Настройки

Укажите год
-

Небесная энциклопедия

Космические корабли и станции, автоматические КА и методы их проектирования, бортовые комплексы управления, системы и средства жизнеобеспечения, особенности технологии производства ракетно-космических систем

Подробнее
-

Мониторинг СМИ

Мониторинг СМИ и социальных сетей. Сканирование интернета, новостных сайтов, специализированных контентных площадок на базе мессенджеров. Гибкие настройки фильтров и первоначальных источников.

Подробнее

Форма поиска

Поддерживает ввод нескольких поисковых фраз (по одной на строку). При поиске обеспечивает поддержку морфологии русского и английского языка
Ведите корректный номера.
Ведите корректный номера.
Ведите корректный номера.
Ведите корректный номера.
Укажите год
Укажите год
Применить Всего найдено 1487. Отображено 100.
23-08-2012 дата публикации

Process for demineralization of bone matrix with preservation of natural growth factors

Номер: US20120213859A1
Автор: Benjamin P. Luchsinger, Darrel L. Holmes, Gregory A. Juda, Jesus Hernandez, Kelly R. Kirker, Nancy J. Shelby, Steven M. Scott
Принадлежит: Bacterin International Inc

A demineralized bone matrix is produced by a process in which a bone body is placed in a first processing solution comprising an acid to demineralize the bone body. The bone body is periodically removed from the first solution at specific time intervals to perform at least one test, such as a compression test, on a mechanical property of the bone body. When the test yields a desired result, the bone body is exposed to a second processing solution that is less acidic than the first, thus minimizing the exposure of the bone body to the harsh acidic conditions of the demineralization phase of the process.

Подробнее
Номер записи: 1
14-02-2013 дата публикации

Phase separated composite

Номер: US20130041044A1
Автор: Joo Eun Chung, Li Shan Wang, Motoichi Kurisawa
Принадлежит: Agency for Science Technology and Research Singapore

A composite is disclosed. The composite comprises a first conjugate of a polymer and a first phenol-containing moiety, and a second conjugate of a gelatin or collagen and a second phenol-containing moiety, wherein the polymer is selected so that the first conjugate is less cell-adhesive than the second conjugate, at least one of the first and second conjugates is crosslinked to form a matrix, and the composite comprises discrete regions that are rich in one of said first and second conjugates. A method of forming such composite is also disclosed. The method comprises mixing precursors for the first and second conjugates in a solution for forming said composite, and dispersing a catalyst in the solution to catalyze crosslinking of at least one of the first and second conjugates to form the matrix. The composite may be used to grow cells.

Подробнее
Номер записи: 2
16-05-2013 дата публикации

Method for Preparing a Degradable Polymer Network

Номер: US20130123384A1
Автор: Dirk Wybe Grijpma, Erhan Bat, Jan Feijen
Принадлежит: Twente Universiteit

The present invention relates to methods for preparing a degradable polymer network. The methods for preparing a degradable polymer network comprise a) preparing a polymer composition comprising monomers of cyclic carbonates and/or cyclic esters and/or linear carbonates and/or linear esters and/or cyclic ethers and/or linear hydroxycarboxylic acids at a temperature between 20° C. and 200° C.; b) adding a cross-linking reagent comprising at least one double or triple C—C bond and/or a cross-linking radical initiator; c) processing the polymer composition (that contains the crosslinking reagentj into a desired shape; d) Crosslinking by irradiating the mixture. Further, the present invention relates to a degradable polymer network. Furthermore, the present invention relates to the use of the degradable polymer network.

Подробнее
Номер записи: 3
13-06-2013 дата публикации

Thermally Induced Gelation Of Collagen Hydrogel And Method Of Thermally Inducing Gelling A Collagen Hydrogel

Номер: US20130149782A1
Автор: Albert J. Banes, Jie Qi, Mari Tsuzaki
Принадлежит: MedTrain Technologies LLC

The present invention relates to collagen hydrogels. Particularly, the invention relates to hydrogels comprising a telopeptide collagen (“telo-collagen”) and an atelopeptide collagen (“atelo-collagen”); hydrogels comprising collagen and chitosan; methods of making the hydrogels; methods of reducing gelation of a hydrogel mixture at room temperature; methods of reducing compaction of cells; and methods of culturing cells on such hydrogels.

Подробнее
Номер записи: 4
04-07-2013 дата публикации

Stimuli Responsive Nanofibers

Номер: US20130171331A1
Автор: Jie Wen, Patrick Guire, Tahmina Naqvi
Принадлежит: Individual

A stimuli responsive nanofiber that includes a stimuli responsive polymer, such as a thermally responsive polymer, and a cross-linking agent having at least two latent reactive activatable groups. The nanofiber may also include a biologically active material or a functional polymer. The stimuli responsive nanofiber can be used to modify the surface of a substrate. When the nanofiber includes a thermally responsive polymer, the physical properties of the surface can be controlled by controlling the temperature of the system, thus controlling the ability of the surface to bind to a biologically active material of interest.

Подробнее
Номер записи: 5
04-01-2018 дата публикации

HYPOTHERMIC 3D BIOPRINTING OF LIVING TISSUES SUPPORTED BY PERFUSABLE VASCULATURE

Номер: US20180002658A1
Автор: Grigoryan Bagrat, Miller Jordan, Ta Anderson
Принадлежит:

The present disclosure provides compositions and methods for producing hydrogel matrix constructs. Methods of using hydrogel matrix constructs for tissue repair and regeneration and for the oxygenation of red blood cells are also disclosed. 1. A prepolymerization solution comprising: a photosensitive polymer having a molecular weight of greater than 2 ,000 Daltons and comprising at least two vinyl groups per molecule of polymer; a photoinitiator; and a biocompatible , light-absorbing additive material suitable to control light penetration.2. The prepolymerization solution of further comprising a cell.3. The prepolymerization solution of claim 1 , wherein the biocompatible claim 1 , light-absorbing additive material is organic.4. The prepolymerization solution of claim 1 , wherein the biocompatible claim 1 , light-absorbing additive material is tartrazine or curcumin.5. The prepolymerization solution of comprising a water content of 10 wt % to about 99.5 wt %.6. The prepolymerization solution of claim 1 , wherein the polymer is poly(ethylene glycol) and wherein the at least two vinyl groups are methacrylate or acrylamide.7. The prepolymerization solution of wherein the photo-initiator is lithium acylphosphinate.8. A composition comprising:a hydrogel matrix comprising a plurality of layers, each layer comprising a cross-linked polymer network formed from a photosensitive polymer having a molecular weight greater than 2,000 Daltons, wherein the hydrogel matrix has a elastic modulus of from about 1 kilopascal to about 200 kilopascals;a first elongated void in the hydrogel matrix providing a first tubular channel;a second elongated void in the hydrogel matrix providing a second tubular channel;wherein the first tubular channel and the second tubular channel are perfusable;wherein the first tubular channel does not intersect the second tubular channel; andwherein the second tubular channel interpenetrates the first tubular channel.9. The composition of claim 8 , wherein ...

Подробнее
Номер записи: 6
02-01-2020 дата публикации

HOLLOW CELLULAR MICROFIBRE AND METHOD FOR PRODUCING SUCH A HOLLOW CELLULAR MICROFIBRE

Номер: US20200002681A1
Автор: ALESSANDRI Kevin, ANDRIQUE LAETITIA, Bikfalvi Andreas, FEYEUX Maxime, NASSOY PIERRE, RECHER GAËLLE
Принадлежит:

The invention relates to a hollow cell microfibre comprising successively, organized around a lumen, at least one endothelial cell layer, at least one smooth muscle cell layer, an extracellular matrix layer, and optionally an outer hydrogel layer. The invention also relates to a process for fabricating such a hollow cell microfibre. 116-. (canceled)17. An artificial hollow cell microfibre comprising successively , organized around a lumen:at least one endothelial cell layer;at least one smooth muscle cell layer;an extracellular matrix layer; and optionallyan outer hydrogel layer.18. The artificial hollow cell microfibre according to claim 17 , wherein the outer hydrogel layer is present and comprises alginate.19. The artificial hollow cell microfibre according to claim 17 , wherein the ratio in cmof endothelial cells to smooth muscle cells in the hollow cell microfibre is between 3:1 and 2:1.20. The artificial hollow cell microfibre according to claim 17 , wherein the endothelial cells are selected from the groip consisting in mammalian umbilical vein endothelial cells (UVEC) claim 17 , dermal microvascular endothelial cells (DMEC) claim 17 , dermal blood endothelial cells (DBEC) claim 17 , dermal lymphatic endothelial cells (DLEC) claim 17 , cardiac mirovascular endothelial cells (CMEC) claim 17 , pulmonary microvascular endothelial cells (PMEC) and uterine microvascular endothelial cells (UtMEC).21. The artificial hollow cell microfibre according to claim 17 , wherein the smooth muscle cells are selected from the group consisting in mammalian vascular smooth muscle cells claim 17 , lymphatic smooth muscle cells claim 17 , digestive tract smooth muscle cells claim 17 , bronchial smooth muscle cells claim 17 , kidney smooth muscle cells claim 17 , bladder smooth muscle cells claim 17 , dermal smooth muscle cells claim 17 , uterine smooth muscle cells and ciliary smooth muscle cells.22. The artificial hollow cell microfibre according to claim 17 , wherein the ...

Подробнее
Номер записи: 7
09-01-2020 дата публикации

System and Method for a Piezoelectric Collagen Scaffold

Номер: US20200009291A1
Автор: Arinzeh Treena, Jaffe Michael, Rajabi Amir Hossein
Принадлежит: NEW JERSEY INSTITUTE OF TECHNOLOGY

The present invention provides novel methods for poling piezoelectric materials, e.g., collagen, which are carried out in the absence of liquid media and at a relatively low temperature. The present invention also provides electroactive scaffolds comprising poled collagen for promoting cell growth and differentiation. 1. A method of poling piezoelectric material , said method comprising exposing said piezoelectric material to a constant electric field;wherein said method is carried out at a temperature of about 80° C. or less.2. The method of claim 2 , wherein said method is carried out in the absence of a liquid medium.3. The method of claim 1 , wherein said method is carried out at a temperature of about 25° C. to about 80° C.4. The method of claim 3 , wherein said method is carried out at a temperature of about 50° C.5. The method of claim 1 , wherein said method comprises exposing said piezoelectric material to a constant electric field of about 0.5×10to about 10V/m.6. The method of claim 1 , wherein said method comprises exposing said piezoelectric material to a constant electric field of about 4.4×10V/m.7. The method of claim 1 , wherein said method comprises applying to the piezoelectric material an electric voltage of about 1 kV to about 50 kV.8. The method of claim 1 , wherein the piezoelectric material is sandwiched between Teflon and steel plates during exposure to the constant electric field.9. The method of claim 1 , wherein the piezoelectric material comprises a polymer.10. The method of claim 9 , wherein said polymer is a naturally derived polymer.11. The method of claim 9 , wherein said polymer is biocompatible claim 9 , biodegradable or both.12. The method of claim 9 , wherein said polymer is selected from the group consisting of collagen claim 9 , gelatin claim 9 , zein claim 9 , elastin claim 9 , silk claim 9 , chitosan claim 9 , chitin claim 9 , alginate claim 9 , starch claim 9 , cellulose claim 9 , proteoglycans and a glycosaminoglycan.13. The ...

Подробнее
Номер записи: 8
11-01-2018 дата публикации

Hydrogel Comprising A Scaffold Macromer Crosslinked With A Peptide And A Recognition Motif

Номер: US20180010091A1
Автор: Ahrens Caroline Chopko, Cook Christi D., Griffith Linda G., Imperiali Barbara, Renggli Kasper, Valdez Macias Jorge L.
Принадлежит: Massachusetts Institute of Technology

Methods of forming, dissolving, and functionalizing an extracellular matrix gel on demand based on cross-linking, modification, and dissolution of hydrogels using transpeptidase (e.g. sortase) are disclosed. Also provided are hydrogels comprising one or more macromers crosslinked to a mixture of peptides, wherein all or a portion of the peptides in the mixture comprise a recognition motif cleavable by a transpeptidase (e.g., sortase). 1. A hydrogel comprising one or more scaffold macromers crosslinked to a mixture of peptides , wherein all or a portion of the peptides in the mixture comprise a recognition motif cleavable by a transpeptidase.2. The hydrogel of claim 1 , wherein the transpeptidase is a sortase or a sortase variant.3. The hydrogel of claim 1 , wherein the recognition sequence comprises a motif selected from the group consisting of: LPXSG claim 1 , LPXTG claim 1 , and LAXTG.4. The hydrogel of any of claim 1 , wherein 0.001% to 80% of the peptides in the mixture comprise a recognition motif cleavable by a first transpeptidase.5. The hydrogel of claim 4 , wherein each peptide that comprises a first recognition sequence cleavable by the first transpeptidase does not comprise a second recognition motif cleavable by a second transpeptidase.6. The hydrogel of any of claim 1 , wherein the peptide further comprises a sequence cleavable by a protease.7. The hydrogel of claim 6 , wherein the protease is an endopeptidase or a metalloprotease.8. The hydrogel of claim 1 , wherein the peptide comprises the amino acid sequence GCRDLPRTGGPQGIWGQDRCG.9. The hydrogel of claim 1 , wherein a portion of the peptides in the mixture is crosslinked to a macromer at its N-terminus claim 1 , and is free at its C-terminus.10. The hydrogel of claim 1 , wherein the hydrogel encapsulates a cell claim 1 , a tissue claim 1 , or an organ.11. The hydrogel of claim 1 , wherein the scaffold macromer is selected from any one or more of polyethyleneglycol (PEG) claim 1 , a dextran claim 1 , ...

Подробнее
Номер записи: 9
18-01-2018 дата публикации

MATRIX IN BALL FORM AS A CELL CARRIER

Номер: US20180015147A1
Автор: BERTHOLET Pauline, BOUCKENOOGHE Thomas, DELORME Bruno
Принадлежит:

The invention relates to a matrix in ball form comprising cross-linked fibrinogen, the matrix being free from fibrin, as well as to a method for preparing such a matrix, comprising the following steps: (a) providing an initial composition comprising fibrinogen and a platelet factor, (b) injecting said initial composition into an oil heated to a temperature of 50° C. to 80° C. so as to form an emulsion, (c) mixing the emulsion thus obtained at a temperature of 50° C. to 80° C. until a matrix in ball form is obtained, and (d) isolating the matrix thus obtained. The matrix is used as a cell carrier. 1. A matrix in ball form comprising cross-linked fibrinogen wherein the matrix is free from fibrin.2. The matrix according to claim 1 , wherein it is porous.3. The matrix according to claim 2 , wherein it has pores with a diameter smaller than 1 μm.4. The matrix according to claim 1 , wherein the fibrinogen is cross-linked via a platelet factor.5. The matrix according to claim 1 , wherein it has a diameter comprised between 20 μm and 2 mm claim 1 , in particular between 50 μm and 1000 μm.6. The matrix according to claim 1 , wherein it further comprises at least one bioactive agent such as a cell claim 1 , a protein claim 1 , for example a growth factor claim 1 , a medicinal product claim 1 , a hormone claim 1 , a cytokine or a combination thereof.7. The matrix according to claim 6 , wherein the protein is a growth factor such as IGF-1.8. The matrix according to claim 1 , on the surface of which cells are adhered.9. A method for preparing a matrix according to claim 1 , comprising the following steps:(a) providing an initial composition comprising fibrinogen and a platelet factor,(b) injecting said initial composition into an oil heated to a temperature of 50° C. to 80° C. so as to form an emulsion,(c) mixing the emulsion thus obtained at a temperature of 50° C. to 80° C. until a matrix in ball form is obtained, and(d) isolating the matrix thus obtained.10. The method ...

Подробнее
Номер записи: 10
03-02-2022 дата публикации

DEVICES AND METHODS FOR SINGLE CELL ANALYSIS

Номер: US20220034867A1
Автор: Butler John, Chaudhuri Bidhan
Принадлежит:

The present disclosure provides systems, methods, and devices for the simultaneous determination of a single cell's response to a stimuli and characterization of its cell response. The present disclosure further provides methods for detection of disease state, clinical management of a subject suffering from a disease, drug screening, prediction of drug response, and stands to help direct drug and diagnostic development for the treatment of disease. 1. (canceled)2. A method of agent transfer comprising:providing a plurality of cells from a biological sample comprising a heterogenous population of cells from a patient positioned on a surface of a first solid substrate at a plurality of cell-philic sites;immobilizing a portion of the cells in a hydrogel concentration at their respective cell-philic sites thereby creating a plurality of three-dimensional cell microenvironments comprising the hydrogel composition and the cells, the hydrogel composition of each three-dimensional cell microenvironment being sized and positioned so as to extend upward with a dome shape from the surface of the solid substrate;dispending an agent onto an agent transfer device comprising a plurality of agent transfer array elements positioned on a surface of a second solid substrate; andcontacting the plurality of agent transfer array elements to the plurality of three-dimensional cell microenvironments, such that each agent transfer array element corresponds to a three-dimensional cell microenvironment, wherein the contacting allows the agent to be transferred to the plurality of three-dimensional cell microenvironments,3. The method of claim 2 , wherein the agent transfer device transfers at least 50% of the original concentration of the agent on the agent transfer device to the plurality of three-dimensional cell microenvironments.4. The method of claim 2 , wherein the plurality of cells comprise a clinical sample.5. The method of claim 2 , wherein the plurality of cells comprise a tumor ...

Подробнее
Номер записи: 11
21-01-2016 дата публикации

SURFACE IMMOBILIZATION OF VARIOUS FUNCTIONAL BIOMOLECULES USING MUSSEL ADHESIVE PROTEIN

Номер: US20160017279A1
Автор: Cha Hyung Joon, Choi Bong-Hyuk, Choi Yoo Seong, Kim Bum Jin
Принадлежит:

The present invention relates to technology of immobilizing or coating various functional bioactive substances on various surfaces without physical chemical treatment using mussel adhesive protein. More specifically, the present invention relates to a functional scaffold for tissue engineering comprising artificial extracellular matrix, manufactured by coating various functional bioactive substances on the surface of nanofiber and metal scaffold using mussel adhesive protein, and a method of manufacturing the same.

Подробнее
Номер записи: 12
28-01-2016 дата публикации

METHOD FOR STEM CELL CULTURE AND CELLS DERIVED THEREFROM

Номер: US20160024467A1
Автор: Crook Jeremy Micah, Horne Rachel, Phillips Blaine Wesley
Принадлежит:

There is described a method of promoting the attachment, survival and/or proliferation of a stem cell in culture, the method comprising culturing a stem cell on a positively-charged support surface. There are also provided a cell composition prepared according to the method of the invention. 1. A cell culture system comprising substantially undifferentiated stem cells cultured on a positively-charged support surface.2. The cell culture system of claim 1 , wherein the support surface comprises a positively-charged molecule bound thereto and wherein the positively charged molecule is tri-methylamine.3. The cell culture system of claim 1 , wherein the support surface is selected from the group consisting of a tissue culture plate claim 1 , a microscope slide claim 1 , a multi-well plate claim 1 , a flask claim 1 , a bottle claim 1 , a bioreactor claim 1 , a two- or three-dimensional scaffold claim 1 , a tube claim 1 , a suture claim 1 , a membrane claim 1 , a film claim 1 , a microcarrier bead claim 1 , a tissue and an organ.4. The cell culture system of claim 3 , wherein the support surface is the surface of a microcarrier bead.5. The cell culture system of claim 1 , further comprising an extracellular matrix component.6. The cell culture system of claim 5 , wherein the extracellular matrix component is selected from the group consisting of elastin claim 5 , fibronectin claim 5 , vitronectin claim 5 , tenascin claim 5 , laminin claim 5 , entactin claim 5 , aggrecan claim 5 , decorin claim 5 , collagen I claim 5 , collagen III claim 5 , collagen IV claim 5 , and collagen VI claim 5 , biologically active fragments or variants of said proteins claim 5 , or combinations thereof.7. The cell culture system of claim 1 , wherein the substantially undifferentiated stem cells are passaged and maintained as single-cell culture.8. The cell culture system of claim 1 , wherein the substantially undifferentiated stem cells are human stem cells.9. The cell culture system of claim 1 , ...

