 82, and 83, respectively;(g) heavy chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 91, 92, and 93, respectively, and light chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 94, 95, and 96, respectively;(h) heavy ...

ANTI-TRANSFERRIN RECEPTOR ANTIBODIES AND METHODS OF USE

The present invention relates to anti-transferrin receptor antibodies and methods of their use. 163.-. (canceled)64. A method of transporting a compound across the BBB in a subject comprising exposing an antibody coupled to the compound to the BBB such that the antibody transports the compound coupled thereto across the BBB , wherein the antibody binds to human transferrin receptor (TfR) and comprises an HVR-H1 comprising the amino acid sequence of SEQ ID NO: 53 , HVR-H2 comprising the amino acid sequence of SEQ ID NO: 156 , HVR-H3 comprising the amino acid sequence of SEQ ID NO: 55 , HVR-L1 comprising the amino acid sequence of SEQ ID NO: 50 , HVR-L2 comprising the amino acid sequence of SEQ ID NO: 51 , and HVR-L3 comprising the amino acid sequence of SEQ ID NO: 52.65. A method of increasing exposure of the CNS of a subject to a compound , comprising exposing an antibody coupled to the compound to the BBB such that the antibody transports the compound coupled thereto across the BBB , wherein the antibody binds to human transferrin receptor (TfR) and comprises an HVR-H1 comprising the amino acid sequence of SEQ ID NO: 53 , HVR-H2 comprising the amino acid sequence of SEQ ID NO: 156 , HVR-H3 comprising the amino acid sequence of SEQ ID NO: 55 , HVR-L1 comprising the amino acid sequence of SEQ ID NO: 50 , HVR-L2 comprising the amino acid sequence of SEQ ID NO: 51 , and HVR-L3 comprising the amino acid sequence of SEQ ID NO: 52.66. A method of increasing retention in the CNS of a compound administered to a subject , comprising exposing an antibody coupled to the compound to the BBB such that the retention in the CNS of the compound is increased , wherein the antibody binds to human transferrin receptor (TfR) and comprises an HVR-H1 comprising the amino acid sequence of SEQ ID NO: 53 , HVR-H2 comprising the amino acid sequence of SEQ ID NO: 156 , HVR-H3 comprising the amino acid sequence of SEQ ID NO: 55 , HVR-L1 comprising the amino acid sequence of SEQ ID NO: 50 , HVR ...

Methods of Using Interleukin-10 for Treating Diseases and Disorders

Methods of treating subjects having a proliferative disease, disorder, or condition, including cancer, via the administration of an IL-10 agent, including pegylated IL-10, in combination with an antibody capable of inducing anti-body-dependent cell-mediated cytotoxicity, are provided. 1. A method of treating or preventing a proliferative disease , disorder or condition in a subject , comprising administering to the subject:a) an antibody capable of inducing antibody-dependent cell-mediated cytotoxicity (ADCC), andb) an IL-10 agent in an amount sufficient to induce IL-18 in the serum.2. A method of treating or preventing a proliferative disease , disorder or condition in a subject , comprising administering to the subject:a) an antibody capable of inducing ADCC, and wherein the mean IL-10 serum trough concentration is at least 1.0 ng/mL, and', 'wherein the mean IL-10 serum trough concentration is maintained for at least 90% of the period of time., 'b) an IL-10 agent in an amount sufficient to induce IL-18 in the serum and to maintain a mean IL-10 serum trough concentration over a period of time; and'}3. The method of claim 2 , wherein the mean IL-10 serum trough concentration is at least 1.5 ng/mL.4. The method of claim 3 , wherein the mean IL-10 serum trough concentration is at least 2.0 ng/mL.5. The method of any one of - claim 3 , wherein the period of time is at least 24 hours.6. The method of claim 5 , wherein the period of time is at least 48 hours.7. The method of claim 6 , wherein the period of time is at least 1 week.8. The method of any one of - claim 6 , wherein the mean IL-10 serum trough concentration is maintained for at least 95% of the period of time.9. The method of claim 8 , wherein the mean IL-10 serum trough concentration is maintained for 100% of the period of time.10. The method of any one of - claim 8 , wherein the IL-10 agent is mature human IL-10.11. The method of any one of - claim 8 , wherein the IL-10 agent is a variant of mature human IL- ...

HUMANIZED ANTI-TROP-2 MONOCLONAL ANTIBODIES AND USES THEREOF

The present invention refers to humanized anti-Trop-2 antibodies and their fragments, derivatives and conjugates that are able to recognise and bind with high affinity distinct regions of the Trop-2 molecule. The present invention also teaches the use of such antibodies and of pharmaceutical compositions thereof for diagnosis and therapy of human pathologies, in particular cancer. 1. A humanized antibody , or fragments , derivatives or conjugates thereof , which recognizes and binds the same epitopes or epitope as the antibody 2EF produced by the hybridoma deposited in the Advanced Biotechnology Center (ABC) with the number PD 08021 or as the antibody 2G10 produced by the hybridoma deposited in the Advanced Biotechnology Center (ABC) with the number PD 08020.2. The humanized antibody claim 1 , or fragments claim 1 , derivatives or conjugates thereof according to claim 1 , comprising a variable domain framework region from a heavy chain of a human antibody or from a human consensus framework and/or a variable domain framework region from a light chain of a human antibody or from a human consensus framework.3. The humanized antibody claim 1 , or fragments claim 1 , derivatives or conjugates thereof according to claim 1 , wherein:said heavy chain of a human antibody or human consensus framework is at least 50% homologue to the heavy chain of said antibody 2EF or of said antibody 2G10; and/orsaid light chain of a human antibody or human consensus framework is at least 50% homologue to the light chain of said antibody 2EF or of said antibody 2G10.4. The humanized antibody claim 2 , or fragments claim 2 , derivatives or conjugates thereof according to claim 2 , wherein in said variable domain framework region an amino acid is substituted with the corresponding residue from a heavy chain of a mouse antibody or mouse consensus framework and/or from a light chain of a mouse antibody or mouse consensus framework claim 2 , or fragments claim 2 , derivatives or conjugates ...