Подробнее
Номер записи: 13
25-01-2018 дата публикации

COMPOSITIONS AND METHODS OF CELL ATTACHMENT

Номер: US20180023050A1
Автор: Fraser Jacob, HUH Dongeun, JANG Kyung Jin, Kerns Jordan, Levner Daniel, Varone Antonio
Принадлежит:

Compositions, devices and methods are described for improving adhesion, attachment, and/or differentiation of cells in a microfluidic device or chip. In one embodiment, one or more ECM proteins are covalently coupled to the surface of a microchannel of a microfluidic device. The microfluidic devices can be stored or used immediately for culture and/or support of living cells such as mammalian cells, and/or for simulating a function of a tissue, e.g., a liver tissue, muscle tissue, etc. Extended adhesion and viability with sustained function over time is observed. 1. A method of culturing cells , comprising: a) providing a microfluidic device comprising a surface; b) covalently attaching one or more proteins or peptides to said surface at a selected area or pattern using a crosslinker so as to create a treated surface; c) seeding viable cells on said treated surface so as to create attached cells; and d) culturing said attached cells.2. The method of claim 1 , wherein said microfluidic device comprises a microchannel claim 1 , said surface disposed within said microchannel claim 1 , and wherein said microchannel is in fluidic communication with a fluidic source comprising fluid claim 1 , the method further comprising flowing fluid from said fluid source through said microchannel so as to create flow conditions claim 1 , and wherein culturing in d) further comprises culturing said attached cells under said flow conditions.3. The method of claim 1 , wherein said crosslinker comprises at least one light-reactive portion claim 1 , at least one chemically reactive portion.4. The method of claim 1 , wherein said crosslinker further comprises at least one spacer portion.5. The method of claim 3 , wherein said at least one light-reactive portion is selected from the group consisting of a nitrophenyl claim 3 , a diazirine and an azides.6. The method of claim 3 , wherein said at least one chemically reactive portion is selected from the group consisting of NHS-ester claim 3 , ...

Подробнее
Номер записи: 14
25-01-2018 дата публикации

Compositions and methods of cell attachment

Номер: US20180024119A1
Автор: Antonio VARONE, Daniel Levner, Dongeun Huh, Jacob Fraser, Jordan KERNS, Kyung Jin Jang
Принадлежит: Emulate Inc

Compositions, devices and methods are described for improving adhesion, attachment, and/or differentiation of cells in a microfluidic device or chip. In one embodiment, one or more ECM proteins are covalently coupled to the surface of a microchannel of a microfluidic device. The microfluidic devices can be stored or used immediately for culture and/or support of living cells such as mammalian cells, and/or for simulating a function of a tissue, e.g., a liver tissue, muscle tissue, etc. Extended adhesion and viability with sustained function over time is observed.

Подробнее
Номер записи: 15
28-01-2021 дата публикации

OPTICAL-QUALITY SURFACE THAT IMPARTS SPATIAL CONTROL OF MACROPHAGE FUSION

Номер: US20210024898A1
Автор: Christenson Wayne, DOUDRICK Kyle, Faust James, Ros Robert, Ugarova Tatiana
Принадлежит:

Methods to form a surface coating and surface pattern, which are based on adsorption of hydrocarbon chains that can be used with imaging optics to visualize macrophage fusion and multinucleated giant cell formation with living specimens are described. 1. A method of adhering a monocyte or macrophage to a glass surface such that cell fusion occurs and can be visualized via microscopy , comprising:coating the glass surface with a hydrocarbon, wherein the glass surface is treated with vacuum gas plasma and the hydrocarbon is non-covalently coupled to the glass surface; and wherein the glass surface having a hydrocarbon coating further comprises a micropattern, wherein the micropattern comprises a grid pattern, and wherein the grid pattern comprises an array of hydrocarbon coating material raised from the glass surface to a peak of about 10 nm; andcontacting said monocyte or macrophage to the hydrocarbon under conditions suitable for cell fusion.2. The method of claim 1 , further comprising producing the micropattern of hydrocarbons on the glass surface.3. The method of claim 2 , wherein the producing the micropattern step further comprises using a stamp that is configured to form a micropattern.4. The method of claim 2 , wherein the producing the micropattern step further comprises using a grid.5. (canceled)6. The method of claim 1 , wherein the hydrocarbon is selected from the group consisting of one or more of oleamide claim 1 , paraffin wax claim 1 , and petrolatum.7. The method of claim 1 , wherein the glass surface is hydrophobic.8. An apparatus for visualizing cell fusion with a microscope claim 1 , comprising a glass surface having a hydrocarbon coating claim 1 , wherein the glass surface is configured to promote cell fusion.918.-. (canceled)14. A method for visualizing macrophage fusion in living specimens with microscopy claim 1 , comprising:contacting a monocyte or macrophage to a glass surface with a hydrocarbon coating suitable for light microscopy under ...

Подробнее
Номер записи: 16
30-01-2020 дата публикации

METHODS AND SYSTEMS FOR CELL AND BEAD PROCESSING

Номер: US20200033237A1
Автор: Hindson Christopher, Price Andrew D., Schnall-Levin Michael
Принадлежит:

The present disclosure provides methods and systems for cell and bead processing or analysis. A method for processing a cell or bead may comprise subjecting a bead to conditions sufficient to change a first characteristic or set of characteristics (e.g., cell or bead size). Such a method may further comprise subjecting the cell or bead to conditions sufficient to change a second characteristic or set of characteristics. In some cases, crosslinks may be formed within the cell or bead. 182.-. (canceled)83. A method of processing a cell , comprising: (i) change a cross-section of said cell from a first cross-section to a second cross-section, which second cross-section is less than said first cross-section, and', '(ii) form crosslinks within said cell having said second cross-section; and, '(a) subjecting said cell to conditions sufficient to(b) providing said cell having said second cross-section in an aqueous fluid.84. The method of claim 83 , wherein said crosslinks are formed upon cross-linking one or more cross-linkable molecules within said cell.85. The method of claim 84 , wherein said one or more cross-linkable molecules are one or more polymers.86. The method of claim 83 , wherein said crosslinks are formed upon polymerizing a plurality of monomers within said cell.87. The method of claim 83 , wherein said cross-section of said cell is changed from said first cross-section to said second cross-section concurrently with formation of said crosslinks within said cell.88. The method of claim 83 , wherein said crosslinks are formed subsequent to changing said cross-section from said first cross-section to said second cross-section.89. The method of claim 83 , wherein said second cross-section is substantially maintained in said aqueous fluid.90. The method of claim 83 , wherein said aqueous fluid is in a droplet as part of an emulsion.91. The method of claim 90 , wherein the volume of said droplet is less than 10 claim 90 ,000 pL.92. The method of claim 83 , ...

Подробнее
Номер записи: 17
08-02-2018 дата публикации

MICROPARTICLES

Номер: US20180036702A1
Автор: Wellings Donald A.
Принадлежит:

The invention provides a self-assembled microparticle having an acid having two or more acid groups and an organic base in a solvent. The microparticles may form into a macrostructure and provide a scaffold for cell culture. The particle is of micron scale. The microparticle may be obtained by contacting a bis-acid and organic base in a hydrophilic solvent, wherein the acid is insoluble or sparingly soluble in the hydrophilic solvent and the organic base is soluble in a hydrophilic solvent. The microparticles have antimicrobial activity and may be used in a wide range of consumer product applications, cell culture and medical products, such as wound dressings. 1. A self-assembled microparticle comprising an acid having two or more acid groups and an organic base.2. A microparticle according to having a particle size of 0.5 to 10 microns.3. A microparticle according to in which the molar ratio of acid groups to basic groups in the acid and base is from 0.6 to 1.4:1.4. (canceled)5. A method of making a microparticle according to suitable for use as a particulate support comprising contacting a bis-acid and an organic base in a hydrophilic solvent claim 1 , wherein the acid is insoluble or sparingly soluble in the hydrophilic solvent and the organic base is soluble in a hydrophilic solvent.67-. (canceled)8. A microparticle according to wherein the acid comprises a bis-acid.911-. (canceled)12. A microparticle according to wherein the acid comprises a compound of general formula HOOC—(CH)—COOH wherein n is sufficiently large that the bis acid is sparingly soluble or insoluble in water.13. A microparticle according to wherein n is at least 5 and not more than 40.14. A microparticle according to wherein the acid comprises brassylic acid claim 1 , sebacic acid and/or azelaic acid.15. A microparticle according to wherein the organic base comprises an aliphatic amine or an aromatic amine having a basic character or other nitrogen-containing base.16. (canceled)17. A ...

Подробнее
Номер записи: 18
11-02-2016 дата публикации

THERMALLY RESPONSIVE CELL CULTURE SURFACES

Номер: US20160040121A1
Автор: Guire Patrick, Naqvi Tahmina, Wen Jie
Принадлежит:

A stimuli responsive nanofiber that includes a stimuli responsive polymer, such as a thermally responsive polymer, and a cross-linking agent having at least two latent reactive activatable groups. The nanofiber may also include a biologically active material or a functional polymer. The stimuli responsive nanofiber can be used to modify the surface of a substrate. When the nanofiber includes a thermally responsive polymer, the physical properties of the surface can be controlled by controlling the temperature of the system, thus controlling the ability of the surface to bind to a biologically active material of interest. 152.-. (canceled)53. A cell culture article comprising a surface and a coating composition in contact with the surface , the coating composition comprising:(a) a thermally responsive polymer, and(b) a monomeric or polymeric crosslinking agent having at least two latent photoreactive groups capable of forming covalent bonds when the coating composition is subjected to electromagnetic energy, thereby coupling the thermally responsive polymer to the surface of the cell culture article in a manner in which at least some of the latent photoreactive groups remain in an inactive state.54. The article according to wherein the latent photoreactive groups are capable of forming a covalent bond with the surface.55. The article according to wherein the covalent bond is formed by carbon or nitrogen bond insertion claim 54 , hydrogen abstraction followed by radical recombination claim 54 , or dimerization.56. The article according to wherein the latent photoreactive groups are aryl ketones.57. The article according to wherein the aryl ketones are selected from acetophenones claim 56 , benzophenones claim 56 , anthraquinones claim 56 , anthrones claim 56 , and anthrone-like heterocycles.58. The article according to wherein the crosslinking agent is a compound having a formula selected from (a) to (g):{'sup': 1', '2', '3', '4, 'sub': 'm', 'claim-text': wherein L is ...

Подробнее
Номер записи: 19
11-02-2016 дата публикации

NANOFIBERS

Номер: US20160040122A1
Автор: MERKLE VALERIE, SLEPIAN Marvin, Wu Xiaoyi
Принадлежит:

The present disclosure relates to nanofibers. In particular, the present disclosure relates to nanofibers comprising multiple layers and their uses in cell culture and tissue engineering. 1. A composition , comprising:a multi-layer nanofiber comprising a polymeric core and a biocompatible shell.2. The composition of claim 1 , wherein said polymeric core is comprised of a material selected from glycolic acid polymers claim 1 , lactic acid polymers claim 1 , polyurethanes claim 1 , polyesters such as poly(ethylene terephthalate) claim 1 , nylon claim 1 , polyacrylonitriles claim 1 , polyphosphazines claim 1 , polycaprolactone claim 1 , poly[bis(p-carboxphenoxy)propane anhydride] claim 1 , polyethylene claim 1 , polyvinyl chloride claim 1 , ethylene vinyl acetate claim 1 , homopolymers and copolymers of delta-valerolactone claim 1 , and p-dioxanone claim 1 , and polyvinyl alcohol.3. The composition of claim 1 , wherein said biocompatible shell is comprised of a biocompatible material selected from gelatin claim 1 , collagen claim 1 , fibrin claim 1 , fibrinogen claim 1 , albumin claim 1 , laminin claim 1 , zein claim 1 , lipids claim 1 , phospholipids claim 1 , and glycoproteins.4. The composition of claim 3 , wherein said biocompatible material comprises an agent that alters the surface texture or functionality of said nano-fiber.5. The composition of claim 4 , wherein said agent is selected from ligands claim 4 , nanoparticles claim 4 , iron claim 4 , labels claim 4 , contrast agents claim 4 , cells claim 4 , encapsulated particles claim 4 , and viruses.6. The composition of claim 4 , wherein said agent is incorporated into said biocompatible material or on the surface of said biocompatible material.7. The composition of claim 1 , wherein said nanfiber is a core-shell nanofiber comprising a polyvinyl alcohol core and a gelatin shell.8. The composition of claim 7 , wherein said PVA and said gelatin are present at a ratio of approximately 1:1 in said nanofiber.9. The ...

Подробнее
Номер записи: 20
11-02-2016 дата публикации

USE OF LIGANDS FOR THE PROGRAMMED CELL DEATH RECEPTOR CONJUGATED TO SOLID SUPPORTS FOR THE EXPANSION OF HUMAN REGULATORY T CELLS

Номер: US20160040127A1
Автор: Ansari M. Javeed, Gallon Lorenzo, LEVENTHAL Joseph R., Mathew James M.
Принадлежит: Northwestern University

Disclosed are methods for isolating, cultivating, and/or cells including regulatory T cells (Tregs). The methods typically include cultivating cells including Tregs in a culture media comprising a ligand for programmed cell death receptor (PD-1) conjugated to a solid support. Suitable ligands may include PD-L1 and suitable solid supports may include magnetic or paramagnetic beads where the methods further include removing the PD-L1/bead conjugates after the Tregs have been isolated, cultured, and/or expanded. 1. A method comprising cultivating regulatory T cells (Tregs) in a culture media comprising a ligand for the programmed cell death receptor (PD-1) conjugated to a solid support.2. The method of claim 1 , wherein the ligand is PD-L1 protein conjugated to a magnetic or paramagnetic bead.3. The method of claim 2 , wherein the culture media has a ratio of Tregs to beads of 1:(1-4).4. The method of claim 1 , wherein greater than about 80% of the Tregs cultivated in the culture media have a phenotype of CD4 claim 1 , CD25 claim 1 , CD127 claim 1 , and greater than about 60% of the Tregs cultivated in the culture media have a phenotype of Foxp3.5. The method of claim 1 , wherein the method further comprises isolating the Tregs from peripheral blood mononuclear cells (PBMCs) prior to cultivating the Tregs in the culture media.6. The method of wherein the Tregs are isolated from the PBMCs by removing cells that are CD8 and CD19 from the PMBCs and by selecting for cells that are CD25 in the PMBCs.7. The method of claim 1 , further comprising cultivating the Tregs in a culture media comprising an antibody against CD3 conjugated to a solid support and/or cultivating the Tregs in a culture media comprising an antibody against CD28 conjugated to a solid support.8. The method of claim 7 , wherein the solid support is a magnetic or paramagnetic bead.9. The method of claim 1 , wherein the culture media further comprises a cytokine.10. The method of claim 9 , wherein the ...

Подробнее
Номер записи: 21
08-02-2018 дата публикации

THREE-DIMENSIONAL STRUCTURE FOR CARDIAC MUSCULAR TISSUE REGENERATION AND MANUFACTURING METHOD THEREFOR

Номер: US20180037870A1
Автор: Cho Dong-Woo, Jang Jinah, PARK Hun-Jun
Принадлежит:

The present invention provides a preparation method of a three-dimensional construct for regenerating a cardiac muscle tissue comprising; a step of forming a three-dimensional construct by printing and crosslinking the first bioprinting composition comprising a tissue engineering construct forming solution containing decellularized extracellular matrix and a crosslinking agent, and cardiac progenitor cells, and the second bioprinting composition comprising the tissue engineering construct forming solution, mesenchymal stem cells and a vascular endothelial growth factor, to arrange the first bioprint layer and the second bioprint layer alternately; and a step of obtaining a crosslink-gelated three-dimensional construct by thermally gelating the crosslinked three-dimensional construct, and a three-dimensional construct for regenerating a cardiac muscle tissue, and the preparation method according to the present invention not only equally positions the cardiac progenitor cells in the construct but also implements a vascular network composed of vascular cells in the construct, so that the viability of cells can be maintained for a long time and the cell transfer efficiency into the myocardium can be significantly improved. 1. A method of preparing a three-dimensional construct for regenerating a cardiac muscle tissue comprising ,(a) forming a three-dimensional construct by printing a first bioprinting composition comprising a tissue engineering construct forming solution containing decellularized extracellular matrix and cardiac progenitor cells, and a second bioprinting composition comprising the tissue engineering construct forming solution, mesenchymal stem cells and a vascular endothelial growth factor, to arrange the first bioprint layer and the second bioprint layer alternately; and(b) carrying out the thermal gelation for the three-dimensional construct,wherein the (a) step is performed at a temperature at which no thermal gelation occurs, and the (b) step is ...

Подробнее
Номер записи: 22
07-02-2019 дата публикации

Polymer-based material having covalently bonded enzymatically degradable peptide sequences

Номер: US20190040353A1
Автор: Carsten Werner, Juliane Teichmann, Mikhail Tsurkan
Принадлежит: Leibniz Institut fuer Polymerforschung Dresden eV

A polymer-based material having covalently bonded enzymatically degradable peptide sequences not degradable by the biological and metabolic activity of cells and tissues is disclosed, wherein the peptide sequences are incorporated into the polymer-based material or conjugated to the polymer-based material. The peptide sequence can be part of the three-dimensional or two-dimensional structure of the polymer-based material. A controlled degradation of a covalent bond in the peptide sequence is effected. Use of such polymer-based material for an in vitro production of cell cultures or tissues or organs, for an in vivo stabilization of donated cells, tissues or organs is also disclosed. An adhesive bond between the material and the sample, i.e. cells, tissues, or organs is controlledly degradable without destroying the integrity of the sample.

Подробнее
Номер записи: 23
07-02-2019 дата публикации

CELL SEEDING SUBSTRATE, METHOD FOR MANUFACTURING THE SAME, AND CELL SHEET SEPARATING METHOD

Номер: US20190040380A1
Автор: CHIEN HSIU-WEN
Принадлежит:

A cell seeding substrate comprises a base comprising a rotary surface and a photolysis layer formed on the rotary surface of the base. The photolysis layer comprises a plurality of photolysis groups, and each of the plurality of photolysis groups has a chemical structural formula of 2. The cell seeding substrate of claim 1 , wherein the base is made of poly (n-isopropyl acrylamide) hydrogel claim 1 , and a plurality of silver nano-particles is dispersed in the poly (n-isopropyl acrylamide) hydrogel.3. The cell seeding substrate of claim 1 , wherein Ris a natural polymer comprising sulfur group or a synthetic polymer comprising sulfur group claim 1 , the natural polymer is selected from collagen claim 1 , hyaluronic acid claim 1 , protein for functionalizing cell claim 1 , or peptides for functionalizing cell.6. The method of claim 5 , wherein the base is made of poly (n-isopropyl acrylamide) hydrogel claim 5 , and a plurality of silver nano-particles is dispersed in the poly (n-isopropyl acrylamide) hydrogel.9. The cell sheet separating method of claim 8 , wherein the base is made of poly (n-isopropyl acrylamide) hydrogel claim 8 , and a plurality of silver nano-particles is dispersed in the poly (n-isopropyl acrylamide) hydrogel. The subject matter herein generally relates to a cell seeding substrate, a method for manufacturing the cell seeding substrate, and a cell sheet separating method using the cell seeding substrate.Cells are usually seeded on a thermoresponsive plate to form a cell sheet. The whole thermoresponsive plate can be deformed when cooled, thus allowing the cell sheet to be separated from the thermoresponsive plate. However, an activity of the cells may be decreased when cooled.It will be appreciated that for simplicity and clarity of illustration, where appropriate, reference numerals have been repeated among the different figures to indicate corresponding or analogous elements. In addition, numerous specific details are set forth in order to ...

Подробнее
Номер записи: 24
06-02-2020 дата публикации

METHOD AND MATERIAL FOR DIFFERENTIATED SEQUESTRATION OF SUBSTANCES OF DIFFERENT SUBSTANCE GROUPS WITH THE AID OF HYDROGELS CONTAINING SULPHATED OR SULPHONATED COMPONENTS

Номер: US20200040147A1
Автор: ATALLAH PASSANT, FREUDENBERG UWE, SCHIRMER LUCAS, WERNER CARSTEN
Принадлежит: LEIBNIZ-INSTITUT FÜR POLYMERFORSCHUNG DRESDEN E.V.

A method is disclosed for the differentiated sequestration of substances of different substance groups A and B in a sulfated and/or sulfonated hydrogel while simultaneously releasing substances of substance group A or B from the sulfated and/or sulfonated hydrogel into the biofluid. The sulfated and/or sulfonated hydrogel is selected from a group of hydrogels of Type 1, 2, 3, 4 and consist of uncharged and charged components. The charged components are characterized by calculating the number of sulfated or sulfonated groups per repeat unit divided by the molecular mass of the repeat unit, for each of Type 1 2 3 and 4. The swollen hydrogels have a concentration of sulfated or sulfonated groups in mmol/ml for Type 1, Type 2, Type 3 and Type 4. The concentration of substances of each substance group A and group B in the biofluid is influenced by the selection of the type of hydrogel. 137.-. (canceled)38. A method for differentiated sequestration of substances of different substance groups in a sulfated and/or sulfonated hydrogel comprising:sequestration of substances of groups A and B and depletion of substances of a group A from a biofluid with simultaneous differentiated release of substances of group A or B from the sulfated and/or sulfonated hydrogel into the biofluid or the reduced binding of substances of group B in the sulfated and/or sulfonated hydrogel,wherein the sulfated and/or sulfonated hydrogel include type 1, type 2, type 3 and type 4 hydrogels and the hydrogels are composed of uncharged building blocks (UGB) and charged building blocks (GB),calculating a parameter of the charged building blocks from the number of sulfate and/or sulfonate groups per repeat unit divided by the molar mass of the repeat unit of 0.0040-0.0060 mole/g for type 1, of 0.0025-0.0040 mole/g for type 2, of 0.0005-0.0025 mole/g for type 3, and of 0040 to 0.0100 mole/g for type 4, wherein swollen hydrogels have a storage module of less than 20 kPa and the swollen hydrogels have a ...

Подробнее
Номер записи: 25
06-02-2020 дата публикации

Decellularized Tissue as a Microcarrier for Cell Culture and Expansion

Номер: US20200040296A1
Автор: JABBARI ESMAIEL
Принадлежит:

A microcarrier for cell culture and expansion is provided. The microcarrier includes decellularized mammalian tissue. Further, the microcarrier has an average particle size ranging from about 10 micrometers to about 600 micrometers. A method of forming a decellularized mammalian tissue microcarrier for cell culture and expansion is also provided, along with a method for treating a mammalian tissue defect via a decellularized mammalian tissue microcarrier on which cells from the same tissue type as the decellularized mammalian tissue are expanded. 1. A microcarrier for cell culture and expansion comprising decellularized mammalian tissue , wherein the microcarrier has an average particle size ranging from about 10 micrometers to about 600 micrometers.2. The microcarrier of claim 1 , wherein the decellularized mammalian tissue originates from a human donor claim 1 , a specific human patient claim 1 , or a non-human mammal.3. The microcarrier of claim 1 , wherein the decellularized mammalian tissue originates from embryonic tissue claim 1 , neonatal tissue claim 1 , natal tissue claim 1 , juvenile tissue claim 1 , or adult tissue.4. The microcarrier of claim 1 , wherein the decellularized mammalian tissue originates from articular cartilage tissue claim 1 , bone tissue claim 1 , heart tissue claim 1 , liver tissue claim 1 , skin tissue claim 1 , or gall bladder tissue.5. The microcarrier of claim 1 , wherein the microcarrier is compatible with cells harvested from mammalian tissue of a same type as the decellularized mammalian tissue.6. The microcarrier of claim 1 , wherein the decellularized mammalian tissue is micronized.7. The microcarrier of claim 1 , wherein the decellularized mammalian tissue is digested and functionalized.8. The microcarrier of claim 7 , wherein the decellularized mammalian tissue is cross-linked.9. The microcarrier of claim 1 , wherein the microcarrier has a honeycomb microstructure.10. The microcarrier of claim 1 , wherein the microcarrier ...

Подробнее
Номер записи: 26
16-02-2017 дата публикации

ACTIVE-ESTER-GROUP-CONTAINING COMPOSITION FOR PRODUCING FIBERS, AND CELL CULTURE SCAFFOLD MATERIAL USING FIBERS PRODUCED FROM ACTIVE-ESTER-GROUP-CONTAINING COMPOSITION

Номер: US20170044491A1
Автор: Chen Yong, KAMEI Kenichiro, Kishioka Takahiro, Liu Li, Nishino Taito, OTANI Ayako, Umezaki Makiko
Принадлежит:

A composition for producing a fiber, containing (A) a polymer compound containing a unit structure represented by the formula (1) and a unit structure represented by the formula (2), (B) a crosslinking agent, (C) an acid compound, and (D) a solvent 3. The composition according to claim 1 , wherein the above-mentioned polymer compound has a weight average molecular weight of 1 claim 1 ,000-1 claim 1 ,000 claim 1 ,000.4. The composition according to claim 1 , wherein the above-mentioned solvent is a polar solvent.5. A production method of a fiber claim 1 , comprising a step of spinning the composition according to .6. The method according to claim 5 , wherein the above-mentioned spinning is electrospinning.7. The method according to claim 5 , comprising a step of heating a spun fiber at 70-300° C.8. The method according to claim 5 , further comprising a step for immobilizing a cell adhesion substance.9. A fiber produced by the method according to .10. A cell culture scaffold material comprising the fiber according to . The present invention relates to a composition for producing a fiber, which comprises a polymer compound having an active ester group and a hydroxy group in a side chain, a crosslinking agent, an acid compound, and a solvent, a fiber superior in organic solvent resistance, which is obtained by spinning (preferably, further heating) the composition, and a cell culture scaffold material using the fiber.In the bone marrow and basal lamina in the body, cells grow and proliferate in an extracellular matrix constituted of a fiber-like structure of a nano level such as collagen and the like. To provide cells necessary for cell medicine and regenerative medicine, a scaffold material for cell culture that enables efficient culture of cells ex vivo is desired. It is preferable that such cell culture scaffold material mimic as much as possible the in vivo environment surrounding the cell.It has conventionally been studied to process matrix constituent materials ...

Подробнее
Номер записи: 27
19-02-2015 дата публикации

METHOD FOR CULTURING PLURIPOTENT STEM CELL, AND POLYPEPTIDE TO BE USED THEREFOR

Номер: US20150050737A1
Автор: IWAKI Yoshihide, IWATA Rie, MURAKAMI Yuta, SASAKI Tasuku
Принадлежит: FUJIFILM Corporation

A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues. 1. A polypeptide consisting of from 40 to 450 amino acid residues and comprising:(1) a first region comprising at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2),', '(2-ii) an amino acid sequence having an identity of not less than 50% to an amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or', '(2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2, in which from 1 to 30 amino acid residues are added, substituted, or deleted, and that has an adsorption ability to a cultivation container., '(2) a second region comprising'}2. The polypeptide according to claim 1 , wherein a GRAVY value is from −2.0 to −0.95.3. The polypeptide according to claim 1 , wherein the first region comprises both of the amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and the amino acid sequence represented by RGD.4. The polypeptide according to claim 1 , wherein the polypeptide ...

Подробнее
Номер записи: 28
03-03-2022 дата публикации

FUNCTIONALIZED SUBSTRATE TO MANIPULATE CELL FUNCTION AND DIFFERENTIATION

Номер: US20220064581A1
Автор: Beckers Lucas Johannes Anna Maria, VAN DE STOLPE Anja
Принадлежит:

The invention relates to a scaffold for steering cells into a predetermined direction of cell functionality, preferably a cell differentiation scaffold for steering cells into a predetermined direction of cell differentiation. The scaffold comprises a polydimethylsiloxane (PDMS)-, or rubber-, or silicone-based polymeric surface, and one or more cell functionality-inducing stimuli, preferably one or more cell differentiation-inducing stimuli, coupled to the polymeric surface.

Подробнее
Номер записи: 29
25-02-2016 дата публикации

TWO AND THREE DIMENSIONAL DECELLULARIZED ECM CONSTRUCTS AND USES THEREFOR

Номер: US20160053231A1
Автор: Xu Qiaobing
Принадлежит:

A microfabricated multi-tissue system for in vitro drug toxicity testing having a plurality of layers, each of which is formed of decellularized tissue extracellular matrix (ECM) including parenchymal cells and non-parenchymal cells attached thereto. Also disclosed is a method for producing a decellularized ECM paste, and methods for producing an ECM construct and a porous 3-D scaffold from the decellularized ECM paste. 1. A microfabricated multi-tissue system for in vitro drug toxicity testing , comprising a plurality of layers , each of which is formed of decellularized tissue extracellular matrix (ECM) and has a thickness of 10 μm to 2 mm , wherein at least a first layer has parenchymal cells attached thereto and at least a second layer has non-parenchymal cells attached thereto , each layer contains only a single cell type , and the first layer is stacked on the second layer such that the non-parenchymal cells extend survival of the parenchymal cells and maintain a differentiated state thereof.2. The microfabricated multi-tissue system of claim 1 , wherein the parenchymal cells are hepatocytes claim 1 , cardiomyocytes claim 1 , kidney epithelial cells claim 1 , enterocytes claim 1 , beta cells claim 1 , or cortical neurons.3. The microfabricated multi-tissue system of claim 1 , wherein the non-parenchymal cells are macrophages claim 1 , fibroblasts claim 1 , epithelial cells claim 1 , adipocytes claim 1 , or endothelial cells.4. The microfabricated multi-tissue system of claim 1 , wherein the plurality of layers are arranged in a tubular structure having a lumen and an exterior surface.5. The microfabricated multi-tissue system of claim 4 , wherein the ECM is decellularized tissue from lung claim 4 , liver claim 4 , heart claim 4 , kidney claim 4 , intestine claim 4 , tendon claim 4 , pancreas claim 4 , brain claim 4 , skin claim 4 , fat claim 4 , cartilage claim 4 , spleen claim 4 , bone claim 4 , or tumor.6. The microfabricated multi-tissue system of claim 5 , ...

Подробнее
Номер записи: 30
13-02-2020 дата публикации

METHOD AND SYSTEM FOR PRINTING CELLS TO A SUBSTRATE COMPRISING CELL ADHESIVE REGIONS

Номер: US20200048602A1
Автор: Alexander Frank, Aubin Megan, Hickman James J., ROTHEMUND Sandra
Принадлежит:

The method of culturing cells disclosed herein includes printing cells onto a substrate that includes cell adhesive regions and cell repulsive regions. The cells are suspended in a printing medium to create a cell suspension, and a volume of the cell suspension is loaded into a printer. A cell adhesive region of the substrate is aligned beneath the printing channel of the printer, and droplets of the cell suspension are dispensed from the printing channel directly onto the cell adhesive region. Contact of the dispensed droplets with cell repulsive regions of the substrate is limited, either by targeting of the droplets to the cell adhesive regions, by repulsions generated by the cell repulsive areas, or both. The cells adhere to the cell adhesive regions to create a cell pattern, and are maintained thereafter in a physiologically suitable environment. 1. A method of culturing cells , the method comprising:providing a substrate with cell adhesive regions and cell repulsive regions,suspending cells in a printing medium to create a cell suspension,loading a printer comprising a printing channel with a volume of the cell suspension,aligning a cell adhesive region of the substrate beneath the printing channel of the printer,dispensing a plurality of droplets of cell suspension from the printing channel directly onto the cell adhesive region,limiting contact of the dispensed droplets with cell repulsive regions,adhering the cells of the dispensed cell suspension to the cell adhesive region to create a cell pattern, andmaintaining the cell pattern in a physiologically suitable environment.2. The method of claim 1 , wherein providing the substrate further comprises patterning the substrate with one or more chemical layers to form the cell adhesive regions and the cell repulsive regions.3. The method of claim 1 , wherein the cell pattern has a width or a length of less than 1 millimeter.4. The method of claim 1 , wherein the cell suspension has a concentration from 0.5 ...

Подробнее
Номер записи: 31
22-02-2018 дата публикации

PROTEINASE-FREE COATINGS FOR COLONY PASSAGING

Номер: US20180051247A1
Автор: Fang Ye, Ferrie Ann MeeJin, Goral Vasiliy Nikoleavich, Henry David, Hervy Martial, Walerack Corinne, Zhou Yue
Принадлежит:

A cell culture article includes a substrate having a polymer coating that is conducive to colony passaging of cells cultured on the coating. Example polymer coatings are formed from polygalacturonic acid (PGA), alginate, or combinations thereof. Cells cultured on the polymer coating can be separated from the substrate as a colony or layer of cells by exposing the polymer coating to (i) a chelating agent, (ii) a proteinase-free enzyme, or (iii) a chelating agent and a proteinase-free enzyme. 1. A substrate for culturing cells , comprising:a polymer coating disposed on a surface of the substrate, wherein the polymer coating is cross-linked or grafted to the substrate and comprises at least one of PGA and alginate.2. The substrate according to claim 1 , wherein the polymer coating is cross-linked with calcium ions.3. The substrate according to claim 1 , wherein the polymer coating thickness ranges from 10 nm to 1000 microns.4. The substrate according to claim 1 , wherein the substrate is selected from the group consisting of microcarriers claim 1 , dishes claim 1 , bottles claim 1 , beakers and flasks.5. The substrate according to claim 1 , wherein the degree of cross-linking is uniform across the polymer coating thickness.6. The substrate according to claim 1 , wherein the degree of cross-linking decreases across the polymer coating thickness in the direction of the substrate.7. The substrate according to claim 1 , further comprising a cell adhesion layer on the polymer coating.8. The substrate according to claim 1 , further comprising a cell adhesion layer on the polymer coating selected from the group consisting of ECM proteins and synthetic molecules.9. A method for making an article for culturing cells claim 1 , comprising:forming a polymer coating on a substrate surface, wherein the polymer coating is cross-linked or grafted to the substrate and comprises at least one of PGA and alginate.10. The method according to claim 9 , wherein the degree of cross-linking is ...

Подробнее
Номер записи: 32
23-02-2017 дата публикации

Cell Carrier, Associated Methods for Making Cell Carrier and Culturing Cells Using the Same

Номер: US20170051248A1
Автор: Burns Andrew Arthur Paul, Conway Kenneth Roger, Davis Brian Michael, Gascoyne David Gilles, Loghin Evelina Roxana
Принадлежит:

A carrier for expansion of pluripotent stem cells is provided, wherein the carrier comprises a substrate comprising one or more outer surfaces, wherein the one or more outer surfaces are modified with gas plasma treatment, and one or more structured indentations on one or more of the outer surfaces. The carrier has a length at least about 0.2 mm, a width at least about 0.2 mm, and a height in a range from about 0.05 mm to 1.2 mm and each of the structured indentations has a major axis in a range from about 0.1 mm to 0.5 mm, a minor axis in a range from about 0.1 mm to 0.5 mm and a depth in a range from about 0.025 mm to about 0.5 mm. A method of making the carrier, and culturing stromal cells using the same carrier are also provided. 1. A method for expanding pluripotent stem cells , comprising:providing a carrier for expansion of pluripotent stem cells, comprising:a substrate comprising one or more outer surfaces modified with one or more of corona discharge treatment, gas plasma treatment, coating, or chemical functionalization to form modified surfaces;a plurality of structured indentations on the one or more outer surfaces and wherein a first structured indentation of the plurality of structured indentations is aligned with a second structured indentation of the plurality of structured indentations such that respective bottoms of the first structured indentation and the second structured indentation are separated by a portion of the substrate; anda biomolecular coating disposed on the modified surfaces,wherein the carrier has a length at least about 0.2 mm, a width at least about 0.2 mm, and a height in a range from about 0.05 mm to 1.2 mm and each of the structured indentations has a major axis in a range from about 0.1 mm to 0.5 mm, minor axis in a range from about 0.1 mm to 0.5 mm and depth in a range from about 0.025 mm to about 0.5 mm; andseeding and expanding the pluripotent stem cells on the carrier.2. The method of claim 1 , comprising releasing the ...

Подробнее
Номер записи: 33
23-02-2017 дата публикации

Carbonized Material And Method Of Inducing Cell Differentiation With The Same

Номер: US20170051250A1
Автор: Yi-Ching Cheng
Принадлежит: LinkWin Technology Co Ltd

A method of inducing cell differentiation with a carbonized material, including the steps of: providing a fiber woven fabric, carbonizing the fiber woven fabric with high temperature to produce a carbonized material, and seeding a cell on the carbonized material where the fiber woven fabric includes a polyacrylonitrile fiber, the carbonized material includes a plurality of carbon fibers, wherein each of the plurality of carbon fibers includes a main body and a plurality of pillars located on a surface of the main body, and are piled up with randomly arranged axes oriented in various directions, and through attachment to the plurality of pillars during the carbonization process, the cell is induced to differentiate into a specialized cell.

Подробнее
Номер записи: 34
10-03-2022 дата публикации

SYSTEMS AND METHODS FOR CULTURING CELLS IN SUSPENSION

Номер: US20220073868A1
Автор: Cooper Kirsten Lee, WANG JIE, Zuo Rongjun
Принадлежит:

A method of culturing adherent cells in suspension is provided that includes culturing adherent cells on a first substrate in a first suspension, harvesting the adherent cells from the first substrate, and transfecting the harvested adherent cells using electro-poration. The method also includes, after the step of transfecting, suspending the transfected adherent cells in a second suspension. A dissolution process for dissolving the second microcarrier particle to harvest the cells or cell products is also provided. This dissolution process includes adding a chelator, such as EDTA, to the second suspension for a predetermined time to separate the cells from the second microcarrier; and isolating the cells or cell products from a remainder of the second suspension after the predetermined time. The dissolution process is performed without enzymes such as pectinase or protease. 1. A method of culturing adherent cells in suspension , comprising:culturing adherent cells on a first substrate in a first suspension;harvesting adherent cells from the first substrate;transfecting the harvested adherent cells using electroporation;after the step of transfecting, suspending the transfected adherent cells in a second suspension.2. The method of claim 1 , wherein claim 1 , after electroporation claim 1 , the cells are recovered on a second substrate in suspension or in another suspension format.3. The method of claim 1 , the method further comprising harvesting the cells or products of the cells from the second suspension.4. The method of claim 1 , wherein the first substrate comprises a first microcarrier particle.5. The method of claim 1 , wherein the transfected adherent cells are suspended in the second suspension on a second substrate.6. The method of claim 5 , wherein the second substrate comprises a second microcarrier particle.7. The method of claim 6 , the method further comprising a dissolution process for dissolving the second microcarrier particle to harvest the cells ...

Подробнее
Номер записи: 35
03-03-2016 дата публикации

TISSUE ENGINEERED MODEL

Номер: US20160060592A1
Автор: Baust John G., Baust John M., Corwin William L., MCKAIN Jennie F., Robilotto Anthony T., SANTUCCI Kimberly L., Smith Joshua T., Snyder Kristi K., Van Buskirk Robert G.
Принадлежит:

A tissue engineered model (TEM) structure, an apparatus and method for making a TEM structure, and methods of using a TEM structure are disclosed. In an embodiment, the TEM structure includes at least one TEM segment. Each TEM segment includes a frame defining a bounded area, the frame having a height, a first edge, and a second edge opposite the first edge, each of the first edge and the second edge defining a perimeter of the bounded area, and the height defining a distance between the first edge and the second edge; a membrane affixed to the first edge about a perimeter of the frame; and a solidified gel and cell matrix disposed within the bounded area within the frame, wherein the solidified gel and cell matrix substantially fills a volume defined by the bounded area and the height of the frame. 1. A method of constructing a tissue engineered model (TEM) structure , the method comprising:forming a first TEM segment, the forming including: a height, a first edge, and a second edge opposite the first edge,', 'each of the first edge and the second edge defining a perimeter of the bounded area, and the height defining a distance between the first edge and the second edge, and', 'a membrane affixed to the first edge about the perimeter of the frame;, 'providing a frame defining a bounded area, the frame includingorienting the frame such that the second edge faces upward;pouring a liquid matrix precursor solution into a volume defined by the bounded area and the height of the frame, wherein the liquid matrix precursor solution includes a gelling agent and is seeded with selected cells;solidifying the liquid matrix precursor solution to form a matrix; andgrowing the cells in culture.2. The method of claim 1 , further comprising:forming a second TEM segment; andvertically stacking the first TEM segment over the second TEM segment such that the first and the second TEM segments are substantially horizontally aligned with one another, andan upper surface of the matrix of ...