HUMAN NEUTRALIZING ANTIBODIES BINDING TO INFLUENZA B NEURAMINIDASE

The present invention provides influenza neuraminidase (NA)-binding human antibodies, which are capable of specifically binding to and neutralizing at least one influenza B virus strain from the B/Victoria lineage and/or at least one influenza B virus strain from the B/Yamagata lineage, as well as antigen-binding fragment thereof. The invention furthermore relates to the use of said antibodies or antigen-binding fragments in the diagnosis, prophylaxis and/or treatment of influenza infection. 15-. (canceled)6. A neuraminidase (NA)-binding human antibody or antigen-binding fragment thereof , wherein the antibody or antigen-binding fragment thereof is capable of specifically binding to and neutralizing at least one influenza B virus strain from the B/Victoria lineage and/or at least one influenza B virus strain from the B/Yamagata lineage , and wherein the antibody or antigen-binding fragment thereof is selected from the group consisting of:a) an antibody or antigen-binding fragment thereof comprising a heavy chain CDR1 sequence of SEQ ID NO:1, a heavy chain CDR2 sequence of SEQ ID NO:2, and a heavy chain CDR3 sequence of SEQ ID NO:3,b) an antibody or antigen-binding fragment thereof comprising a heavy chain CDR1 sequence of SEQ ID NO:4, a heavy chain CDR2 sequence of SEQ ID NO:5, and a heavy chain CDR3 sequence of SEQ ID NO:6, andc) an antibody or antigen-binding fragment thereof comprising a heavy chain CDR1 sequence of SEQ ID NO:7, a heavy chain CDR2 sequence of SEQ ID NO:8, and a heavy chain CDR3 sequence of SEQ ID NO:9.7. A neuraminidase (NA)-binding human antibody or antigen-binding fragment thereof , wherein the antibody or antigen-binding fragment thereof is capable of specifically binding to and neutralizing at least one influenza B virus strain from the B/Victoria lineage and/or at least one influenza B virus strain from the B/Yamagata lineage , and wherein the antibody or antigen-binding fragment thereof is selected from the group consisting of:a) an ...

MONOCLONAL ANTIBODIES WITH ENHANCED ADCC FUNCTION

The invention concerns a method for obtaining and selecting monoclonal antibodies by an ADDC-type test, said antibodies capable of activating type III Fcy receptors and having a particular glycan structure. The inventive anti-D antibodies can be used for preventing Rhesus isoimmunisation in Rh negative persons, in particular for haemolytic disease in a new-born baby of for uses such as idiopathic thrombocytopenic pupura 9ITP) 118.-. (canceled)19. A monoclonal antibody composition comprising purified monoclonal antibodies having on the Fcγ glycosylation site (Asn 297 , EU numbering) bi-antennary glycan structures ,wherein said glycan structures of the purified monoclonal antibodies have a fucose content less than 55%.20. The composition of claim 19 , wherein said glycan structures of the purified monoclonal antibodies have a fucose content of less than 50%.21. The composition of claim 20 , wherein said glycan structures of the purified monoclonal antibodies have a fucose content of less than 45%.22. The composition of claim 21 , wherein said glycan structures of the purified monoclonal antibodies have a fucose content of less than 40%.23. The composition of claim 22 , wherein said glycan structures of the purified monoclonal antibodies have a fucose content of less than 25%.24. The composition of claim 23 , wherein said glycan structures of the purified monoclonal antibodies have a fucose content of less than 20%.25. The composition of claim 19 , wherein said glycan structures of the purified monoclonal antibodies have a fucose content of 45% to 55%.26. The composition of claim 25 , wherein said glycan structures of the purified monoclonal antibodies have a fucose content of 50% to 55%.27. The composition of claim 19 , wherein the purified monoclonal antibodies are directed against rhesus D.28. The composition of claim 19 , wherein the purified monoclonal antibodies are directed against an infectious disease antigen.29. The composition of claim 19 , wherein the ...

ANTI-FOLATE RECEPTOR 1 ANTIBODIES AND USES THEREOF

Anti-FOLR1 antibodies and antigen-binding fragments thereof are described. Also described are nucleic acids encoding the antibodies, compositions comprising the antibodies, methods of producing the antibodies, and methods of using the antibodies for treating or preventing diseases, such as cancer. 2. (canceled)3. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1 , comprising a heavy chain variable region having a polypeptide sequence at least 95% claim 1 , at least 96% claim 1 , at least 97% claim 1 , at least 98% claim 1 , or at least 99% identical to SEQ ID NO: 120 9 15 claim 1 , 1 claim 1 , 3 claim 1 , 5 claim 1 , 7 claim 1 , 11 claim 1 , 13 claim 1 , 113 claim 1 , 114 claim 1 , 115 claim 1 , 116 claim 1 , 119 claim 1 , 124 claim 1 , 128 claim 1 , 129 claim 1 , or 130 claim 1 , or a light chain variable region having a polypeptide sequence at least 95% claim 1 , at least 96% claim 1 , at least 97% claim 1 , at least 98% claim 1 , or at least 99% identical to SEQ ID NO: 120 claim 1 , 10 claim 1 , 16 claim 1 , 2 claim 1 , 4 claim 1 , 6 claim 1 , 8 claim 1 , 12 claim 1 , 14 claim 1 , 117 118 claim 1 , 121 claim 1 , 123 claim 1 , 126 claim 1 , 127 claim 1 , 131 claim 1 , 132 claim 1 , 133 claim 1 , or 134.4. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1 , comprising:a. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:120, and a light chain variable region having the polypeptide sequence of SEQ ID NO:122;b. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:9, and a light chain variable region having the polypeptide sequence of SEQ ID NO:10;c. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:15, and a light chain variable region having the polypeptide sequence of SEQ ID NO:16;d. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:1, and a light chain variable region having the polypeptide sequence of SEQ ID ...

Humanized monoclonal antibodies and methods of use for the diagnosis and treatment of colon and pancreas cancer

This invention relates to humanized antibodies that selectively bind the 31.1 epitope on the A33 protein differentially expressed in cancers including, lung cancer, ovarian cancer, pancreas cancer, breast cancer, and colon cancer, and diagnostic and therapeutic usages.

ANTIBODIES SPECIFIC FOR TROP-2 AND THEIR USES

The present invention provides antibodies that specifically bind to trophoblast cell-surface antigen-2 (Trop-2). The invention further provides antibody conjugates comprising such antibodies, antibody encoding nucleic acids, and methods of obtaining such antibodies. The invention further relates to therapeutic methods for use of these antibodies and Trop-2 antibody conjugates for the treatment of a condition associated with Trop-2 expression (e.g., cancer), such as colon, esophageal, gastric, head and neck, lung, ovarian, or pancreatic cancer. 1. An isolated polynucleotide comprising a nucleotide sequence encoding an antibody which specifically binds to Trop-2 , wherein the antibody comprises{'sub': 1', '2', '1', '2', 'i', '1', '1', '1, '(a) a heavy chain variable (VH) region comprising (i) a VH complementarity determining region one (CDR1) comprising the sequence SYWIN (SEQ ID NO: 40), GYTFTSY (SEQ ID NO: 41), or GYTFTSYWIN (SEQ ID NO: 42); (ii) a VH CDR2 comprising the sequence NIXPSDSYSNYNXKFKD wherein Xis Y or F; Xis Q or K (SEQ ID NO: 51), or XPSDSY wherein Xis Y or F (SEQ ID NO: 52); and iii) a VH CDR3 comprising the sequence GSXFDY wherein Xis S or G (SEQ ID NO: 53); and'}{'sub': 1', '2', '1', '2, '(b) a light chain variable region (VL) region comprising (i) a VL CDR1 comprising the sequence RASQTIGTSIH (SEQ ID NO: 59); (ii) a VL CDR2 comprising the sequence YASESIS (SEQ ID NO: 60); and (iii) a VL CDR3 comprising the sequence XQSXSWPFT wherein Xis Q or S; Xis N or F (SEQ ID NO:64).'}2. An isolated polynucleotide comprising a nucleotide sequence encoding an antibody which specifically binds to Trop-2 , wherein the antibody comprises:a VH region comprising a VH CDR1, VH CDR2, and VH CDR3 of the VH sequence shown in SEQ ID NO: 13; anda VL region comprising VL CDR1, VL CDR2, and VL CDR3 of the VL sequence shown in SEQ ID NO: 12.3. The isolated polynucleotide of claim 2 , wherein the VH region comprises (i) a VH CDR1 comprising the sequence SYWIN (SEQ ID NO: 40) ...

Methods and compositions for targeting treg cells

The antibody NEO-201 is shown to bind to Treg cells, and its use in targeting Treg cells is described. NEO-201 may be used for isolation, detection, or purification of active Treg cells and also to kill Treg cells. Therapeutic methods and combination therapies using NEO-201 optionally in combination with another agent are described.

PROCESS FOR PRODUCING HU14.18K322A MONOCLONAL ANTIBODY

A fed-batch process for producing Hu14.18K322A monoclonal antibody by culturing a mammalian cell culture in a culture medium including plant protein hydrolysates and a stable glucose concentration is provided, wherein said method yields a population of Hu14.18K322A monoclonal antibodies with increased titer and percentage of afucosylation. 1: A fed-batch process for producing Hu14.18K322A monoclonal antibody in mammalian host cell culture comprising culturing mammalian host cells , which harbor a nucleic acid encoding Hu14.18K322A monoclonal antibody and are selected for producing substantially afucosylated Hu14.18K322A monoclonal antibody , in a cell culture medium comprising plant protein hydrolysates and a stable glucose concentration of 0.5 g/L to 1.5 g/L , thereby producing Hu14.18K322A monoclonal antibody in mammalian cell culture.2: The fed-batch process of claim 1 , further comprising the step of purifying the Hu14.18K322A monoclonal antibody.3: The fed-batch process of claim 2 , wherein the Hu14.18K322A monoclonal antibody is purified by contacting the cell culture medium comprising the Hu14.18K322A monoclonal antibody with a protein A resin and eluting the Hu14.18K322A monoclonal antibody.4: The fed-batch process of claim 1 , wherein the Hu14.18K322A monoclonal antibody is at least 55% afucosylated.5: A population of substantially afucosylated Hu14.18K322A monoclonal antibodies produced by the method of .6: The population of substantially afucosylated Hu14.18K322A monoclonal antibodies of claim 5 , wherein said antibodies are at least 55% afucosylated.7: The population of Hu14.18K322A monoclonal antibodies of claim 5 , wherein said population has an antibody titer of at least about 400 mg/L.8: The population of Hu14.18K322A monoclonal antibodies of claim 5 , wherein said Hu14.18K322A monoclonal antibodies exhibit enhanced ADCC activity.9: A pharmaceutical composition comprising the population of Hu14.18K322A monoclonal antibodies of in admixture with a ...