Подробнее
Номер записи: 36
04-03-2021 дата публикации

PROTEINASE-FREE COATINGS FOR COLONY PASSAGING

Номер: US20210062142A1
Автор: Fang Ye, Ferrie Ann MeeJin, Goral Vasiliy Nikolaevich, Henry David, Hervy Martial, Walerack Corinne, Zhou Yue
Принадлежит:

A cell culture article includes a substrate having a polymer coating that is conducive to colony passaging of cells cultured on the coating. Example polymer coatings are formed from polygalacturonic acid (PGA), alginate, or combinations thereof. Cells cultured on the polymer coating can be separated from the substrate as a colony or layer of cells by exposing the polymer coating to (i) a chelating agent, (ii) a proteinase-free enzyme, or (iii) a chelating agent and a proteinase-free enzyme. 18-. (canceled)9. A method for making an article for culturing cells , comprising:forming a polymer coating on a substrate surface, wherein the polymer coating is cross-linked with calcium ions and comprises at least one of polygalacturonic acid (PGA) and alginate; andforming a cell adhesion layer on the polymer coating, the cell adhesion layer comprising at least one of extracellular matrix (ECM) proteins and synthetic molecules.10. The method according to claim 9 , wherein the degree of cross-linking is uniform across the polymer coating thickness.11. (canceled)12. The method according to claim 9 , comprising cross-linking the polymer coating after forming the polymer coating on the substrate.13. (canceled)14. The method according to claim 12 , wherein the degree of cross-linking decreases across the polymer coating thickness in the direction of the substrate.15. A method for culturing cells claim 12 , comprising:forming a polymer coating on a substrate surface, wherein the polymer comprises at least one of PGA and alginate;forming a cell adhesion layer on the polymer coating;culturing cells on the cell adhesion layer; andseparating the cells from the cell adhesion layer as a colony or layer of cells by exposing the polymer coating to (i) a chelating agent, (ii) a proteinase-free enzyme, or (iii) a chelating agent and a proteinase-free enzyme.16. The method according to claim 15 , wherein the chelating agent is EDTA.17. The method according to claim 15 , wherein the proteinase- ...

Подробнее
Номер записи: 37
28-02-2019 дата публикации

COACERVATE MICRO AND/OR NANO DROPLETS AND HYDROGELS

Номер: US20190060467A1
Автор: Alsberg Eben, Jeon Oju, Wolfson David
Принадлежит:

A composition includes a plurality of coacervate micro and/or nanodroplets of oxidized alginate and a methacrylated gelatin. 120-. (canceled)21. A method for promoting tissue growth in a subject comprising:administering a coacervate hydrogel to a target site in the subject, the coacervate hydrogel comprising: crosslinked oxidized alginate and methacrylated gelatin that form a hydrogel matrix and a plurality of coacervate microdroplets and/or nanodroplets suspended in the matrix, wherein the oxidized alginate has an oxidation percentage of at least 10% of uronic acid units of alginate and the methacrylated gelatin has a methacrylation percentage of about 10% to about 99% of amine groups of gelatin.22. The method of claim 21 , wherein at least one bioactive agent is incorporated in the coacervate microdroplets and/or nanodroplets and/or matrix.23. The method of claim 21 , wherein the oxidized alginate has an oxidation percentage of up to 50% of uronic acid units of alginate.24. The method of claim 21 , wherein the oxidized alginate is methacrylated and has a methacrylation percentage up to 45% of alginate carboxylic acid reactive groups.25. The method of claim 22 , wherein the hydrogel matrix includes a plurality of cells and the plurality of coacervate microdroplets and/or nanodroplets provide controlled release of the bioactive agent to the plurality of cells.26. The method of claim 25 , wherein the bioactive agent comprises BMP-2 and the cells comprise hMSCs.27. The method of claim 21 , wherein the coacervate hydrogel is administered to a tissue defect.28. The method of claim 27 , wherein the tissue defect is a bone and/or cartilage defect.29. A method for promoting tissue growth in a subject comprising:administering a coacervate hydrogel to a target site in the subject, the coacervate hydrogel comprising: a crosslinked oxidized methacrylated alginate and a methacrylated gelatin that form a hydrogel matrix and a plurality of coacervate microdroplets and/or ...

Подробнее
Номер записи: 38
10-03-2016 дата публикации

Stem Cell Seeded Natural Substrates and Methods Relating Thereto

Номер: US20160067377A1
Автор: Atkinson Brent L., Bogdansky Simon, Dittman Brian, SHI Yaling, Stilwell Reginald L.
Принадлежит: ALLOSOURCE

This disclosure provides compositions for treating tissue injuries comprising a tissue-derived substrate and mesenchymal stem cells adhered thereto, as well as methods of making and using such compositions. The tissue-derived substrates include bone, cartilage, and collagen matrix. 1. A method of making an allograft composition for treating a soft tissue injury , the method comprising:(a) providing a cell suspension comprising mesenchymal stem cells and non-mesenchymal stem cells derived from tissue obtained from a cadaveric donor;(b) seeding the cell suspension onto an acellular collagen matrix derived from tissue obtained from the cadaveric donor;(c) incubating the acellular collagen matrix seeded with the cell suspension under conditions suitable for adhering the mesenchymal stem cells to the acellular collagen matrix to form a seeded matrix; and(d) rinsing the seeded matrix to remove the non-adherent cells from the seeded matrix, thereby forming the allograft composition comprising the acellular collagen matrix with mesenchymal stem cells adhered thereto.2. The method of claim 1 , wherein the acellular collagen matrix is skin claim 1 , dermis claim 1 , tendon claim 1 , ligament claim 1 , muscle claim 1 , amnion claim 1 , meniscus claim 1 , small intestine submucosa claim 1 , or bladder.3. The method of claim 1 , furthering comprising treating the collagen matrix to reduce immunogenicity prior to seeding the cell suspension.4. The method of claim 3 , wherein treating the collagen matrix to reduce immunogenicity comprises contacting the collagen matrix with a decellularizing agent.5. The method of claim 3 , wherein treating the collagen matrix to reduce immunogenicity comprises removing an epidermis layer without decellularizing the collagen matrix.6. The method of claim 3 , wherein the treated collagen matrix has at least 50% fewer endogenous cells than a corresponding untreated collaged matrix of the same type.7. The method of claim 3 , wherein the treated ...

Подробнее
Номер записи: 39
17-03-2022 дата публикации

Chitin Whisker-Enhanced Hyaluronic Acid Cell Scaffold and Preparation Method Thereof

Номер: US20220081492A1
Автор: Caili Ma, Feifei Wu, Jie Li, Jin Zeng, Kui ZHOU, Shitu Ma
Принадлежит: Hangzhou Singclean Medical Products Co Ltd

Provided are a chitin whisker-enhanced hyaluronic acid cell scaffold and a preparation method thereof. Components of the cell scaffold include chitin whiskers and cross-linked hyaluronic acid. The chitin whisker-enhanced hyaluronic acid cell scaffold is obtained by dispersing chitin whiskers into deionized water using ultrasound, followed by addition of hyaluronic acid and uniform mixing to obtain an aqueous solution, adjusting a pH value of the aqueous solution to be in a range of 4.0 to 6.0, subjecting the aqueous solution to a cross-linking reaction, dialyzing a reaction product in a phosphate buffer solution, and freeze drying a resulting product. The chitin whisker-enhanced hyaluronic acid cell scaffold and the preparation method thereof can increase a mechanical property and a resistance to degradation of a scaffold material and expand an application scope of hyaluronic acid cell scaffolds.

Подробнее
Номер записи: 40
08-03-2018 дата публикации

Hierarchically Structured and Multifunctional Nanofibrous Composite Structure for Soft-Tissue Engineering Applications

Номер: US20180064853A1
Автор: Bagherzadeh Roohollah, KONG Lingxue, Latifi Masoud
Принадлежит:

The disclosed method presents a method of fabrication of wrapped multi-scale nano-to-micro fibrous structures near-similar to extracellular matrix (ECM) structure. The resulting materials finely mingle nano-scale fibers on micro-scale fibers to form a composite structure with defined responsibility of each fiber category for diffident application including soft-tissue engineering. This composite-like structure of the fibrous material may be helpful in cell differential regulation when different cell types are necessary in a tissue. This hierarchically structure of nanofibers, as a cell-adhesive matrix, on the micro-scale fibers, as an elastomeric structural component, present a favorable structure most similar to the natural ECM and therefor acts as a growth factors for recruitment and cell proliferation within the structure. 1. A method for producing a hierarchically structured and manufactured nanofibrous composite structure for soft tissue engineering application comprising the steps of: dissolving two different biocompatible polymers separately in a solvent at different concentration of 12-16% wt/v , creating a polymer blend solution; wherein said polymer blend solution with different volumetric ratio under gentle stirring is prepared for electrospinning; said polymer solution is then fed by a syringe pump at different rates through a nozzle , where a voltage is then applied to said nozzle via a high voltage power; a set of collectors was placed with a predetermined needle-tip to collector distance; creating a nanofibrous scaffold containing both nano-scale and micro-scale fibers , wherein smaller fiber diameter of said scaffold provides a larger surface area-to-volume ratio to bind more cell growth factors; wherein said smaller diameter fibers are more flexible and pliable than larger diameter fibers; therefore cells require less force to migrate within and over said smaller diameter fibers than fibers with said micro-scale fibers.2. The method of claim 1 , ...

Подробнее
Номер записи: 41
08-03-2018 дата публикации

CULTURE SUPPORT HAVING IMPROVED CELL ADHESIVENESS AND MOBILITY

Номер: US20180066226A1
Автор: KOO Song Hee, LEE Ji Hyun, LEE SEUNG HOON, SEO In Yong
Принадлежит:

Provided is a cell culture support having improved cell adhesion and mobility, which includes: a fibrous web which is made by accumulating fibers containing a hydrophilic polymer and a hydrophobic polymer obtained by electrospinning, in which a plurality of pores into which a culture solution is penetrated are formed. 1. A cell culture support having improved cell adhesion and mobility , the cell culture support , which is a support to which cells are attached to culture the cells , the cell culture support comprising:a fibrous web which is made by accumulating fibers containing a hydrophilic polymer and a hydrophobic polymer obtained by electrospinning, in which a plurality of pores into which a culture solution is penetrated are formed.2. The cell culture support having improved cell adhesion and mobility of claim 1 , wherein the fibers contain 60 wt % to 90 wt % of the hydrophilic polymer.3. The cell culture support having improved cell adhesion and mobility of claim 1 , wherein the hydrophilic polymer is PVP or PAN.4. The cell culture support having improved cell adhesion and mobility of claim 1 , wherein the hydrophobic polymer is one of PVdF claim 1 , PU claim 1 , and PES.5. The cell culture support having improved cell adhesion and mobility of claim 1 , wherein the diameters of the fibers range from 100 nm to 10 μm.6. The cell culture support having improved cell adhesion and mobility of claim 1 , further comprising a plurality of beads formed on the fibers in order to secure spaces in which the cells penetrate into the fibrous web and grow therein.7. The cell culture support having improved cell adhesion and mobility of claim 6 , wherein the fibrous web is a web obtained by electrospinning a spinning solution in which the hydrophilic polymer claim 6 , the hydrophobic polymer claim 6 , and a solvent are mixed claim 6 , and a viscosity of the spinning solution ranges from 50 cps to 2000 cps.8. The cell culture support having improved cell adhesion and mobility ...

Подробнее
Номер записи: 42
08-03-2018 дата публикации

Optical-quality surface that imparts spatial control of macrophage fusion

Номер: US20180066234A1
Автор: James Faust, Kyle Doudrick, Robert Ros, Tatiana Ugarova, Wayne Christenson
Принадлежит: Arizona Board of Regents of ASU

Methods to form a surface coating and surface pattern, which are based on adsorption of hydrocarbon chains that can be used with imaging optics to visualize macrophage fusion and multinucleated giant cell formation with living specimens are described.

Подробнее
Номер записи: 43
27-02-2020 дата публикации

BLOOD VESSEL MIMIC AND METHOD FOR CULTURING BLOOD VESSEL MIMIC

Номер: US20200063107A1
Автор: CHO Dong Woo, GAO Ge, KONG Jeong Sik
Принадлежит:

A method for culturing a blood vessel mimic according to an embodiment of the present invention comprises the steps of: printing a lower structure of a chamber; printing a blood vessel mimic on the lower structure; printing an upper structure of the chamber on the lower structure and the blood vessel mimic; connecting, to both ends of the blood vessel mimic, tubes connected to a circulating pump, respectively; and operating the circulating pump to circulate a fluid through the blood vessel mimic. 1. A method for culturing a blood vessel mimic , which comprises the steps of:printing a blood vessel mimic, such that a solution in which calcium ions are dissolved forms a core layer; a tubular first layer that encompasses the core layer is formed using a first bioink in which vascular endothelial cells and alginate are mixed with a decellularized extracellular matrix isolated from a blood vessel tissue; and a tubular second layer that encompasses the first layer is formed using a second bioink, in which smooth muscle cells and alginate are mixed with a decellularized extracellular matrix isolated from a blood vessel tissue;connecting, to both ends of the blood vessel mimic, tubes connected to a circulating pump, respectively; andoperating the circulating pump to circulate a fluid through the blood vessel mimic through the core layer.2. The method of claim 1 , wherein claim 1 , in the printing a blood vessel mimic claim 1 , the first layer and the second layer are crosslinked by reacting with the calcium ions.3. The method of claim 1 , wherein the method further comprises controlling the perfusion pressure of the fluid by controlling the circulating pump claim 1 , such that the first layer is cultured with vascular endothelial cells and the second layer is cultured with smooth muscle cells claim 1 , andthe vascular endothelial cells are arranged such that the flow direction of the fluid becomes the long axis, and the smooth muscle cells are arranged such that a direction ...

Подробнее
Номер записи: 44
09-03-2017 дата публикации

ELECTROPHYSIOLOGICAL RECORDING SYSTEM AND METHODS OF USING SAME

Номер: US20170067015A1
Автор: BAKER Brian, Goldberg Gary S., HARVEY Ian, MONDAL ABHIJIT, MORENO ALONSO P.
Принадлежит:

The disclosure provided herein provides systems, devices, and methods for analyzing cultured cells. Also disclosed herein are systems, devices, and methods for analyzing interactions between two different groups of cells. Also disclosed herein are systems and methods of producing and analyzing a three-dimensional cell culture. 1. A method of forming a three-dimensional cell culture , comprising:positioning a porous membrane having a first surface and an opposed second surface in a substantially planar configuration, the porous membrane defining a first cell culture region disposed on a select portion of the first surface and a second cell culture region disposed on a select portion of the second surface, the porous membrane defining a plurality of pores extending between the first surface and the second surface within the opposed first and second cell culture regions, wherein an electrode array is secured to the porous membrane, the electrode array comprising a plurality of electrodes having distal recording ends that are secured to the porous membrane and extend to the first cell culture region of the porous membrane, and wherein the porous membrane and the electrode array cooperate to form a cell culture structure;applying a first group of cells thereon the first surface of the porous membrane within the first cell culture region;applying a second group of cells thereon the opposed second surface of the porous membrane within the second cell culture region; androlling up the porous membrane and the electrode array to form a three-dimensional cell culture structure having a spiral cross-sectional shape.2. The method of claim 1 , further comprising applying one or more physiological substrates to at least one of the first surface or the second surface of the porous membrane prior to applying the first group of cells and the second group of cells.3. The method of claim 1 , wherein the first group of cells differs from the second group of cells claim 1 , wherein the ...

Подробнее
Номер записи: 45
09-03-2017 дата публикации

Tumor model for breast cancer cell migration studies and related methods

Номер: US20170067025A1
Автор: Feba Sam, Mehdi Nikkhah, Nitish Peela
Принадлежит: Arizona Board of Regents of ASU

A method for creating a tumor model includes encapsulating cancer cells in a first solution, disposing the first solution on a spacer, cross-linking the first solution and creating one or more high stiffness constructs, disposing a second solution around the one or more high stiffness constructs, and cross-linking the second solution and creating a low stiffness matrix surrounding the one or more low stiffness constructs.

Подробнее
Номер записи: 46
12-03-2015 дата публикации

Method For Manufacturing A Three-Dimensional Biomimetic Scaffold And Uses Thereof

Номер: US20150072429A1
Автор: Aguilar Juan Pablo, Mata Chavarria Alvaro
Принадлежит:

The present invention relates to a method for manufacturing a three-dimensional (3D) biomimetic scaffold that exploits the use of electrical fields and electrical insulating materials to pattern previously polymerized hydro gels with different molecules and/or macromolecular entities. The invention also relates to the 3D-biomimetic scaffolds obtained and to the uses and applications thereof. 1. A method for manufacturing a three-dimensional (3D) biomimetic scaffold comprising: (i) a porous membrane placed on the surface of the top of the immobile phase, said porous membrane defining the geometrical regions through which the mobile phase passes;', '(ii) at least a tube inserted into the top of the immobile phase; and', '(iii) a combination of (i) and (ii);, 'a) contacting a mobile phase with an immobile phase through an electrical insulating material containing the mobile phase, said electrical insulating material selected from the group consisting ofb) subjecting said mobile phase and said immobile phase in the presence of the electrical insulating material to a direct current (DC) electric field created inside a chamber and applied in closed circuit by a pair of electrodes in vertical or horizontal configuration, said chamber containing the mobile phase, the immobile phase and the electrical insulating material covered by a buffer; andc) patterning the immobile phase with the components of the mobile phase, in which said components move by forming patterns within the immobile phase and are not separated by their molecular weight and in which the location of the components of the mobile phase is controlled as desired by modulating the electric field and the time;wherein the mobile phase is an aqueous or organic medium comprising at least a charged compound and/or a charged macromolecular entity; andwherein the immobile phase is any previously polymerized hydrogel.2. The method according to claim 1 , wherein the compound of the mobile phase is selected from the group ...

Подробнее
Номер записи: 47
14-03-2019 дата публикации

ADIPOSE TISSUE MATRICES

Номер: US20190076582A1
Автор: Connor Jerome
Принадлежит:

The present disclosure provides tissue products produced from adipose tissues, as well as methods for producing such tissue products. The tissue products can include acellular extracellular matrices. In addition, the present disclosure provides systems and methods for using such products. 1. A tissue product , comprising:a decellularized adipose extracellular tissue matrix, wherein the tissue matrix has been formed into a sponge, and wherein the tissue matrix is partially cross-linked to maintain a porous structure of the sponge.2. The product of claim 1 , wherein the tissue matrix has been processed to remove at least some lipids.3. The product of claim 1 , wherein the tissue matrix is freeze-dried.4. The product of claim 1 , wherein the tissue matrix maintains the porous structure when implanted in a body.5. The product of claim 1 , wherein the tissue matrix maintains the porous structure when contacted with an aqueous environment.6. The product of claim 1 , wherein the tissue matrix maintains the porous structure when compressed.7. The product of claim 1 , wherein the tissue matrix contains hyaluronic acid and chondroitin sulfate.8. A tissue product claim 1 , comprising:an adipose extracellular tissue matrix comprising particles of decellularized adipose tissue formed into a sponge, and wherein the tissue matrix is partially cross-linked to maintain a porous structure of the sponge.9. The product of claim 8 , wherein the particles of decellularized adipose tissue are produced by cutting claim 8 , grinding claim 8 , or blending adipose tissue.10. The product of claim 8 , wherein the particles of decellularized adipose tissue are freeze-dried.11. The product of claim 8 , wherein the tissue matrix maintains the porous structure when implanted in a body.12. The product of claim 8 , wherein the tissue matrix maintains the porous structure when contacted with an aqueous environment.13. The product of claim 8 , wherein the tissue matrix maintains the porous structure ...