ANTIBODY THERAPEUTICS THAT BIND CD123

There is disclosed compositions and methods relating to or derived from anti-CD123 antibodies. More specifically, there is disclosed fully human antibodies that bind CD123, CD123-antibody binding fragments and derivatives of such antibodies, and CD123-binding polypeptides comprising such fragments. Further still, there is disclosed nucleic acids encoding such antibodies, antibody fragments and derivatives and polypeptides, cells comprising such polynucleotides, methods of making such antibodies, antibody fragments and derivatives and polypeptides, and methods of using such antibodies, antibody fragments and derivatives and polypeptides, including methods of treating a disease. 1. A fully human antibody of an IgG class that binds to a CD123 epitope that has a heavy chain variable domain sequence that is at least 95% identical to the amino acid sequences selected from the group consisting of SEQ ID NO. 1 , SEQ ID NO. 3 , SEQ ID NO. 5 , SEQ ID NO. 7 , SEQ ID NO. 9 or , SEQ ID NO. 11 , SEQ ID NO. 13 , SEQ ID NO. 15 , SEQ ID NO. 17 , SEQ ID NO. 19 , SEQ ID NO. 21 , SEQ ID NO. 23 , SEQ ID NO. 25 , SEQ ID NO. 27 , and combinations thereof , and that has a light chain variable domain that is at least 95% identical to the amino acid sequence of SEQ ID NO. 2 , SEQ ID NO. 4 , SEQ ID NO. 6 , SEQ ID NO. 8 , SEQ ID NO. 10 or , SEQ ID NO. 12 , SEQ ID NO. 14 , SEQ ID NO. 16 , SEQ ID NO. 18 , SEQ ID NO. 20 , SEQ ID NO. 22 , SEQ ID NO. 24 , SEQ ID NO. 26 , SEQ ID NO. 28 , and combinations thereof.212-. (canceled) This application claims priority to U.S. Provisional Application 62/144,899, filed on Apr. 8, 2015, the entire contents of which are incorporated by reference in their entirety herein.The present disclosure provides compositions and methods relating to or derived from anti-CD123 antibodies. More specifically, the present disclosure provides fully human antibodies that bind CD123, CD123-antibody binding fragments and derivatives of such antibodies, and CD123-binding ...

SCREENING FOR ANTI-CANCER COMPOUNDS USING NETRIN-1 ACTIVITY

The subject matter of the present invention relates to an in vitro method for the screening of anti-cancer compounds based on the capacity for these compound to interact with netrin-1 receptor and/or to inhibit the dimerization of the intracellular domain of the netrin-1 receptor expressed in tumor cells. The invention also relates to a method for predicting the presence of metastatic or aggressive cancer, or for determining the efficiency of an anti-cancer treatment based on the measuring of the expression level of netrin-1. The invention further comprises kits and compounds as a medicament for the treatment of cancer such as metastatic breast cancer, related to the overexpression of netrin-1 by the tumor cells. 138.-. (canceled)39. A method of treatment for inducing the apoptosis or the cell death of tumor cells which has acquired the selective advantage to escape netrin-1 dependence receptors induced apoptosis by elevated netrin-1 level , in a patient having such tumor cells , comprisingadministering to said patient an effective amount of a monoclonal or polyclonal antibody directed specifically against netrin-1, a netrin-1 receptor or an extracellular domain of a netrin-1 receptor, which antibody specifically inhibits the interaction between the netrin-1 and a netrin-1 receptor and/or the dimerization or multimerization of a netrin-1 receptor or of the intracellular domain of a netrin-1 receptor.40. The method of claim 39 , comprising the step of identifying a patient suffering from a cancer having tumoral cells expressing or overexpressing netrin 1.41. The method of claim 39 , wherein the antibody is a chimeric antibody or a humanized antibody.42. The method of claim 39 , comprising administering to said patient an effective amount of a monoclonal or polyclonal antibody directed specifically against netrin-1.43. The method of claim 42 , wherein the antibody is a chimeric antibody or a humanized antibody.44. The method of claim 39 , wherein the netrin-1 receptor ...

Anti-garp antibody

The present invention relates to an antibody that binds to GARP and is useful as a therapeutic agent for a tumor, and a method for treating a tumor using the aforementioned antibody. It is an object of the present invention to provide an antibody, which inhibits the function of Treg in a tumor and is thereby used as a pharmaceutical product having therapeutic effects, a method for treating a tumor using the aforementioned antibody, and the like. An anti-GARP antibody that binds to GARP and exhibits inhibitory activity to Treg function and exhibits ADCC activity is obtained, and moreover a pharmaceutical composition for use in tumor therapy, comprising the aforementioned antibody, etc. is obtained.

ANTI-TNFR2 ANTIBODY AND USE THEREOF

An antibody or an antigen-binding fragment thereof capable of specifically binding to TNFR2, the antibody or the antigen-binding fragment thereof is capable of regulating the function of immune cells and may be used as a medicament to treat diseases related to immune-related disorders, such as tumors. 1. An antibody or antigen binding fragment thereof which specifically binds to TNFR2 , and which is capable of regulating function of immune cells and be used as a drug to treat diseases related to immune abnormalities , such as tumors.2. The antibody or antigen binding fragment thereof of claim 1 , wherein the regulating comprises inhibiting proliferation and/or activation of regulatory T cells (Treg cells) and/or myeloid derived suppressor cells (MDSC).3. The antibody or antigen binding fragment thereof of claim 1 , wherein the regulating is achieved by blocking the binding of TNF to TNFR2.5. The antibody or antigen binding fragment thereof of claim 4 , comprising a combination of the heavy chain CDRs and light chain CDRs selected from the group consisting of VH1+VL1 claim 4 , VH2+VL2 claim 4 , VH3+VL3 claim 4 , VH4+VL4 claim 4 , VH5+VL5 claim 4 , VH6+VL6 claim 4 , VH7+VL7 claim 4 , VH8+VL8 claim 4 , VH9+VL9 claim 4 , VH10+VL10 claim 4 , VH11+VL11 claim 4 , VH12+VL12 claim 4 , VH13+VL13 claim 4 , VH14+VL14 claim 4 , VH15+VL15 claim 4 , VH16+VL16 claim 4 , VH17+VL17 claim 4 , VH18+VL18 claim 4 , VH19+VL19 claim 4 , VH20+VL20 claim 4 , VH21+VL21 and VH22+VL22 claim 4 , and CDR combinations having 1 claim 4 , 2 claim 4 , 3 or more amino acid insertions claim 4 , deletions and/or substitutions compared with the combination of the heavy chain CDR and light chain CDR.6. The antibody or antigen binding fragment thereof of claim 4 , wherein1) a heavy chain variable region and a light chain variable region have the sequence shown in SEQ ID NO: 1 and SEQ ID NO: 2, respectively, or the sequence having 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or higher consistency with ...

Engineered Antibody Constant Regions for Site-Specific Conjugation and Methods and Uses Therefor

The present invention is directed to antibodies, and antigen-binding portions thereof, engineered to introduce amino acids for site-specific conjugation. The invention relates to engineered antibody constant region (Fc, Cγ, Cκ, and Cλ) polypeptides, and portions thereof, and antibodies comprising the polypeptides. Further, the invention relates to Fc fusion proteins comprising an engineered Fc region. The invention also relates to methods and uses of the engineered antibodies and portions for, among other things, production of antibody-drug conjugate therapeutics. 1. An engineered antibody constant domain polypeptide , or a portion thereof , wherein the engineered constant domain comprises at least one amino acid substitution to introduce a cysteine residue useful for conjugation , and wherein the constant domain polypeptide is selected from the group consisting of:(a) an engineered human IgG heavy chain constant domain (Cγ) polypeptide, or portion thereof, comprising at least one amino acid substitution selected from the group consisting of K246, D249, D265, 5267, D270, N276, Y278, E283, R292, E293, E294, Y300, V302, V303, L314, N315, E318, K320, I332, E333, K334, 1336, E345, Q347, 5354, R355, M358, K360, Q362, K370, Y373, D376, A378, E380, E382, Q386, E388, N390, K392, T393, D401, F404, T411, D413, K414, R416, Q418, Q419, N421, M428, A431, L432, T437, Q438, K439, L443, and S444, According to the EU Index of Kabat;(b) an engineered human lambda light chain constant domain (Cλ) polypeptide, or portion thereof, comprising at least one amino acid substitution selected from the group consisting of K110, A111, L125, K149C, V155, G158, T161, Q185, 5188, H189, 5191, T197, V205, E206, K207, T208 and A210, according to the numbering of Kabat;(c) an engineered human kappa light chain constant domain (Cκ) polypeptide, or portion thereof, comprising at least one amino acid substitution selected from the group consisting of A111, K183, and N210, according to the numbering of ...

Anti-CD38 Antibodies for Treatment of Light Chain Amyloidosis and Other CD28-Positive Hematological Malignancies

The present invention relates to methods of treatment of light chain amyloidosis and other CD38-positive hematological malignancies with anti-CD38 antibodies. 1. A method of treating a patient having light chain amyloidosis (AL) , comprising administering to the patient in need thereof an anti-CD38 antibody for a time sufficient to treat AL.2. The method of claim 1 , wherein the patient is resistant to treatment with a proteasome inhibitor claim 1 , cyclophosphamide and/or a corticosteroid.3. The method of claim 2 , wherein the proteasome inhibitor is Velcade® (bortezomib).4. The method of claim 2 , wherein the corticosteroid is dexamethasone.5. The method of claim 1 , wherein the anti-CD38 antibody is administered in combination with a second therapeutic agent.6. The method of claim 2 , wherein the anti-CD38 antibody is administered in combination with a second therapeutic agent.7. The method of claim 5 , wherein the second therapeutic agent is a proteasome inhibitor claim 5 , cyclophosphamide or a corticosteroid.8. The method of claim 7 , wherein the proteasome inhibitor is Velcade® (bortezomib) or NINLARO® (ixazomib).9. The method of claim 7 , wherein the corticosteroid is dexamethasone.10. The method of claim 5 , wherein the second therapeutic agent is Velcade® (bortezomib) claim 5 , NINLARO® (ixazomib) claim 5 , Kyprolis® (carfilzomib) claim 5 , Farydak® (panobinostat) claim 5 , cyclophosphamide claim 5 , Alkeran® (melphalan) claim 5 , Thalomid® (thalidomide) claim 5 , Revlimid® (lenalidomide) claim 5 , Pomalyst® (pomalidomide) claim 5 , dexamethasone or interferon alpha.11. The method of claim 1 , wherein the anti-CD38 antibody is administered in combination with a proteasome inhibitor claim 1 , cyclophosphamide and a corticosteroid.12. The method of claim 11 , wherein the proteasome inhibitor is Velcade® (bortezomib).13. The method of claim 11 , wherein the proteasome inhibitor is NINLARO® (ixazomib).14. The method of claim 11 , wherein the corticosteroid is ...