Подробнее
Номер записи: 48
26-03-2015 дата публикации

System and Method for Electrospun Biodegradable Scaffold for Bone Repair

Номер: US20150087062A1
Автор: Arinzeh Treena Lynne, Briggs Tamunotonye
Принадлежит:

This invention relates a structure and system for growth factor incorporation which can improve the osteogenic differentiation of hMSCs, for potential bone regeneration and bone growth applications or used alone for bone repair or growth applications. The system comprises a biodegradable polyester, a hydrophilic polymer, a growth factor and optionally a bioceramic. 1. An electrospun composite scaffold comprising a polyester , a hydrophilic polymer and a growth factor or a protein.2. The electrospun composite scaffold of further comprising a bioceramic claim 1 , a non-ionic surfactant or a cationic surfactant.3. The electrospun composite scaffold of wherein the polyester is selected from the group of polylactic acid claim 1 , polyglycolic acid claim 1 , polylactic co-glycolic acid copolymers and polycaprolactone.4. (canceled)5. The electrospun composite scaffold of wherein the hydrophilic polymer is selected from the group of polyethylene oxide claim 1 , polyethylene glycol claim 1 , polyvinyl alcohol claim 1 , glycosaminoglycans claim 1 , chitosan claim 1 , sulfated dextran claim 1 , sulfated cellulose claim 1 , and heparin sulfate.6. (canceled)7. The electrospun composite scaffold of wherein the growth factor is Recombinant human Platelet Derived Growth Factor-BB (PDGF-BB) claim 1 , vascular endothelial factor (VEGF) claim 1 , transforming growth factor-beta (tgf-BETA) or Bone Morphogenetic Protein (BMP).8. The electrospun composite scaffold of wherein the protein is lysozyme.9. The electrospun composite scaffold of wherein the bioceramic is selected from the group of hydroxyapatite claim 2 , tricalcium phosphate claim 2 , biphasic calcium phosphates claim 2 , calcium carbonate claim 2 , calcium sulfate claim 2 , and bioactive glass.10. (canceled)11. (canceled)12. The electrospun composite scaffold of wherein the non-ionic surfactant is Span® 80.13. The electrospun composite scaffold of further comprising a cationic surfactant.14. (canceled)15. An electrospun ...

Подробнее
Номер записи: 49
31-03-2022 дата публикации

HYDROGEL BIOMIMETIC FOR INVASIVE DISEASES

Номер: US20220098547A1
Автор: Shoichet Molly Sandra, SMITH Laura Jean, STANFORD William Lloyd, TAM Roger Yue Ting, YOCKELL-LELIEVRE Julien
Принадлежит:

An extracellular biomimetic for assessing and analyzing cell invasion includes hydrogel matrix and a first peptide crosslinked to the hydrogel matrix, where the first peptide is responsive to a first substance released by diseased cells upon invasion into the biomimetic. The biomimetic further includes at least one modulating agent enabling cell invasion independent from said first substance. The hydrogel matrix can comprise hyaluronate modified with furanyl functional groups, and the modulating agent can be viscoelastic polymer forming reversible crosslinks within the hydrogel matrix. Examples of the viscoelastic polymer include methyl cellulose, or functionalized methyl cellulose, for example, with thiol functional groups. The first substance released by diseased cells is an enzyme, for example, matrix metalloproteinase (MMP). The biomimetic can be used for drug screening to identify compounds that reduce the invasion and viability of the diseased cells, for example, cells from the lung, brain, breast, prostate, and human pluripotent stem cells. 1. An extracellular biomimetic for culturing diseased cells , comprising:hydrogel matrix,a first extracellular matrix protein-mimetic peptide crosslinked to the hydrogel matrix, said first extracellular matrix protein-mimetic peptide being responsive to a first substance released by diseased cells upon invasion into the extracellular biomimetic, andat least one modulating agent enabling cell invasion independent from said first substance.2. The extracellular biomimetic according to claim 1 , wherein the hydrogel matrix comprises hyaluronate or hyaluronic acid claim 1 , modified with furanyl functional groups.3. The extracellular biomimetic according to claim 2 , wherein the furanyl functional groups are furan claim 2 , or furan substituted with alkyl- claim 2 , aryl- claim 2 , or electron-donating functional groups.4. The extracellular biomimetic according to claim 1 , wherein the modulating agent is at least one ...

Подробнее
Номер записи: 50
12-03-2020 дата публикации

Polymeric Carriers and Methods

Номер: US20200080051A1
Автор: ABRAHAM Eytan, Artzi Natalie, Levinson Yonatan, WANG Kui, Zhang Yi
Принадлежит: Massachusetts Institute of Technology

Provided are methods of controlling disassociation of cells from a carrier, compositions, and methods of collecting cells. The methods of controlling disassociation of cells from a carrier may include contacting a polymeric carrier with one or more digesting agents to disassociate at least a portion of a plurality of cells from the polymeric carrier. The polymeric carrier may be crosslinked with a crosslinker including at least one of a redox sensitive moiety, a UV light sensitive moiety, a pH sensitive moiety, and a temperature sensitive moiety. 1. A method of controlling disassociation of cells from a carrier , the method comprising:providing a polymeric carrier and a plurality of cells adhered to the polymeric carrier; andcontacting the polymeric carrier with one or more digesting agents to disassociate at least a portion of the plurality of cells from the polymeric carrier;wherein the polymeric carrier is crosslinked with a crosslinker comprising at least one redox sensitive moiety.2. The method of claim 1 , wherein the at least one redox sensitive moiety comprises a disulfide bond.13. A method of controlling disassociation of cells from a carrier claim 1 , the method comprising:providing a polymeric carrier and a plurality of cells adhered to the polymeric carrier; andcontacting the polymeric carrier with one or more digesting agents to disassociate at least a portion of the plurality of cells from the polymeric carrier;wherein the polymeric carrier is crosslinked with a crosslinker comprising at least one of a UV light sensitive moiety, a pH sensitive moiety, and a temperature sensitive moiety.14. The method of claim 13 , wherein the crosslinker comprises the UV light sensitive moiety claim 13 , and the UV light sensitive moiety is a photoreversibly dimerizable moiety or a photocleavable moiety.19. The method of claim 14 , wherein the crosslinker comprises the photocleavable moiety claim 14 , and the photocleavable moiety comprises an o-nitrobezene based ...

Подробнее
Номер записи: 51
29-03-2018 дата публикации

Photodegradable hydrogel, culture device, method for forming tissue, and method for separating cells

Номер: US20180086883A1
Автор: Fumiki YANAGAWA, Kimio Sumaru, Masato Tamura, Shinji Sugiura, Toshiyuki Kanamori, Toshiyuki Takagi
Принадлежит: National Institute of Advanced Industrial Science and Technology AIST

Provided are a photodegradable hydrogel in which cells can be embedded in the photodegradable gel without causing cytotoxicity when the cells are embedded in the photodegradable gel by allowing the cells to coexist at the time of preparation of the photodegradable gel, and which contains a protein as one of the main components; a culture device using the same; a method for forming tissue; and a method for separating cells. A photodegradable hydrogel is obtained by condensation of an alkyne group contained in a cyclooctyne ring or an azacyclooctyne ring of the following compound A with an azido group of the following compound B. (Compound A) A compound is a photocleavable crosslinker which contains a main chain having a linear type- or a branched type- (of three or more branches) polyethylene glycol structure, a photodegradable nitrobenzyl group disposed at both terminals or a branched terminal of the main chain, and a group having a cyclooctyne ring or an azacyclooctyne ring disposed at a terminal side of the nitrobenzyl group. (Compound B) A compound is an azide-modified protein in which a main chain is a protein and at least some of an amino group present at lysine and arginine side chains of the main chain and an amino group present at a terminal of the main chain are modified with the azido group.

Подробнее
Номер записи: 52
21-03-2019 дата публикации

Three Dimensional Matrix for Cancer Stem Cells

Номер: US20190085298A1
Автор: JABBARI ESMAIEL
Принадлежит:

Synthetic inert 3D gel culture systems are described that can be finely tuned to exhibit desired and predetermined physical, chemical, mechanical, and biochemical properties. The culture system can be utilized to study the effect of microenvironmental factors on cancer cell response, and in particular on cancer stem cell (CSC) response. Cancer cells can be encapsulated in a crosslinked gel system having a narrow range of predetermined gel stiffness. One or more biochemical factors including peptides that can affect the growth, development, and/or proliferation of CSCs can be incorporated in the system to examine the effects of the factor(s) on the encapsulated cells with regard to growth, proliferation, size, etc. 1. A three dimensional hydrogel matrix comprising a crosslinked inert synthetic polymer that is absent of ligands that can interact with cell surface receptors , the hydrogel matrix further comprising a peptide conjugated to the matrix , the three dimensional hydrogel matrix having an elastic modulus of from 2 kilopascals to 70 kilopascals.2. The three dimensional hydrogel matrix of claim 1 , wherein the three dimensional hydrogel matrix has an elastic modulus of from about 2.5 kilopascals to about 10 kilopascals.3. The three dimensional hydrogel matrix of claim 1 , the peptide affecting the growth claim 1 , development claim 1 , and/or proliferation of a cancer stem cell.4. The three dimensional hydrogel matrix of claim 1 , wherein the peptide comprises a CD44 binding peptide or a mutant thereof claim 1 , an integrin binding peptide or a mutant thereof claim 1 , or a heparin binding peptide or a mutant thereof.5. The three dimensional hydrogel matrix of claim 1 , wherein the peptide comprises RLVSYNGIIFFLK (SEQ ID NO.: 17) claim 1 , VLFGFLKIYSRIN (SEQ ID NO.: 18) claim 1 , GRGDS (SEQ ID NO.: 19) claim 1 , GRDGS (SEQ ID NO.: 20) claim 1 , WQPPRARI (SEQ ID NO.: 21) claim 1 , or RPQIPWAR (SEQ ID NO.: 22).6. The three dimensional hydrogel matrix of further ...

Подробнее
Номер записи: 53
05-05-2022 дата публикации

BIOFUNCTIONALIZED HYDROGEL FOR CELL CULTURE

Номер: US20220135953A1
Автор: "OGrady Brian", Balotin Kylie, Bellan Leon M., Lippmann Ethan S.
Принадлежит:

Provided are biomaterials useful for cell culture, method of preparation thereof, and use thereof. The present biomaterial comprises a crosslinked hydrogel and a peptide chemically attached to the hydrogel, wherein the peptide comprises a histidine-alanine-valine (HAV) sequence. In particular, the present biomaterial may be useful for culturing neurons, brain endothelial cells, and/or glial cells, supporting the formation of synaptically connected neural networks, and growing stem cell-derived organoids that more closely resemble human organs.

Подробнее
Номер записи: 54
19-03-2020 дата публикации

METHOD OF MANUFACTURING A CULTURE SUPPORT HAVING IMPROVED CELL ADHESIVENESS AND MOBILITY

Номер: US20200087618A1
Автор: KOO Song Hee, LEE Ji Hyun, LEE SEUNG HOON, SEO In Yong
Принадлежит:

Provided is a method of manufacturing a cell culture support having improved cell adhesion and mobility. The method includes: mixing a hydrophilic polymer, a hydrophobic polymer and a solvent to prepare an electro-spinning solution having a viscosity from 50 cps to 2000 cps; electro-spinning the electro-spinning solution to form polymer fibers having beads formed on each of the fibers; accumulating the polymer fibers to form a fibrous web having pores; and penetrating a culture solution into the pores of the fibrous web. The beads have a diameter larger than that of the polymer fibers. 1. A method of manufacturing a cell culture support having improved cell adhesion and mobility , the method comprising:mixing a hydrophilic polymer, a hydrophobic polymer and a solvent to prepare an electro-spinning solution having a viscosity from 50 cps to 2000 cps;electro-spinning the electro-spinning solution to form polymer fibers having beads formed in each of the polymer fibers;accumulating the polymer fibers to form a fibrous web having pores; andpenetrating a culture solution into the pores of the fibrous web.2. The method of claim 1 , wherein the polymer fibers have a diameter in a range from 100 nm to 10 μm.3. The method of claim 2 , wherein the beads have a diameter larger than that of the polymer fibers.4. The method of claim 1 , wherein the polymer fibers contain 60 wt % to 90 wt % of the hydrophilic polymer.5. The method of claim 1 , wherein the hydrophilic polymer is PVP (polyvinylpyrrolidone) or PAN (polyacrylonitrile).6. The method of claim 1 , wherein the hydrophobic polymer is one of PVdF (polyvinylidene fluoride) claim 1 , PU (polyurethane) claim 1 , and PES (polyethersulfone).7. The method of claim 1 , wherein the solvent is at least one selected from the group consisting of DMAc (N claim 1 ,N-dimethyl acetoamide) claim 1 , DMF (N claim 1 ,N-dimethylformamide) claim 1 , NMP (N-methyl-2-pyrrolidinone) claim 1 , DMSO (dimethyl sulfoxide) claim 1 , THF (tetra- ...

Подробнее
Номер записи: 55
12-05-2022 дата публикации

POROUS CELLULAR SCAFFOLD COMPRISING SERUM-DERIVED PROTEIN, AND PRODUCTION METHOD THEREFOR

Номер: US20220145243A1
Автор: JU Seung Yon
Принадлежит:

Provide are a porous cell scaffold including a serum-induced protein and a method of manufacturing the same. A porous cell scaffold according to an embodiment may stably and continuously incubate cells, show a culture pattern suitable for the characteristics of each cell to simulate actual tissues, and have a stable culture and high in vivo engraftment rate. Accordingly, the porous cell scaffold can be usefully used in the evaluation of drug activity and toxicity using organoids, for use in cell therapy products, or in the production of a target protein. 1. A porous cell scaffold comprising a serum-induced protein obtained in such a manner that a serum or plasma protein aqueous solution is treated with a cross-linking agent to cross-link proteins therein and then a reducing agent is used to cause a reduction reaction.2. The porous cell scaffold of claim 1 , wherein the serum-induced protein is obtained by homogenizing a reaction product after reduction with the reducing agent.3. The porous cell scaffold of claim 1 , wherein the cross-linking agent comprises one selected from dextran dialdehyde claim 1 , 1-ethyl-3-[3-dimethylaminopropyl]carbodiimide hydrochloride claim 1 , vinylamine claim 1 , 2-aminoethyl methacrylate claim 1 , 3-aminopropyl methacrylamide claim 1 , ethylene diamine claim 1 , ethylenfor exampleycol dimethacrylate claim 1 , methyl methacrylate claim 1 , N claim 1 ,N′-methylene-bisacrylamide claim 1 , N claim 1 ,N′-methylenebis-methacrylamide claim 1 , diallyltartardiamide claim 1 , allyl(meth)acrylate claim 1 , lower alkylenfor exampleycol di(meth)acrylate claim 1 , poly lower alkylenfor exampleycol di(meth)acrylate claim 1 , lower alkylene di(meth)acrylate claim 1 , divinyl ether claim 1 , divinyl sulfone claim 1 , divinylbenzene claim 1 , trivinylbenzene claim 1 , trimethylolpropane tri(meth)acrylate claim 1 , pentaerythritol tetra(meth)acrylate claim 1 , bisphenol A di(meth)acrylate claim 1 , methylenebis(meth)acrylamide claim 1 , triallyl ...

Подробнее
Номер записи: 56
12-05-2022 дата публикации

OSTEOPOROSIS MODEL COMPRISING CALCIUM PHOSPHATE HYDROGEL COMPOSITION AND USE THEREOF

Номер: US20220145254A1
Автор: CHA Mi Sun, Kim Jung Ju
Принадлежит:

Provided is a method of preparing a hydrogel composition including a uniform content of calcium phosphate, wherein a hydrogel composition prepared by the method has a uniform content of calcium phosphate, and thus may be used to quantify phosphates contained in the hydrogel composition. Provided is an in-vitro 3D osteoporosis model including a calcium phosphate hydrogel composition, wherein osteoblasts and osteoclasts may be three-dimensionally co-cultured inside a biogel, such that the osteoporosis model may be fabricated according to an intended use or clinical stage. Further, the model contains a calcium phosphate hydrogel with a uniform content of phosphate and thus enables quantification of calcium phosphate through measurement of phosphates, and therefore, the model may be used to screen candidate compounds for an osteoporosis drug and may effectively predict therapeutic effects of the drug on osteoporosis. 1. A method comprising:preparing a first composition by dissolving chitosan in a gelatin solution; preparing a second composition by dispersing calcium phosphate in a calcium chloride solution; andmixing the first composition with the second composition, to thereby prepare a calcium phosphate hydrogel composition.2. The method of preparing a hydrogel composition of claim 1 , further comprising: preparing a hydrogel bead composition by adding dropwise the hydrogel composition into an alkaline solution.3. The method of preparing a hydrogel composition of claim 1 , wherein the chitosan is included in an amount of 0.1 wt % to 10 wt % in the first composition.4. The method of preparing a hydrogel of claim 1 , wherein the calcium phosphate is included in an amount of 0.1 wt % to 10 wt % in the second composition.5. The method of preparing a hydrogel of claim 1 , wherein the preparation of the second composition further comprises conducting sonification subsequent to dispersal of the calcium phosphate in the calcium chloride solution.6. The method of preparing a ...

Подробнее
Номер записи: 57
12-05-2022 дата публикации

CELL CULTURE SCAFFOLD MATERIAL, RESIN FILM, CELL CULTURE VESSEL, AND METHOD FOR CULTURING A CELL

Номер: US20220145263A1
Автор: HANEDA Satoshi, Tomita Yoshiki
Принадлежит: Sekisui Chemical Co., Ltd.

To provide a cell culture scaffold material capable of enhancing adhesiveness of cells. The cell culture scaffold material according to the present invention contains a peptide-conjugated acrylic resin, in which the peptide-conjugated acrylic resin has a first structural part having no peptide portion in a side chain and a second structural part having a peptide portion in a side chain, and solubility parameter calculated by Okitsu's equation for the first structural part is 9.7 (cal/cm)or more and 10.7 (cal/cm)or less. 1. A cell culture scaffold material comprising a peptide-conjugated acrylic resin , whereinthe peptide-conjugated acrylic resin has a first structural part having no peptide portion in a side chain and a second structural part having a peptide portion in a side chain, and{'sup': 3', '1/2', '3', '1/2, "solubility parameter calculated by Okitsu's equation for the first structural part is 9.7 (cal/cm)or more and 10.7 (cal/cm)or less."}2. The cell culture scaffold material according to claim 1 , wherein the first structural part has a poly(meth)acrylic acid ester skeleton.3. The cell culture scaffold material according to claim 1 , wherein the number of amino acid residues in the peptide portion in the second structural part is 10 or less.4. A resin film formed of the cell culture scaffold material according to .5. The resin film according to claim 4 , wherein compressive elastic modulus at a frequency of 1 Hz measured in ion exchange water after immersing the resin film in the ion exchange water at 37° C. for 24 hours in accordance with ISO14577-1 using a nanoindenter device is 1 GPa or more.6. The resin film according to claim 4 , which has a water swelling ratio of 70% or less.7. The resin film according to claim 4 , which has a sea-island structure claim 4 , wherein an island portion in the sea-island structure contains the peptide portion.8. A cell culture vessel equipped with the resin film according to in at least a part of cell culture area.9. A ...