PHARMACEUTICAL COMPOSITION FOR TREATING CANCER

The object of the present invention is to prepare a cancer therapeutic agent by means of a novel monoclonal antibody which binds to SLC6A6 or its extracellular region and a substance which suppresses SLC6A6 expression. 1. A pharmaceutical composition comprising a monoclonal antibody or a fragment thereof , which recognizes native SLC6A6 , or a substance capable of suppressing SLC6A6 expression by RNA interference.2. A pharmaceutical composition comprising a monoclonal antibody or a fragment thereof , which recognizes a polypeptide in the extracellular region of SLC6A6.3. The pharmaceutical composition according to claim 2 , wherein the polypeptide in the extracellular region is at least one selected from (a) to (c) shown below:(a) a polypeptide which consists of the amino acid sequence shown in SEQ ID NO: 4;(b) a polypeptide which consists of an amino acid sequence with substitution, deletion and/or insertion of one or several amino acids in the amino acid sequence shown in SEQ ID NO: 4 and which serves as an extracellular region of SLC6A6; and(c) a polypeptide which consists of an amino acid sequence sharing a homology of 70% or more with the amino acid sequence shown in SEQ ID NO: 4 and which serves as an extracellular region of SLC6A6.4. A pharmaceutical composition comprising a monoclonal antibody against SLC6A6 or a fragment thereof claim 2 , which is produced by a hybridoma having Accession No. FERM BP-11413 or FERM BP-11414.5. A pharmaceutical composition comprising a monoclonal antibody against SLC6A6 or a fragment thereof claim 4 , which binds to an epitope recognized by the monoclonal antibody or fragment thereof according to .6. The pharmaceutical composition according to any one of to claim 4 , wherein the monoclonal antibody is human or humanized.7. The pharmaceutical composition according to any one of to claim 4 , wherein the monoclonal antibody is fused.8. The pharmaceutical composition according to claim 1 , which is intended for treatment of ...

Therapeutic methods using anti-cd200 antibodies

The present disclosure relates to anti-CD200 antibodies and to use of the antibodies in methods for treating autoimmune disorders and cancer. Also featured are biomarkers for use in selecting or prescribing a treatment modality for a patient with an autoimmune disorder and/or cancer. In addition, the disclosure features methods of treatment using an anti-CD200 antibody in combination with one or more additional therapeutic agents such as an anti-CD20 therapeutic agent.

Erythropoietin Analogs For Veterinary Use

Provided are various embodiments relating to erythropoietin (EPO) polypeptide analogs with one or more additional glycosylation sites and/or additional cysteine residues and methods of producing and using the same to treat anemia in companion animals. Also provided are various embodiments relating to polypeptides comprising an extracellular domain of EPO receptor and methods of using the same for treating polycythemia in mammals. 1. An erythropoietin (EPO) polypeptide comprising the amino acid sequence of SEQ ID NO: 1 , SEQ ID NO: 2 , SEQ ID NO: 3 , SEQ ID NO: 4 , SEQ ID NO: 7 , or SEQ ID NO: 8 , except for the presence of at least one N-linked glycosylation site not present in SEQ ID NO: 1 , SEQ ID NO: 2 , SEQ ID NO: 3 , SEQ ID NO: 4 , SEQ ID NO: 7 , or SEQ ID NO: 8 , wherein the N-linked glycosylation site comprises the sequence asparagine-xaa-serine or asparagine-xaa-threonine , wherein xaa is any amino acid except proline , and wherein one N-linked glycosylation site does not overlap with another N-linked glycosylation site.2. The EPO polypeptide of claim 1 , wherein each of the at least one N-linked glycosylation sites is present at:a) a position selected from position 47-49, 55-57, 56-58, 60-62, 61-63, 79-81, 81-83, 82-84, 91-93, 92-94, 97-99, 98-100, 99-101, 112-114, 113-115, 114-116, 115-117, 116-118, 137-139, 138-140, 140-142, 141-143, 142-144, 143-145, 144-146, 145-147, 146-148, 147-149, 148-150, 149-151, 150-152, 161-163, 162-164, 184-186, and 186-188 of SEQ ID NO: 1, SEQ ID NO: 3, or SEQ ID NO: 7; orb) a position selected from position 21-23, 29-31, 30-32, 34-36, 35-37, 53-55, 55-57, 56-58, 65-67, 66-68, 71-73, 72-74, 73-75, 86-88, 87-89, 88-90, 89-91, 90-92, 111-113, 112-114, 114-116, 115-117, 116-118, 117-119, 118-120, 119-121, 120-122, 121-123, 122-124, 123-125, 124-126, 135-137, 136-138, 158-160, and 162-164 of SEQ ID NO: 2, or SEQ ID NO: 4, or SEQ ID NO: 8.3. The EPO polypeptide of or comprising an amino acid except proline at a position ...

ANTI-FGFR2 ANTIBODY

The present invention provides an antibody which binds to a fibroblast growth factor receptor. 1. An antibody or a functional fragment thereof that binds to a human fibroblast growth factor receptor (FGFR) , wherein the antibody or functional fragment thereof comprisesa heavy chain comprising CDRH1 comprising SEQ ID NO: 58; CDRH2 comprising SEQ ID NO: 59; and a CDRH3 comprising amino acids 3-9 of SEQ ID NO: 60; anda light chain comprising CDRL1 comprising SEQ ID NO: 67; CDRL2 comprising SEQ ID NO: 68; and CDRL3 comprising SEQ ID NO: 69.2. The antibody or functional fragment thereof according to claim 1 , wherein the CDRH3 region comprises amino acids 118-126 of an amino acid sequence selected from the group consisting of SEQ ID NOS: 97 claim 1 , 89 claim 1 , 91 claim 1 , 95 and 83.3. The antibody or functional fragment thereof according to claim 2 , wherein the antibody or functional fragment thereof is humanized.4. The antibody or functional fragment thereof according to claim 2 , wherein the heavy chain variable region comprises amino acids 20-137 of an amino acid sequence selected from the group consisting of SEQ ID NOS: 97 claim 2 , 89 claim 2 , 91 claim 2 , 95 and 83.5. The antibody or functional fragment thereof according to claim 2 , wherein the light chain variable region comprises amino acids 21-130 of SEQ ID NO: 73.6. The antibody or functional fragment thereof according to claim 2 , wherein the heavy chain comprises amino acids 20-467 of an amino acid sequence selected from the group consisting of SEQ ID NOS: 97 claim 2 , 89 claim 2 , 91 claim 2 , 95 and 83.7. The antibody or functional fragment thereof according to claim 2 , wherein the light chain comprises amino acids 21-235 of SEQ ID NO: 73.8. The antibody or functional fragment thereof according to claim 2 , wherein the antibody comprises a heavy chain amino acid sequence encoded by a nucleotide sequence selected from the group consisting of SEQ IDS NO: 96 claim 2 , 88 claim 2 , 90 claim 2 , 94 and ...