Подробнее
Номер записи: 58
28-03-2019 дата публикации

POLYPEPTIDE COPOLYMER, POROUS FIBROUS SCAFFOLD INCLUDING THE SAME AND METHOD FOR NERVE REGENERATION OR GROWTH

Номер: US20190092902A1
Автор: CHEN Ta-Ching, SU WEI-FANG
Принадлежит:

A polypeptide copolymer, a preparation method thereof, a porous fibrous scaffold including the same, and a method for nerve regeneration or growth are disclosed. The polypeptide copolymer comprises: a glutamate unit; and a glutamic acid unit, wherein a ratio of a content of the glutamic acid unit to a content of the glutamate unit is in a range from 10:90 to 90:10. 1. A polypeptide copolymer , comprising: a glutamate unit; and a glutamic acid unit; wherein a ratio of a content of the glutamic acid unit to a content of the glutamate unit is in a range from 10:90 to 90:10.2. The polypeptide copolymer according to claim 1 , wherein the ratio of the content of the glutamic acid unit to the content of the glutamate unit is in a range from 10:90 to 40:60.3. The polypeptide copolymer according to claim 1 , wherein the ratio of the content of the glutamic acid unit to the content of the glutamate unit is in a range from 15:85 to 40:60.4. The polypeptide copolymer according to claim 1 , wherein the polypeptide copolymer is a random copolymer.5. The polypeptide copolymer according to claim 1 , wherein the weight average molecular weight of the polypeptide copolymer is in a range from 100 kDa to 500 kDa.6. The polypeptide copolymer according to claim 1 , wherein the glutamate unit is a benzyl glutamate unit.7. A porous fibrous scaffold claim 1 , comprising a polypeptide copolymer claim 1 , which comprises: a glutamate unit; and a glutamic acid unit; wherein a ratio of a content of the glutamic acid unit to a content of the glutamate unit is in a range from 10:90 to 90:10.8. The porous fibrous scaffold according to claim 13 , wherein the porous fibrous scaffold is obtained from the polypeptide copolymer by electrospinning.9. The porous fibrous scaffold according to claim 13 , wherein the porous fibrous scaffold has a structure of unidirectional arrangement.10. The porous fibrous scaffold according to claim 13 , wherein the ratio of the content of the glutamic acid unit to the ...

Подробнее
Номер записи: 59
26-06-2014 дата публикации

Continuous culturing device

Номер: US20140178448A1
Автор: Francesco Curcio
Принадлежит: VIVABIOCELL SPA

A continuous device for culturing mammalian cells in a three-dimensional structure for the transplantation or implantation in vivo is described. The culturing device comprises (a) a scaffold formed by a matrix of interconnected growth surfaces spaced at regular intervals and (b) a fluid distribution means at the inlet and the exit of the growth areas. The device is particularly useful for culturing bone cells for dental implants or bone reconstruction.

Подробнее
Номер записи: 60
13-04-2017 дата публикации

CULTURED CELL LEAFLET MATERIAL

Номер: US20170100237A1
Автор: Anderson-Cunanan Crystal Marie, EPPIHIMER MICHAEL, Fazackerley Katherine Cora, KENWOOD SHANNON SMITH, Lavery Karen Suzanne, Sushkova Natalia P.
Принадлежит:

A prosthetic heart valve provided herein can include a cultured cell tissue leaflet. In some cases, a prosthetic heart valve can include a plurality of leaflets secured together and retained within the expandable tubular member. The cultured cell tissue can be obtained by culturing fibroblast cells, smooth muscle cells, or a combination thereof to form a sheet of cultured cells and chemically cross-linking the fibroblast cells while under tension. In some cases, the cultured cell tissue can be radially tensioned. In some cases, the cultured cell tissue can be bi-axially tensioned. 1. A prosthetic heart valve comprising a plurality of leaflets secured together and retained within the expandable tubular member , each leaflet comprising radially or biaxially oriented and chemically cross-linked cultured cell tissue material.2. The prosthetic heart valve of claim 1 , wherein the cultured cell material is cultured from fibroblast cells.3. The prosthetic heart valve of claim 2 , wherein the fibroblast cells are dermal fibroblast cells.4. The prosthetic heart valve of claim 3 , wherein the dermal fibroblast cells are bovine dermal fibroblast cells.5. The prosthetic heart valve of claim 1 , wherein the cultured cell material is cultured from cells including smooth muscle cells.6. The prosthetic heart valve of claim 5 , wherein the smooth muscle cells are bovine smooth muscle cells.7. The prosthetic heart valve of claim 1 , wherein the cultured cell material is cultured from a mixture of fibroblasts and smooth muscle cells.8. The prosthetic heart valve of claim 7 , wherein the fibroblast cells and fibroblast cells are in a ratio of between 20:80 and 80:20.9. The prosthetic heart valve of claim 1 , wherein the cultured cell tissue is cross-linked with glutaraldehyde.10. The prosthetic heart valve of claim 1 , wherein the cultured cells are cultured for at least 3 weeks.11. The prosthetic heart valve of claim 10 , wherein the cultured cells are cultured for at least 5 weeks.12 ...

Подробнее
Номер записи: 61
21-04-2016 дата публикации

METAL-COATED SCAFFOLDS FOR TISSUE ENGINEERING

Номер: US20160106886A1
Автор: Dvir Tal, MAOZ Ben M., SHEVACH Michal
Принадлежит:

Metal nanoparticle-coated scaffolds are provided for use in tissue engineering. 1. A composition of matter comprising viable cells seeded on a scaffold , wherein an outer surface of said scaffold comprises a coating of metal nanoparticles and wherein more than 50% of said metal nanoparticles are positioned on said outer surface of said scaffold.2. A scaffold comprising fibers of decellularized extracellular matrix (ECM) , wherein an outer surface of said scaffold comprises a coating of metal nanoparticles , with the proviso that said metal nanoparticles are not crosslinked to said scaffold.3. A scaffold comprising decellularized omentum , wherein an outer surface of said scaffold comprises a coating of metal nanoparticles.4. The composition of matter or scaffold of claim 1 , wherein said metal nanoparticles comprise gold nanoparticles.5. The composition of matter of claim 1 , wherein said cells comprise electrically excitable cells.6. The composition of matter of claim 1 , wherein said scaffold comprises fibers.7. The composition of matter or scaffold of claim 1 , wherein said coating is between 2-20 nm in thickness.8. (canceled)9. The composition of matter of claim 6 , wherein said fibers comprise electrospun fibers.10. The composition of matter of claim 6 , wherein said fibers comprise a non-biodegradable polymer.11. The composition of matter of claim 1 , wherein said scaffold comprises decellularized extracellular matrix (ECM).12. The composition of matter of claim 6 , wherein said fibers comprise a biodegradable polymer.13. The composition of matter of claim 12 , wherein said biodegradable polymer is selected from the group consisting of polycaprolactone (PCL) claim 12 , polylactic acid (PLA) claim 12 , polyglycolic acid (PGA) claim 12 , and poly(Lactide-co-Glycolide) (PLGA).14. The composition of matter of claim 12 , further comprising an adhesive agent.15. The composition of matter of claim 14 , wherein said adhesive agent is selected from the group consisting ...

Подробнее
Номер записи: 62
19-04-2018 дата публикации

ARTIFICIAL DESCEMET'S MEMBRANE

Номер: US20180104046A1
Автор: GUTERMUTH Angela
Принадлежит: FRAUNHOFER-GESELLSCHAFT ZUR FORDERUNG DER ANGEWANDTEN FORSCHUNG E.V.

The invention relates to methods and means for synthesizing endothelial tissue of the cornea and is directed to a structured artificial construct that allows corneal endothelium to be regenerated from isolated cells outside the human or animal body. 1. An artificial Descemet construct for mechanotransductive differentiation of biological cells into de novo corneal endothelial tissue , wherein the construct is formed from a dome-shaped base body with a honeycomb structure formed in a concave side of the base body.2. The construct according to claim 1 , wherein the honeycomb structure is formed from repetitive base elements with a central recess and lateral webs claim 1 , a web height being 0.3 to 1 μm claim 1 , a web width being 1 to 8 μm claim 1 , and a width of the central recess enclosed by the webs being in each case from 10 to 20 μm.3. The construct according to claim 2 , wherein the honeycomb structure is formed of repetitive primitives of substantially equal size.4: The construct according to claim 2 , wherein the honeycomb structure is formed from repetitive basic elements of different sizes for a quasi-stochastic distribution of the sizes of the basic elements in the honeycomb structure.5. The construct according to claim 2 , wherein the basic elements each have a hexagonal basic shape.6. The construct according to claim 1 , wherein the construct is a biocompatible polymer.7. The Descemet construct of in combination with an in vitro implant claim 1 , the implant further comprising corneal endothelial tissue formed from isolated cells.9. The method according to claim 8 , wherein the formation of the spatial honeycomb structure includes:producing a negative form of the honeycomb structure by one of the microstructuring processes, and subsequentlyforming the honeycomb structure in a biocompatible or biological polymer by casting or embossing by the produced negative form.10. Use of the artificial Descemet construct according to for mechanotransductive ...

Подробнее
Номер записи: 63
21-04-2016 дата публикации

METHOD OF ASSEMBLING A 3D TISSUE CULTURING SCAFFOLD

Номер: US20160108358A1
Автор: CURCIO Francesco
Принадлежит:

A continuous device for culturing mammalian cells in a three-dimensional structure for the transplantation or implantation in vivo is described. The culturing device comprises (a) a scaffold formed by a matrix of interconnected growth surfaces spaced at regular intervals and (b) a fluid distribution means at the inlet and the exit of the growth areas. The device is particularly useful for culturing bone cells for dental implants or bone reconstruction. 1. A method of assembling a 3D tissue culturing scaffold comprising:defining a 3D matrix of interconnected growth surfaces of a 3D tissue culture scaffold having regular and repetitive 3D structures defining open spaces along x, y, and z Cartesian axes;varying parameters associated with the dimensions of the open spaces;optimizing flow by computationally analyzing fluid flow distribution throughout the defined scaffold based on the varied parameters to establish optimum open space dimensions; andproducing the tissue culture scaffold according to the optimum open space dimension by assembling 2D layers over each other.2. The method of claim 1 , wherein the step of optimizing includes arranging spacing of open spaces to permit uniform directional flow.3. The method of claim 1 , wherein the step of optimizing includes calculating shear force of the fluid flow distribution on the 3D structures to determine solidity to the 3D tissue culture scaffold.4. The method of claim 1 , further comprising adjusting channels of the open spaces to facilitate uniform flow distribution to the growth surfaces.5. The method of claim 1 , wherein the 3D structures forming the matrix have at least one of the following shapes: cylindrical shape claim 1 , rectangular shape claim 1 , and hexagonal shape.6. The method of claim 1 , wherein the growth surfaces comprise solid cylindrical structures.7. The method of claim 1 , wherein the growth surfaces are textured.8. The method of claim 1 , wherein the optimum open space dimensions fall within the ...

Подробнее
Номер записи: 64
03-07-2014 дата публикации

Cell carrier, associated methods for making cell carrier and culturing cells using the same

Номер: US20140186946A1
Автор: Andrew Arthur Paul Burns, Brian Michael Davis, David Gilles Gascoyne, Evelina Roxana Loghin, Kenneth Roger Conway
Принадлежит: General Electric Co

A carrier for expansion of pluripotent stem cells is provided, wherein the carrier comprises a substrate comprising one or more outer surfaces, wherein the one or more outer surfaces are modified with gas plasma treatment, and one or more structured indentations on one or more of the outer surfaces. The carrier has a length at least about 0.2 mm, a width at least about 0.2 mm, and a height in a range from about 0.05 mm to 1.2 mm and each of the structured indentations has a major axis in a range from about 0.1 mm to 0.5 mm, a minor axis in a range from about 0.1 mm to 0.5 mm and a depth in a range from about 0.025 mm to about 0.5 mm. A method of making the carrier, and culturing stromal cells using the same carrier are also provided.

Подробнее
Номер записи: 65
30-04-2015 дата публикации

EXTRACELLULAR MATRIX-SYNTHETIC SKIN SCAFFOLD

Номер: US20150118308A1
Автор: Dye Julian F.
Принадлежит:

The present invention provides a process or preparing an extracellular matrix composition which comprises: (a) mixing an aqueous solution of fibrinogen with a coagulating agent and a bulking agent and a foaming agent; (b) causing the mixture to foam and coagulate; (c) incubating the mixture obtained in step (b) with a cross-linking agent; and (d) washing the cross-linked composition obtained in step (c) to remove the cross-linking agent. Wherein the foaming agent consists of or comprises one or more surfactant agent(s) from the class of sugar-surfactants. The invention also relates to the formulation mixture as such, and to the products of the process. 1. A process for preparing an extracellular matrix composition which comprises:(a) mixing an aqueous solution of fibrinogen with a coagulating agent and a bulking agent and a foaming agent;(b) causing the mixture to foam and coagulate;(c) incubating the mixture obtained in step (b) with a cross-linking agent; and(d) washing the cross-linked composition obtained in step (c) to remove the cross-linking agentwherein the foaming agent consists of or comprises one or more surfactant agent(s) from the class of sugar-surfactants.2. A process according to wherein the fibrinogen is present at a purity level of greater than one of 75% claim 1 , 80% claim 1 , 85% claim 1 , 90% claim 1 , 95% claim 1 , 97% or 99%.3. A process according to wherein the aqueous solution of fibrinogen is essentially free of other protein.4. A process according to wherein fibrinogen is present as truncated forms of fibrinogen claim 1 , such as fibrin A claim 1 , fibrin B claim 1 , fibrin C claim 1 , fibrin D claim 1 , fibrin X and fibrin Y.5. A process according to wherein the truncated form of fibrinogen is fibrin E.6. A process according to wherein fibrinogen is present as an aqueous solution buffered to a pH of between 4 and 10 claim 1 , wherein preferably the buffer is MES/NaCl or HEPES buffered saline.7. A process according to wherein the mixture ...

Подробнее
Номер записи: 66
27-04-2017 дата публикации

Porous Polymer Scaffold Useful for Tissue Engineering in Stem Cell Transplantation

Номер: US20170112960A1
Автор: BAR Nimai, BASAK Pratyay, Das Amitava, DHOKE Neha Raghuvir, GEESALA Ramasatyaveni, KAUSHIK Komal
Принадлежит: COUNCIL OF SCIENTIFIC & INDUSTRIAL RESEARCH

The present invention relates to the synthesis of porous polymer scaffold from polyethyleneglycol-polyurethane having castor oil linkages under controlled conditions and their use as stem cell delivery vehicles thereby accelerating the tissue regeneration process. The present invention further studies the biodegradability, stability and biocompatibility of porous polymer scaffolds in varios cell lines and primary bone marrow stem cells. Particularly the present invention further relates to the physio-chemical characterization of the porous polymer scaffolds. 1. A porous polymer scaffold for tissue engineering in stem cell transplantation consisting of a crosslinker , polyether backbone , an isocyanate containing compound , and a secondary component.2. The porous polymer scaffold of claim 1 , wherein the crosslinker is a triglyceride selected from the group consisting of castor oil claim 1 , palm oil claim 1 , soybean oil claim 1 , cotton seed oil claim 1 , and linseed oil.3. The porous polymer scaffold of claim 2 , wherein the crosslinker is a triglyceride of castor oil.4. The porous polymer scaffold of claim 1 , wherein the polyether backbone is selected from the group consisting of di-hydroxyl claim 1 , di-amine claim 1 , and di-carboxyl terminated compounds.5. The porous polymer scaffold of claim 1 , wherein the polyether backbone is selected from the group consisting of polyethylene glycol (PEG) claim 1 , polypropylene glycol (PPG) claim 1 , polytetramethylene glycol (PTMG) claim 1 , block copolymers thereof claim 1 , branched/graft copolymers thereof claim 1 , and combinations thereof.6. The porous polymer scaffold of claim 5 , wherein the polyether backbone is polyethylene glycol (PEG) with molecular weight of 400-10000 Daltons.7. The porous polymer scaffold of claim 1 , wherein the isocyanate containing compound is selected from the group consisting of methylene diphenylene diisocyanate (MDI) claim 1 , polymeric methylene diphenylene diisocyanate (p-MDI) ...

Подробнее
Номер записи: 67
13-05-2021 дата публикации

CARRIER FOR CELL CULTURING AND A METHOD OF PREPARATION THEREOF

Номер: US20210138454A1
Автор: Jancar Josef, Vojtova Lucy
Принадлежит: LYOPOR, s.r.o.

A carrier for cell culturing that contains a multiwell plate, where at least one of the wells of the multiwell plate has a porous substrate having the porosity of ≥90% and adapted for cell culturing, and the porous substrate adheres to the surface of the well. A method for preparation of the carrier for cell culturing is also provided. 1. A carrier for cell culturing , which contains a multiwell plate , wherein at least one of the wells of the said multiwell plate contains a porous substrate , preferably having the porosity of ≥90% and adapted for cell culturing , and wherein the said porous substrate adheres to the surface of the said well.2. The carrier according to claim 1 , wherein the porous substrate is provided in at least 25% of the wells claim 1 , more preferably in at least 50% of the wells or in all the wells of the multiwell plate.3. The carrier according to claim 1 , wherein the multiwell plate is made of a material selected from the group consisting of plastics claim 1 , glass claim 1 , ceramics claim 1 , metals claim 1 , and combinations of these materials.4. The carrier according to claim 1 , wherein the porous substrate is composed of at least two layers which differ mutually in at least one of: material composition claim 1 , presence or absence of additives claim 1 , composition of additives claim 1 , porosity claim 1 , pore size claim 1 , pore connectivity.5. The carrier according to claim 1 , wherein the pore size of the porous substrate is within the range from 0.1 to 1000 μm claim 1 , preferably between 5 and 1000 μm or between 100 and 2000 nm or within the range from 50 to 600 μm.6. The carrier according to claim 1 , wherein the material of the porous substrate is selected from the group consisting of proteins of the extracellular matrix (ECM); structural proteins such as collagens claim 1 , fibrin claim 1 , silk fibroin claim 1 , elastin or gelatine; polysaccharides such as hyaluronic acid and its derivatives claim 1 , chitosan and its ...

Подробнее
Номер записи: 68
27-04-2017 дата публикации

ENGINEERED SUBSTRATES FOR HIGH-THROUGHPUT GENERATION OF 3D MODELS OF TUMOR DORMANCY, RELAPSE AND MICROMETASTASES FOR PHENOTYPE SPECIFIC DRUG DISCOVERY AND DEVELOPMENT

Номер: US20170115275A1
Автор: Grandhi Taraka Sai Pavan, Potta Thrimoorthy, Rege Kaushal
Принадлежит: Arizona Board of Regents on behalf of Arizona State University

Methods to form a novel aminoglycoside based hydrogel for high-throughput generation of 3D dormant, relapsed and micrometastatic tumor microenvironments are disclosed. In addition, methods of screening agents against tumor cells grown in the 3D environments disclosed herein that include, for example, screening of lead drugs and therapies for an effect on dormant, relapsed and/or micrometastatic tumor cells. 2. The hydrogel of claim 1 , wherein a mole ratio between said aminoglycoside and said polymeric compound is from about 1:1.5 to 1:3.3. The hydrogel of claim 1 , wherein said aminoglycoside is (2S)-4-amino-N-[(1R claim 1 ,2S claim 1 ,3S claim 1 ,4R claim 1 ,5 S)-5-amino-2-[(2S claim 1 ,3R claim 1 ,4S claim 1 ,5S claim 1 ,6R)-4-amino-3 claim 1 ,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-4-[(2R claim 1 ,3R claim 1 ,4S claim 1 ,5S claim 1 ,6R)-6-(aminomethyl)-3 claim 1 ,4 claim 1 ,5-trihydroxyoxan-2-yl]oxy-3-hydroxycyclohexyl]-2-hydroxybutanamide claim 1 , and/or salt or hydrate thereof.7. The hydrogel of claim 2 , further comprising a mechanical stiffness of about 7 kilopascals (KPa) to about 100 KPa.8. The hydrogel of claim 2 , further comprising a non-adhesive surface.9. A method to generate a 3D tumor microenvironment (3DTM) using the cross-linked hydrogel of claim 1 , comprising overlaying a first plurality of cancer cells and culturing said cancer cells under conditions and for a duration sufficient to form a spheroidal 3DTM.10. The method of claim 9 , wherein the plurality of cancer cells comprises a seeding density of 1 claim 9 ,000 to 50 claim 9 ,000 cells.11. The method of claim 9 , wherein a size of the spheroidal 3DTM is dependent on the seeding density of the plurality of cancer cells.12. The method of claim 9 , wherein the plurality of cancer cells is selected from the group consisting of T24 bladder cancer cells claim 9 , PC3 prostate cancer cells claim 9 , PC3-eGFP prostate cancer cells claim 9 , and MDA-MB-231 breast cancer cells.13. The method of ...