LEUCOCYTE IMMUNOGLOBULIN-LIKE RECEPTOR NEUTRALIZING ANTIBODIES

This invention relates to agents that bind and neutralize the inhibitory activity of human ILT2 proteins having inhibitory activity in NK cells, T cells and/or other immune cells. Such agents can be used for the treatment of cancers or infectious disease. 157-. (canceled)58. A monoclonal antibody or antibody fragment that specifically binds to a human ILT2 polypeptide and is capable of enhancing the cytotoxicity of NK cells in a cytotoxicity assay in which NK cells that express ILT2 are purified from human donors and incubated with target cells that express at their surface HLA-G polypeptides , wherein the antibody comprises:a HCDR1 region (Kabat positions 31-35) of 2H2B comprising an amino acid sequence NYYMQ (SEQ ID NO: 139), optionally wherein one, two or three of these amino acids may be substituted by a different amino acid, optionally wherein the HCDR1 comprises an amino acid substitution at Kabat position 32, 33, 34 and/or 35, optionally wherein the HCDR1 comprises at least two aromatic residues (Y, H or F) at Kabat position 32, 33, 34 and/or 35, optionally wherein the HCDR1 comprises an aromatic residue (Y, H or F) at Kabat position 32 and/or an aromatic residue (Y, H or F), N or Q at 35;a HCDR2 region (Kabat positions 50-65) of 2H2B comprising an amino acid sequence WIFPGSGESSYNEKFKG (SEQ ID NO: 140) or WIFPGSGESNYNEKFKG (SEQ ID NO: 161), optionally wherein one, two or three of these amino acids may be substituted by a different amino acid, optionally wherein the HCDR2 comprises an amino acid substitution at Kabat position 52A, 54, 55, 56, 57, 58, 60 and/or 65, optionally wherein the residue at 52A is P or L, optionally wherein the residue at 54 is G, S, N or T, optionally wherein the residue at 55 is G, N or Y, optionally wherein the residue at 56 is E or D, optionally wherein the residue at 57 is S or T, optionally wherein the residue at 58 is S, K or N, optionally wherein the residue at 60 is N or S, optionally wherein the residue at 65 is G or V;a HCDR3 ...

METHODS AND PHARMACEUTICAL COMPOSITIONS FOR THE TREATMENT OF ACUTE MYELOID LEUKEMIA BY ERADICATING LEUKEMIC STEM CELLS

After intensive chemotherapy, the emergence of cells with dmg resistant and/or stem cell features might explain frequent relapses and the poor outcome of patients with acute myeloid leukemia (AML). Herein the inventors first uncovered that the adrenomedullin receptor CALCRL is overexpressed in AML patients comparing with normal cells and preferentially in the immature CD34 CD38 compartment. Then they demonstrated its role in the maintenance of leukemic stem cell function in vivo. Moreover, CALCRL depletion strongly affected leukemic growth in xenograft models and sensitized to chemotherapeutic agent cytarabine in vivo. It Accordingly, the inventors showed that ADM-CALCRL axis drove cell cycle, DNA integrity, and high OxPHOS status of chemoresistant AML stem cells in an E2F1- and BCL2-dependent manner. Furthermore, CALCRL depletion sensitizes cells to cytarabine and its CT expression predicted the response to chemotherapy in vivo in mice. Further, using the combination of limiting dilution assays, single-cell RNA-seq analysis of primary AMF samples at diagnosis and relapse and before and after transplantation in NSG mice, the inventors revealed the pre-existence of a chemoresistant leukemic stem cell sub-population harboring a CALCRL-driven gene signature. Finally the inventors strongly demonstrated that chemoresistant LSC are dependent for CALCRL. All of these data highlight the critical role of CALCRL in stem cell survival, proliferation and metabolism and identify this receptor as a new marker of chemoresistant leukemic stem cell population and a promising therapeutic target to specifically eradicate them and overcome relapse in AML. 1. A method of depleting leukemic stem cells in a subject suffering from acute myeloid leukemia comprising administering to the subject a therapeutically effective amount of an antibody that specifically binds to CALCRL thereby depleting said leukemic stem cells.2. A method of depleting leukemic stem cells in a subject suffering from ...

BCMA ANTIBODIES AND USE OF SAME TO TREAT CANCER AND IMMUNOLOGICAL DISORDERS

The invention provides humanized antibodies that specifically bind to BCMA. The antibodies are useful for treatment and diagnoses of various cancers and immune disorders as well as detecting BCMA. 16-. (canceled)7. A method for treating a subject with a cancer that expresses human B-cell maturation antigen (BCMA) , the method comprising administering to the subject an effective amount of an antibody or a binding fragment thereof that binds to human BCMA , wherein the antibody or binding fragment comprises a mature heavy chain variable region and a mature light chain variable region , wherein the mature heavy chain variable region comprises complementarity determining regions (CDRs) comprising the amino acid sequences of SEQ ID NOs:60 , 61 and 62 , and the mature light chain variable region comprises CDRs comprising the amino acid sequences of SEQ ID NOs:90 , 91 and 92.8. The method of claim 7 , wherein the mature heavy chain variable region is fused to a heavy chain constant region and the mature light chain variable region is fused to a light chain constant region.9. The method of claim 8 , wherein the heavy chain constant region is a mutant form of a natural human constant region and has reduced binding to an Fcγ receptor relative to the natural human constant region.10. The method of claim 8 , wherein the heavy chain constant region is of immunoglobulin G1 (IgG1) isotype.11. The method of claim 8 , wherein the heavy chain constant region comprises the amino acid sequence of SEQ ID NO:5 and the light chain constant region comprises the amino acid sequence of SEQ ID NO:3.12. The method of claim 7 , wherein the antibody or antibody binding fragment is non-fucosylated.13. The method of claim 7 , wherein the antibody or antibody binding fragment is an antibody binding fragment.14. The method of claim 13 , wherein the antibody binding fragment is selected from the group consisting of a Fab claim 13 , a Fab′ claim 13 , and a F(ab′).15. The method of claim 7 , wherein ...