Подробнее
Номер записи: 69
09-04-2020 дата публикации

Visible light polymerization of polyethylene glycol (peg) hydrogels

Номер: US20200109372A1
Автор: Andrew Khalil, Connie STECHMANN LEBAKKEN, William L. Murphy
Принадлежит: Stem Pharm Inc

Provided herein are compositions and methods for generating visible light photopolymerized hydrogels to support cell viability, expansion, and encapsulation. The present disclosure provides a composition, comprising a visible light harvesting complex, a photoinitiator, a co-initiator, a di-thiol-terminated crosslinker, and at least one cysteine-containing peptide. The present disclosure provides a method of generating a visible light photopolymerized hydrogel. In further embodiments that method comprises generating a 3-dimensional endothelial network comprising the visible light photopolymerized hydrogel. In additional embodiments the method comprises generating a hydrogel network comprising the visible light photopolymerized hydrogel comprising at least one cell.

Подробнее
Номер записи: 70
07-05-2015 дата публикации

CELLULAR RESPONSE TO SURFACE WITH NANOSCALE HETEROGENEOUS RIGIDITY

Номер: US20150125957A1
Автор: Biggs Manus J.P., Cooper Ryan, Dahlberg Carl Fredrik Oskar, Fazio Teresa Anne, Kysar Jeffrey William, Liao Jinyu, Wind Shalom Jonas
Принадлежит:

An elastomeric substrate comprises a surface with regions of heterogeneous rigidity, wherein the regions are formed by exposing the elastomeric substrate to an energy source to form the regions such that the regions include a rigidity pattern comprising spots. 1. An elastomeric substrate comprising a surface with regions of heterogeneous rigidity , wherein the regions are formed by exposing the elastomeric substrate to an energy source to form the regions such that the regions include a rigidity pattern comprising spots.2. The elastomeric substrate of claim 1 , wherein the regions provide for a differential functional response from cells cultured upon the rigidity pattern of the regions.3. The elastomeric substrate of claim 2 , wherein the differential functional response comprises at least one of: differential focal adhesion of the cells; differential cell differentiation of the cells; differential immune response; or growth of the cells.4. The elastomeric substrate of claim 2 , wherein the cells comprise at least one of stem cells claim 2 , T-cells claim 2 , cancer cells claim 2 , nerve cells claim 2 , osteoblasts claim 2 , and muscle cells.5. The elastomeric substrate of claim 2 , wherein at least some of the spots include a lateral dimension that is greater than or equal to 250 nanometers.6. The elastomeric substrate of claim 2 , wherein at least some of the spots include a lateral dimension that is less than or equal to 250 nanometers.7. The elastomeric substrate of claim 1 , wherein the energy source comprises at least one of a focused electron beam or deep ultraviolet light.8. The elastomeric substrate of claim 1 , wherein the elastomeric substrate comprises poly(dimethylsiloxane) or a poly(dimethylsiloxane)-based polymer.9. The elastomeric substrate of claim 1 , wherein the regions of heterogeneous rigidity are formed at at least one of a microscale or a nanoscale so that the spots comprise micrometer or submicrometer scale spots.10. A method of culturing ...

Подробнее
Номер записи: 71
25-04-2019 дата публикации

PHOTOPOLYMER COMPOSITION AND APPLICATION THEREOF

Номер: US20190119429A1
Автор: Lin Yuan-Min, SU Jiun-Ming
Принадлежит:

The present disclosure provides a photopolymer composition and the applications thereof. The photopolymer composition comprises: 5 weight percent to 15 weight percent of gelatin methacrylate (GelMA), 0.1 weight percent to 5 weight percent of silanized biologically active additive, 0.1 weight percent to 5 weight percent of photoinitiator, and 75 weight percent to 95 weight percent of a solvent. Compared to a conventional hydrogel, the hydrogel prepared from the photopolymer composition of the present disclosure has improved compressive strength, mechanical strength and stability. Accordingly, the hydrogel is applicable to biomedical research and tissue repair. 1. A photopolymer composition , comprising:5 weight percent to 15 weight percent of gelatin methacrylate (GelMA);0.1 weight percent to 5 weight percent of silanized biologically active additive;75.1 weight percent to 5 weight percent of photoinitiator; and75 weight percent to 95 weight percent of a solvent.2. The photopolymer composition according to claim 1 , wherein the silanized biologically active additive comprises silanized hydroxyapatite claim 1 , silanized β-tricalcium phosphate (β-TCP) or silanized bio-active glass.3. The photopolymer composition according to claim 1 , the photoinitiator comprises 2 claim 1 ,2′-Azobis[2-Methyl-N-(2-hydroxyethyl) propionamide].4. The photopolymer composition according to claim 1 , wherein the photoinitiator can be excited by light with wavelength in a range from 400 nm to 800 nm so as to induce photopolymerization.5. The photopolymer composition according to claim 1 , wherein the solvent comprises water claim 1 , phosphate buffered saline (PBS) claim 1 , conditioned media from cell line or cell culture media.6. A three-dimensional cell culture media claim 1 , comprising the photopolymer composition according to .7. A tissue repair composition claim 1 , comprising the photopolymer composition according to .8. A method for preparing a three-dimensional cell culture media ...

Подробнее
Номер записи: 72
16-04-2020 дата публикации

COMPOSITIONS AND METHODS OF MAKING AND USING PROTEIN-FUNCTIONALIZED HYDROGELS

Номер: US20200115675A1
Автор: PATHAK Amit, Sarker Bapi
Принадлежит: WASHINGTON UNIVERSITY

Among the various aspects of the present disclosure is the provision of a hydrogel-based substrate comprising an aldehyde-containing component, such as N-ethanal acrylamide. The hydrogel component allows for functionalization of a hydrogel through conjugation of proteins (e.g., collagen) to the hydrogel in the absence of a post hoc crosslinking component. 1. A substrate comprising a polyacrylamide (PA) hydrogel comprising an aldehyde-containing acrylamide suitable for protein functionalization , wherein protein functionalization of the PA hydrogel enables protein fiber formation of a tunable protein fiber length.3. The substrate of claim 1 , wherein the PA hydrogel further comprises an acrylamide co-polymer and a bis-acrylamide monomer crosslinker.4. The substrate of claim 1 , wherein the PA hydrogel comprises:(i) between about 1% and about 20% acrylamide by volume;(ii) between about 0.05% and about 5% bis-acrylamide by volume; or "the PA hydrogel has a Young's modulus or stiffness between about 0.1 kPa and about 200 kPa.", '(iii) between about 0.5% and about 2% N-ethanal acrylamide by volume, wherein,'}5. The substrate of claim 1 , wherein an extracellular matrix (ECM) protein claim 1 , optionally collagen claim 1 , comprising an N-termini (ϵ-amino groups) region claim 1 , is bound to an aldehyde group of the aldehyde-containing acrylamide.6. The substrate of claim 1 , wherein the substrate does not comprise an intermediate post hoc crosslinker claim 1 , optionally claim 1 , sulfosuccinimidyl 6-[4′-azido-2′-nitro-phenylamino]hexanoate (sulfo-SANPAH) claim 1 , or N-Hydroxysuccinimide (NHS)-ethyl (dimethylaminopropyl) carbodiimide (EDC) for protein functionalization.7. The substrate of claim 1 , wherein(i) the tunable protein fiber length average is between about 0.1 μm and 100 μm; or(ii) the substrate is a stiff substrate if a Young's moduli of the substrate is more than about 2 kPa or the substrate is a soft substrate if a Young's moduli of the substrate is less ...

Подробнее
Номер записи: 73
14-05-2015 дата публикации

ENCAPSULATION AND CARDIAC DIFFERENTIATION OF hiPSCs IN 3D PEG-FIBRINOGEN HYDROGELS

Номер: US20150132847A1
Автор: Hodge Alexander J., Kerscher Petra, Lipke Elizabeth A.
Принадлежит:

The present invention relates to the production of cell cultures and tissues from undifferentiated pluripotent stem cells using three-dimensional biomimetic materials. The resultant cell cultures or tissues can be used in any of a number of protocols including testing chemicals, compounds, and drugs. Further, the methods and compositions of the present invention further provide viable cell sources and novel cell delivery platforms that allow for replacement of diseased tissue and engraftment of new cardiomyocytes from a readily available in vitro source. The present invention includes novel methods required for the successful production of cell cultures and tissues, systems and components used for the same, and methods of using the resultant cell and tissue compositions. 1. A method of producing a three-dimensional cell culture or tissue comprising:combining a population of pluripotent stem cells (PSCs) with a biomimetic material to form a biomimetic-PSC suspension;treating said biomimetic-PSC suspension to produce a three-dimensional biomimetic-PSC microenvironment; andculturing said biomimetic-PSC microenvironment to differentiate the PSCs into at least one type of somatic cell.2. The method of wherein the biomimetic material is a hydrogel.3. The method of wherein the hydrogel is a covalently-linkable hydrogel.4. The method of wherein the covalently-linkable hydrogel is a PEG-based hydrogel.5. The method of wherein the PEG-based hydrogel comprises PEG-fibrinogen.6. The method of wherein said treating said biomimetic-PSC suspension further comprises placing said biomimetic-PSC suspension into a mold.7. The method of wherein said microenvironment is selected from the group consisting of microislands claim 1 , cardiac discs claim 1 , strings claim 1 , macrotissues claim 1 , and microspheres claim 1 , and combinations thereof.8. The method of wherein said treating said biomimetic-PSC suspension to produce a three-dimensional biomimetic-PSC microenvironment comprises ...

Подробнее
Номер записи: 74
01-09-2022 дата публикации

MEMBRANE AND METHOD FOR CULTURE AND DIFFERENTIATION OF CELLS

Номер: US20220275319A1
Автор: CUI Chang, Wang Jiaxian, WANG Pengyuan
Принадлежит:

Provided is a membrane for cell culture and differentiation. The membrane comprises a base portion and an array of protrusions consisting of a plurality of protrusions. The protrusions are substantially evenly distributed on the base portion. The plurality of protrusions has dimensions on the order of micrometers. In particular, the membrane consists of particles of different particle sizes of two or more types. One type of particles has an average particle size of 1 μm to 50 μm. Two or more types of particles of different particle sizes include nanoscale particles, 10-900 nm. One type of particle is selected from the group consisting of inorganic compound microspheres. The other type of particles of the two or more types of particles of different particle sizes is selected from the group consisting of organic polymer nanospheres. Also provided is a method for maintaining, culturing and/or differentiating cells using such membrane. 1. A method for culture and/or differentiation of human induced pluripotent stem cells (hiPSCs) , comprising culturing and/or differentiating the hiPSCs on a membrane comprising:a base portion; anda protrusion array composed of a plurality of protrusions, the plurality of protrusions being substantially uniformly distributed on the base portion, and the plurality of protrusions having a size on the order of micrometers.2. The method according to claim 1 , wherein the cells comprise at least one selected from the group consisting of induced pluripotent stem cells (iPSCs) claim 1 , embryonic stem cells (ESCs) claim 1 , and adult stem cells.3. The method according to claim 1 , wherein the cells comprise at least one selected from the group consisting of bone marrow mesenchymal stem cells (BMSCs) claim 1 , hematopoietic stem cells (HSCs) claim 1 , neural stem cells (NSCs) claim 1 , adipose stem cells (ASCs) claim 1 , placental stem cells claim 1 , placental sub-totipotent stem cells claim 1 , and amniotic stem cells.4. The method according to ...

Подробнее
Номер записи: 75
19-05-2016 дата публикации

DEVICE AND METHOD FOR COMPRESSING A HYDROGEL

Номер: US20160136333A1
Автор: REICHMANN Ernst
Принадлежит:

The invention relates to a device and a method for compressing a hydrogel layer (H), wherein a separate piston () that is designed to be connected to a second component () of the device in a releasable manner in an operating mode of the device, particularly by means of a latching connection, presses along a compression direction (C) against said hydrogel layer (H) residing on a membrane bottom () of a graft frame () so as to compress the hydrogel layer (H) between the piston () and the membrane bottom ().

Подробнее
Номер записи: 76
03-06-2021 дата публикации

Methods and compositions for t cell activation

Номер: US20210163894A1
Автор: Amit PATHAK, Bapi Sarker, Eynav Klechevsky
Принадлежит: Washington University in St Louis WUSTL

Among the various aspects of the present disclosure is the provision of methods, synthetic DC, and compositions for T cell activation. The present disclosure provides for synthetic dendritic cells (DCs), methods of generating synthetic dendritic cells (DCs), methods of generating T cell-encapsulated gelatin microspheres and microcapsules, methods of activating T cells using synthetic DCs, methods for expanding T cells against individualized antigen-specific mutational antigens using synthetic DCs, and methods of treating a chronic disease (e.g., HIV, HPV) or cancer using the synthetic DCs.

Подробнее
Номер записи: 77
07-08-2014 дата публикации

Thermally Induced Gelation Of Collagen Hydrogel And Method Of Thermally Inducing Gelling A Collagen Hydrogel

Номер: US20140220688A1
Автор: Albert J. Banes, Jie Qi, Mari Tsuzaki
Принадлежит: MedTrain Technologies LLC

The present invention relates to collagen hydrogels. Particularly, the invention relates to hydrogels comprising a telopeptide collagen (“telo-collagen”) and an atelopeptide collagen (“atelo-collagen”); hydrogels comprising collagen and chitosan; methods of making the hydrogels; methods of reducing gelation of a hydrogel mixture at room temperature; methods of reducing compaction of cells; and methods of culturing cells on such hydrogels.

Подробнее
Номер записи: 78
09-05-2019 дата публикации

THERMORESPONSIVE CELL CULTURE SUPPORTS

Номер: US20190136179A1
Автор: Alghunaim Abdullah, Newby Bi-min Zhang
Принадлежит:

The present invention relates to a cell culture support comprising a substrate and a polymeric blend layer bound to the substrate. The polymeric blend layer comprises at least one thermoresponsive polymer and at least one coupling agent. The coupling agent is a non-protein coupling agent that has functional thiol, ester, epoxy, or aldehyde groups. The cell culture support further includes cells supported by the polymeric blend layer, wherein the thermoresponsive polymer provides for temperature induced detachment of the cells and/or cell sheets. 1. A method of making a cell culture complex comprising:providing a substrate;blending at least one thermoresponsive polymer and at least one coupling agent having functional thiol, ester, epoxy, or aldehyde groups to provide a polymeric blend;applying a thin film of said polymeric blend to the substrate to provide a polymeric blend layer on the substrate;curing the polymeric blend layer on the substrate to provide a cell culture support; anddepositing cells onto said cell culture support, wherein the cells may optionally further comprise medium, to provide a cell culture complex.2. The method of claim 1 , wherein the cultured cell layer comprises cells further characterized as anchor dependent cells.3. The method of claim 1 , wherein the cultured cell layer comprises cells further characterized as adhesive cells.4. The method of claim 1 , wherein the cultured cell layer comprises cells selected from the group consisting of fibroblasts claim 1 , myoblasts claim 1 , myotube cells claim 1 , corneal cells claim 1 , vascular endothelial cells claim 1 , smooth muscle cells claim 1 , cardiomyocytes claim 1 , dermal cells claim 1 , epidermal cells claim 1 , mucosal epithelial cells claim 1 , mesenchymal stem cells claim 1 , ES cells claim 1 , iPS cells claim 1 , osteoblasts claim 1 , osteocytes claim 1 , chondrocytes claim 1 , fat cells claim 1 , neurons claim 1 , hair root cells claim 1 , dental pulp stem cells claim 1 , β-cells ...

Подробнее
Номер записи: 79
30-04-2020 дата публикации

CONSTRUCTS AND METHODS FOR ENGINEERING COMPLEX CELL SYSTEMS

Номер: US20200131472A1
Автор: Selvaganapathy Ponnambalam, Shahin-Shamsabadi Alireza
Принадлежит: MCMASTER UNIVERSITY

This application provides constructs for use as complex cell systems of a desired shape and methods of preparing thereof. The constructs comprise cells contained within a biocompatible gel matrix deposited on a scaffold material optionally cut into defined patterns and impregnated with a crosslinking agent, wherein the biocompatible gel matrix crosslinks upon contact with the crosslinking agent on the scaffold. By stacking multiple alternating layers of the scaffold material cut into defined patterns and the biocompatible gel matrix deposited on the scaffold in defined patterns, complex 3D structures with features like embedded channels are be formed. These complex cell system constructs can be used as in vitro models of biological processes. 1. A construct comprising:a) at least one first layer comprising a scaffold, the scaffold comprising a crosslinking agent; and 'and wherein the scaffold comprises at least one pattern cut into the scaffold.', 'b) at least one second layer comprising a biocompatible gel, the biocompatible gel comprising a plurality of cells, wherein the biocompatible gel is crosslinked to the crosslinking agent,'}2. The construct of claim 1 , wherein the pattern defines at least one void.3. The construct of claim 1 , wherein the biocompatible gel is present in a pattern on the at least one second layer.4. The construct of claim 1 , wherein the construct is a three-dimensional structure comprised of a plurality of alternating layers of the first layer and the second layer claim 1 , wherein the layers are joined by crosslinking of the biocompatible gel with the crosslinking agent of an adjacent scaffold layer.5. The construct of claim 4 , comprising at least one three-dimensional void claim 4 , wherein the three-dimensional void is defined by at least one pattern cut into at least one scaffold.6. The construct of claim 5 , wherein the three-dimensional void is defined by a plurality of patterns cut into a plurality of scaffolds.7. The construct of ...

Подробнее
Номер записи: 80
16-05-2019 дата публикации

MICROBEADS FOR CELL CULTURE AND METHOD OF MONITORING CELL CULTURE USING THE SAME

Номер: US20190144820A1
Автор: Kim Sung Hyun, Kim Tae Woo, LEE Eun Ah, OH Tong In
Принадлежит: UNIVERSITY-INDUSTRY COOPERATION GROUP OF KYUNG HEE UNIVERSITY

Disclosed are microbeads for cell culture and a method of monitoring cell culture using the same. More particularly, each of the microbeads for cell culture according to an embodiment of the present invention include a core and a surface modification layer formed on a surface of the core. By using the method of monitoring cell culture with the microbeads for cell culture according to an embodiment of the present invention, cell culture may be carried out in highly scaled-up dimension and easily monitored. 1. A microbead for cell culture , comprising:a core; anda surface modification layer formed on a surface of the core.2. The microbead according to claim 1 , further comprising a metal coating layer formed between the core and the surface modification layer.3. The microbead according to claim 1 , wherein the microbead has a specific gravity of 0.90 to 1.00.4. The microbead according to claim 1 , wherein the microbead has a spherical or disc shape.5. The microbead according to claim 4 , wherein the microbead has a diameter of 10 μm to 800 μm.6. The microbead according to claim 1 , wherein the core comprises at least any one selected from the group consisting of glass claim 1 , silica claim 1 , plastic such as polystyrene (PS) claim 1 , polyethylene (PE) claim 1 , polypropylene (PP) claim 1 , and biocompatible polymers such as poly lactic acid (PLA) claim 1 , poly L-lactic acid (PLLA) claim 1 , poly(glycolic acid) (PGA) claim 1 , poly(lactic-co-glycolic acid) (PLGA) claim 1 , and poly-caprolactone (PCL).7. The microbead according to claim 1 , wherein the surface modification layer comprises at least any one selected from the group consisting of gelatin claim 1 , collagen claim 1 , hyaluronic acid claim 1 , chondroitin sulfate claim 1 , alginate claim 1 , chitosan claim 1 , aminopropylsiloxane claim 1 , poly-dopamine claim 1 , poly-L-lysine claim 1 , RGD peptide claim 1 , and graphene.8. The microbead according to claim 2 , wherein the metal coating layer comprises at ...