ANTI-ROR1 ANTIBODIES

The invention relates to antibodies, and in particular, to antibodies exhibiting specificity for Receptor tyrosine kinase-like Orphan Receptors (ROR), and to uses thereof, for example in the treatment of cancer. The invention extends to polynucleotide and polypeptide sequences encoding the antibodies, and therapeutic uses thereof, and to diagnostic kits comprising these molecules. The invention also extends to antibody-drug conjugates and to uses thereof in therapy. 144.-. (canceled)45. A polypeptide capable of binding to Receptor Tyrosine Kinase-Like Orphan Receptor 1 (ROR1) protein , the peptide comprising an amino acid sequence selected from a group consisting of:(i) SEQ ID NO:8, 9, 10, 16, 17 and/or 18;(ii) SEQ ID NO:24, 25, 26, 32, 33 and/or 34;(iii) SEQ ID NO:40, 41, 42, 48, 49 and/or 50;(iv) SEQ ID NO:56, 57, 58, 64, 65 and/or 66;(v) SEQ ID NO:72, 73, 74, 80, 81 and/or 82;(vi) SEQ ID NO:88, 89, 90, 96, 97 and/or 98;(vii) SEQ ID NO:104, 105, 106, 112, 113 and/or 114;(viii) SEQ ID NO:120, 121, 122, 128, 129 and/or 130;(ix) SEQ ID NO:136, 137, 138, 144, 145 and/or 146;(x) SEQ ID NO:152, 153, 154, 160, 161 and/or 162;(xi) SEQ ID NO:168, 169, 170, 176, 177 and/or 178;(xii) SEQ ID NO:184, 185, 186, 192, 193 and/or 194;(xiii) SEQ ID NO:200, 201, 202, 208, 209 and/or 210; and/or(xiv) SEQ ID NO:216, 217, 218, 224, 225 and/or 226.46. The polypeptide of claim 45 , comprising a functional fragment of an anti-ROR1 antibody.47. The polypeptide of claim 46 , comprising an anti-ROR1 scFv.48. The polypeptide of claim 45 , comprising at least two claim 45 , three claim 45 , four claim 45 , five or six amino acid sequences defined in any of (i) to (xiv).49. The polypeptide according to claim 45 , wherein the peptide comprises an amino acid sequence substantially as set out in SEQ ID NO: 4 claim 45 , 20 claim 45 , 36 claim 45 , 52 claim 45 , 68 claim 45 , 84 claim 45 , 100 claim 45 , 116 claim 45 , 132 claim 45 , 148 claim 45 , 164 claim 45 , 180 claim 45 , 196 or 212 claim 45 , ...

ANTI-CD154 ANTIBODIES HAVING IMPAIRED FcR BINDING AND/OR COMPLEMENT BINDING PROPERTIES AND USE IN THERAPY

Improved anti-CD154 antibodies are provided herein which have ablated FcR binding and/or complement binding/activation. The use of these antibodies for inducing tolerance and treating immune diseases including autoimmunity, inflammation and allergic disorders is disclosed herein. 1. A human , chimeric or humanized antibody of the human IgG1 or IgG3 isotype that is specific to human CD154 wherein the Fc region of the antibody is mutated to eliminate or substantially reduce FcR binding in a manner that renders it substantially non-thrombogenic.226.-. (canceled)27. A human or humanized anti-CD154 IgG1 antibody wherein the Fc region thereof comprises an E269R mutation and a K322A mutation and further comprises at least one additional Fc modification which impairs FcR binding and/or impairs complement binding.28. The human or humanized anti-CD154 IgG1 antibody of wherein the additional Fc modification which impairs FcR binding is one which impairs at least one of FcRn claim 27 , FcγRI claim 27 , FcγRIIA or FcγRIIIA binding.29. The human or humanized anti-CD154 IgG1 antibody of wherein the additional Fc modification which impairs FcR binding is selected from the following modifications: E233P claim 27 , D265A claim 27 , D265N claim 27 , D270N claim 27 , N297A claim 27 , S298N claim 27 , P329A claim 27 , D270A claim 27 , K326V claim 27 , V369R claim 27 , F405K claim 27 , L410P claim 27 , V427R claim 27 , L234N claim 27 , G237M claim 27 , S239F claim 27 , V262E claim 27 , V264F claim 27 , V266T claim 27 , S267N claim 27 , N268E claim 27 , N297R claim 27 , T299A claim 27 , R301D claim 27 , N325L claim 27 , N325E and L328R.30. The human or humanized anti-CD154 IgG1 antibody of wherein the additional Fc modification which impairs complement binding comprises P331G or P331G/K322A.31. A composition which comprises a pharmaceutically effective amount of the human or humanized anti-CD154 IgG1 antibody of .32. A composition which comprises a pharmaceutically effective amount of the ...

Optimized antibodies that target cd19

The present invention describes antibodies that target CD19, wherein the antibodies comprise at least one modification relative to a parent antibody, wherein the modification alters affinity to an FcγR or alters effector function as compared to the parent antibody. Also disclosed are methods of using the antibodies of the invention.