Подробнее
Номер записи: 81
07-05-2020 дата публикации

BIOMIMETIC NETWORKS COMPRISING POLYISOCYANOPEPTIDE HYDROGELS

Номер: US20200140604A1
Автор: KOUWER Paul, Rowan Alan Edward, SCHOENMAKERS Daniël
Принадлежит:

A polymer hydrogel having a polymer formed by the crosslinking reaction of a polymeric unit A according to formula (I), 2. The polymer hydrogel according to claim 1 , wherein the amount of polymer in the hydrogel ranges between 0.01 wt. % and 1 wt. % claim 1 , more preferably between 0.02 wt. % and 0.5 wt. % claim 1 , wherein the amount of water in the hydrogel ranges between 90 and 99.99 wt. % relative to the total of the hydrogel.3. The polymer hydrogel according to claim 1 , wherein the concentration of functional groups FG ([FG]) ranges between 20-200 μM.4. The polymer hydrogel according to claim 1 , wherein the molar ratio between FG and functional groups F1 claim 1 , F2 claim 1 , F ranges between 0.5:1 and 2:1.5. The polymer hydrogel according to claim 1 , wherein the number of ethylene glycol units (m) ranges independently between 2 and 10 claim 1 , preferably the number of ethylene glycol units is 3 or 4 claim 1 , most preferably 3.6. The polymer hydrogel according to claim 1 , wherein k ranges between 0.02 and 0.04.7. The polymer hydrogel according to claim 1 , wherein functional groups F1 claim 1 , F2 claim 1 , F and functional groups FG that can give covalently couplings are selected from alkyne-azide coupling claim 1 , dibenzocyclooctyne-azide coupling claim 1 , bicyclo[6.1.0]non-4-yne-based-azide couplings claim 1 , vinylsulphone-thiol coupling claim 1 , maleimide-thiol coupling claim 1 , methyl methacrylate-thiol coupling claim 1 , ether coupling claim 1 , thioether coupling claim 1 , biotin-strepavidin coupling claim 1 , amine-carboxylic acid resulting in amides linkages claim 1 , alcohol-carboxylic acid coupling resulting in esters linkages claim 1 , tetrazine-trans-cyclooctene coupling and NHS-ester (N-hydroxysuccinimide ester)-amine coupling.8. The polymer hydrogel according to claim 7 , wherein the couplings are based on azide-alkene and/or azide-alkyn coupling such as dibenzocyclooctyne-azide coupling claim 7 , bicyclo[6.1.0]non-4-yne—based-azide ...

Подробнее
Номер записи: 82
17-06-2021 дата публикации

CURVATURE-DEFINED CONCAVE AND CONVEX PDMS SURFACES FOR USE IN CELL AND TISSUE CULTURING AND IN OTHER SURFACE AND INTERFACE APPLICATIONS

Номер: US20210180012A1
Автор: Yang Shengyuan
Принадлежит:

The present disclosure provides a method of fabricating curvature-defined (C-D) or shape-defined (S-D) concave and convex polydimethylsiloxane (PDMS) surfaces and a method of fabricating C-D or S-D convex and concave gel surfaces for use in cell and tissue culturing and in other surface and interface applications, and provides a method of using C-D or S-D convex and concave surfaces with varying curvatures to direct cell attachment, spreading, and migration. 1. A method of fabricating curvature-defined (C-D) or shape-defined (S-D) concave and convex surfaces for use in cell and tissue culturing and in other surface and interface applications , comprising:(1) embedding rigid C-D or S-D convex microstructures on a solidified first material layer of a sufficient rigidity through the polymerization or solidification process to form this solidified first material layer of a sufficient rigidity, and then the exposed C-D or S-D concave surfaces being obtained by carefully-removing these embedded rigid C-D or S-D convex microstructures from this solidified first material layer of a sufficient rigidity, wherein the curvatures of the obtained exposed C-D or S-D concave surfaces are same to those of the C-D or S-D convex surfaces of the corresponding removed rigid convex microstructures that generated these exposed C-D or S-D concave surfaces, and wherein, the sufficient rigidity of a solidified material layer means that (same below), this solidified material layer is rigid enough or the elastic moduli of this solidified material layer is large enough so that, the permanent deformations on the to-be-exposed concave surface of this solidified material layer induced by the possible significant pulling and pushing forces between an embedded rigid C-D or S-D convex microstructure and this solidified material layer during the removing process of this embedded rigid convex microstructure, and the shape variations of the exposed concave surface of this solidified material layer ( ...

Подробнее
Номер записи: 83
22-09-2022 дата публикации

Method and device for forming a gel particle slurry

Номер: US20220298471A1
Автор: Eben Alsberg, Oju Jeon
Принадлежит: CASE WESTERN RESERVE UNIVERSITY

A method of forming a gel particle slurry includes providing a first solution that includes a cross-linkable hydrogel polymer macromer and an optional first crosslinker in a first depot and optionally a second solution in a second depot that is separated from the first depot by a mixing unit that includes a mixing element; and reversibly transferring the first solution and the optional second solution through the mixing unit between the first depot and the second depot such that the first solution and the optional second solution are mixed and agitated to form the gel particle slurry.

Подробнее
Номер записи: 84
23-05-2019 дата публикации

HYDROGEL PRECURSOR FORMULATION AND THE USE THEREOF

Номер: US20190153420A1
Автор: Rizzi Simone, TOUATI Jeremy
Принадлежит:

A hydrogel precursor formulation which is in the form of an unreacted powder. The formulation comprises an activating enzyme, preferably thrombin, a cross-linking enzyme, preferably a transglutaminase, and more preferably factor XIII transglutaminase. The cross-linking enzyme is activatable by the activating enzyme in water with or without a buffer, and at least one structural compound A. The structural compound is crosslinkable by a selective reaction mediated by the crosslinking enzyme to form a hydrogel, wherein the cross-linking enzyme is activated. 117-. (canceled)18. A hydrogel precursor formulation in the form of an unreacted powder comprising:an activating enzyme,a cross-linking enzyme, wherein the cross-linking enzyme is activatable by the activating enzyme in water with or without a buffer,at least one structural compound A,wherein said structural compound is crosslinkable by a selective reaction mediated by the crosslinking enzyme to form a hydrogel.19. The hydrogel precursor formulation according to claim 18 , wherein the precursor formulation is substantially deprived of divalent ions.20. The hydrogel precursor formulation according to claim 18 , wherein the at least one structural compound comprises at least two distinct reactive groups.21. The hydrogel precursor formulation according to claim 18 , wherein the at least one structural compound comprises an acyl moiety and an amine moiety.22. The hydrogel precursor formulation according to claim 18 , wherein the hydrogel precursor formulation comprises at least one further hydrogel compound.23. The hydrogel precursor formulation according to claim 18 , wherein the at least one structural compound is a multi-branched polyethylene glycol.24. A process for the production of a hydrogel precursor formulation in the form of an unreacted powder claim 18 , comprising: an activating enzyme,', 'a cross-linking enzyme, wherein the cross-linking enzyme is activatable by the activating enzyme in water, and', 'at ...

Подробнее
Номер записи: 85
28-08-2014 дата публикации

Thermally Induced Gelation Of Collagen Hydrogel And Method Of Thermally Inducing Gelling A Collagen Hydrogel

Номер: US20140242697A1
Автор: Albert J. Banes, Jie Qi, Mari Tsuzaki
Принадлежит: MedTrain Technologies LLC

The present invention relates to collagen hydrogels. Particularly, the invention relates to hydrogels comprising a telopeptide collagen (“telo-collagen”) and an atelopeptide collagen (“atelo-collagen”); hydrogels comprising collagen and chitosan; methods of making the hydrogels; methods of reducing gelation of a hydrogel mixture at room temperature; methods of reducing compaction of cells; and methods of culturing cells on such hydrogels.

Подробнее
Номер записи: 86
14-05-2020 дата публикации

CELL CULTERING MATERIALS

Номер: US20200148999A1
Автор: Beckers Lucas Johannes Anna Maria, Kriege Jan Cornelis
Принадлежит:

A material for binding to a cell culturing protein is disclosed. The material contains a bulk-modified elastomer comprising a plurality of fatty acid moieties covalently bound to the elastomer bulk, wherein the carboxylic acid groups of said moieties are available to provide said binding. Also disclosed are a fluidic device module, a cell culturing scaffold, a fluidic device, the method of synthesizing such a material and a drug testing method. With such a material, a (monolithic) fluidic device module may be manufactured in as few as a single step injection molding process. 1. A material for binding to a cell culturing protein , the material comprising a bulk-modified elastomer ,wherein the bulk-modified elastomer comprises a plurality of fatty acid moieties covalently bound to the elastomer bulk,wherein the carboxylic acid groups of the moieties are available to provide the binding.2. The material of claim 1 , wherein each of the fatty acid moieties is covalently bound to the elastomer bulk through a cross-linking reaction between a vinyl or hydride functional group of the elastomer and an unsaturated carbon-carbon bond of an unsaturated fatty acid.3. The material of claim 2 , wherein the unsaturated fatty acid is selected from the group consisting of myristoleic acid claim 2 , palmitoleic acid claim 2 , sapienic acid claim 2 , oleic acid claim 2 , elaidic acid claim 2 , vaccenic acid claim 2 , linoleic acid claim 2 , linoeladic acid claim 2 , α-linolenic acid claim 2 , arachidonic acid claim 2 , eicospaentaenoic acid claim 2 , erucic acid and docosahexaenoic acid.4. The material of any of claim 1 , wherein the elastomer comprises a polybutadiene backbone or a silicone backbone.5. The material of claim 4 , wherein at least a fraction of the carboxylic acid groups within the silicone backbone is saponified.6. A cell culturing scaffold comprising the material of any of and a cell culturing protein bound to at least some of the carboxylic acid groups.7. The cell ...

Подробнее
Номер записи: 87
24-06-2021 дата публикации

3D STIMULATED TISSUE CONSTRUCTS AND METHODS OF MAKING THEREOF

Номер: US20210189327A1
Автор: Selvaganapathy Ponnambalam, Shahin-Shamsabadi Alireza
Принадлежит:

This application discloses a method for preparing a construct comprising preparing a mixture of an extracellular matrix and a plurality of cells suspended in a first cell culture medium, applying a crosslinking or gelation agent to the mixture, depositing the mixture into a mold of a defined shape, allowing the extracellular matrix in the mixture to crosslink or gel for a duration of about 1 hour to about 4 hours, applying a second cell culture medium to the mixture containing crosslinked or gelled extracellular matrix, and allowing cell directed self-assembly of the mixture for a duration of about 2 hours to about 10 hours to form a construct, wherein the construct is a three-dimensional structure formed within the mold of the defined shape. Optionally, the method further comprises applying at least one stimuli to the mixture or the construct. Also provided are constructs prepared according to the methods disclosed herein. 1. A method for preparing a construct comprising:a) preparing a mixture of an extracellular matrix and a plurality of cells suspended in a first cell culture medium,b) applying a crosslinking or gelation agent to the mixture,c) depositing the mixture from b) into a mold of a defined shape,d) allowing the extracellular matrix in the mixture in c) to crosslink or gel for a duration of about 1 hour to about 4 hours,e) applying an additional cell culture medium to the mixture containing crosslinked or gelled extracellular matrix from d), andf) allowing cell directed self-assembly of the mixture from e) for a duration of about 2 hours to about 10 hours to form a construct,wherein the construct is a three-dimensional structure formed within the mold of the defined shape.2. The method of claim 1 , further comprising removing the construct from the mold.3. The method of claim 1 , wherein the construct retains the defined shape after removal from the mold.4. The method of claim 1 , wherein the extracellular matrix comprises a hydrogel claim 1 , collagen ...

Подробнее
Номер записи: 88
14-06-2018 дата публикации

SOLUBILIZATION OF ANTIGEN COMPONENTS FOR REMOVAL FROM TISSUES

Номер: US20180161479A1
Автор: GRIFFITHS Leigh G., PAPALAMPROU Angeliki, WONG Maelene L.
Принадлежит: The Regents of the University of California

The present invention relates to methods for removing antigens from tissues by sequentially destabilizing and/or depolymerizing cytoskeletal components and removing and/or reducing water-soluble antigens and lipid-soluble antigens. The invention further relates to tissue scaffolding and decellularized extracellular matrix produced by such methods. 1128-. (canceled)129. A tissue scaffold depleted of antigens comprising extracellular matrix (ECM) structure , ECM biochemical composition and ECM tensile strength that is substantially the same as the ECM prior to antigen removal , wherein the ECM is compatible with viable cell repopulation , and is substantially free of endogenous antigens , wherein at least 60% of the lipid-soluble antigens are removed from the ECM and wherein the glycosaminoglycan (GAG) content is substantially decreased in comparison to the ECM prior to antigen removal.130. The tissue scaffold of claim 129 , wherein the tissue scaffold is free of residual sodium dodecyl sulfate.131. The tissue scaffold of claim 129 , wherein the tissue scaffold induces little or no immune response in a host that is xenogeneic or allogeneic to the tissue scaffold.132. The tissue scaffold of claim 129 , wherein the tissue scaffold does not comprise detectable sarcomeric constituents.133. The tissue scaffold of claim 129 , wherein at least about 65% claim 129 , 70% claim 129 , 75% claim 129 , 80% claim 129 , 85% claim 129 , 90% claim 129 , or more claim 129 , of the lipid soluble antigens are removed from the ECM.134. The tissue scaffold of claim 129 , wherein the glycosaminoglycan content is decreased by about 75%.135. The tissue scaffold of claim 129 , wherein the tissue scaffold is produced by the method comprising:a) solubilizing water-soluble antigens in a tissue by contacting the tissue with a first solution comprising a first buffering agent, a first reducing agent, a first protease inhibitor, and one or more salts suitable for maintaining protein solubility, ...

Подробнее
Номер записи: 89
30-05-2019 дата публикации

TRANSGLUTAMINASE MEDIATED HIGH MOLECULAR WEIGHT HYALURONAN HYDROGELS

Номер: US20190160202A1
Автор: BROGUIERE Nicolas, CAVALLI Emma, Zenobi-Wong Marcy
Принадлежит: ETH Zurich

The invention relates to a process for forming a hyaluronan hydrogel, comprising the steps of 2. A process for forming a hyaluronan hydrogel , comprising the steps ofa. providing an aqueous solution of a first hyaluronan peptide conjugate comprising transglutaminase donor peptides and a second hyaluronan peptide conjugate comprising transglutaminase acceptor peptides,b. adding a thrombin polypeptide to said aqueous solution and allowing equilibration of the resulting mixture;c. subsequently, adding a factor XIII polypeptide.3. The process according to any one of the preceding claims ,wherein the aqueous solution of step a. additionally comprises heparin or heparan sulfate, particularly at a concentration from 0.05% to 0.5% (w/v relative to the gel), andwherein the heparin or heparan sulfate comprises covalently attached transglutaminase donor and/or acceptor peptides, particularly wherein 10% to 20% of carboxylic acid groups present in said heparin or heparan sulfate are covalently modified, more particularly covalently modified to contain a modification described by general formula (II) as laid out above, with L, S and Pep having the meaning indicated above.4. The process according to any one of the preceding claims , wherein the concentration of the sum of said first hyaluronan peptide conjugate and said second hyaluronan peptide conjugate is 0.25% (w/v) to 5% (w/v) , particularly 0.75% to 0.95% or from 0.5% to 3% , 0.5% to 2% , or 0.5% to 1.5%.5. A process for modification of a hyaluronan polymer , wherein said hyaluronan polymer is composed of n dimers of D-glucuronic acid moieties and D-N-acetylglucosamine moieties , and wherein said D-glucuronic acid moieties bear reactive carboxylic acid moieties , and said process comprises the steps of:a. thiolation of 5% to 20%, particularly 8-12%, more particularly approximately 10% of said reactive carboxylic acid moieties to yield partially thiolated hyaluronan;b. reacting said partially thiolated hyaluronan with ...

Подробнее
Номер записи: 90
25-06-2015 дата публикации

THREE DIMENSIONAL MATRIX FOR CANCER STEM CELLS

Номер: US20150175972A1
Автор: JABBARI ESMAIEL
Принадлежит:

Synthetic inert 3D gel culture systems are described that can be finely tuned to exhibit desired and predetermined physical, chemical, mechanical, and biochemical properties. The culture system can be utilized to study the effect of microenvironmental factors on cancer cell response, and in particular on cancer stem cell (CSC) response. Cancer cells can be encapsulated in a crosslinked gel system having a narrow range of predetermined gel stiffness. One or more biochemical factors including peptides that can affect the growth, development, and/or proliferation of CSCs can be incorporated in the system to examine the effects of the factor(s) on the encapsulated cells with regard to growth, proliferation, size, etc. 1. A method of forming a three dimensional hydrogel matrix for supporting a cancer cell , the method comprising:combining an inert synthetic polymer with a crosslinking agent to form a precursor solution;crosslinking the inert synthetic polymer via the crosslinking agent to form the three dimensional hydrogel matrix, wherein the concentration of the crosslinking agent and/or the concentration of the inert synthetic polymer is predetermined in the precursor solution such that the three dimensional hydrogel matrix has a predetermined elastic modulus; andconjugating a peptide to the matrix, the peptide affecting the growth, development, and/or proliferation of a cancer stem cell.2. The method of claim 1 , wherein the inert synthetic polymer comprises polyethylene glycol claim 1 , polyhydroxyethyl methacrylate claim 1 , polyvinylolypyrrolidone claim 1 , or polyvinyl alcohol.3. The method of claim 1 , wherein the inert synthetic polymer is combined with and reacted with the crosslinking agent prior to crosslinking the polymer.4. The method of claim 1 , further comprising encapsulating a population of cells in the three dimensional hydrogel matrix claim 1 , the population of cells comprising cancer stem cells.5. The method of claim 4 , the population of cells ...

Подробнее
Номер записи: 91
23-06-2016 дата публикации

PHOTODEGRADABLE CROSS-LINKING AGENT, PHOTODEGRADABLE GEL, CELL CULTURE INSTRUMENT, CELL ARRANGEMENT-SORTING APPARATUS, CELL ARRANGEMENT METHOD, CELL SORTING METHOD, TISSUE FORMING METHOD, AND TISSUE

Номер: US20160177030A1
Автор: KANAMORI Toshiyuki, SUGIURA Shinji, SUMARU Kimio, TAKAGI Toshiyuki, YANAGAWA Fumiki
Принадлежит:

The present invention provides a photodegradable cross-linking agent capable of manufacturing a photodegradable gel, which has appropriate moisture content and water solubility as a cell carrier and has strength that makes it possible to construct a complicated three-dimensional microstructure. The photodegradable cross-linking agent of the present invention includes a main chain which is composed of branched polyethylene glycol having three or more branched chains and a photodegradable benzyl group which is disposed on the terminus of the branched chains, in which the benzyl group has an active ester group , which is reactive with an amino group or a hydroxyl group, and one or more nitro groups in a benzene ring. 1. A photodegradable cross-linking agent comprising:a polyethylene glycol main chain which has three or more branched chains; anda photodegradable benzyl group which is disposed on the terminus of the polyethylene glycol main chain having the branched chains,the benzyl group having an active ester group, which is reactive with an amino group or a hydroxyl group, and one or more nitro groups in a benzene ring of the benzyl group.2. The photodegradable cross-linking agent according to claim 1 ,wherein the active ester group is a derivative of N-hydroxysuccinimide.3. The photodegradable cross-linking agent according to claim 1 ,wherein the average repetition number of ethylene glycol in the branched chains is within a range of 20 to 500.4. The photodegradable cross-linking agent according to claim 1 ,wherein the number of the branched chains is 4 or 8.5. The photodegradable cross-linking agent according to claim 1 ,wherein the polyethylene glycol main chain has a neopentyl skeleton.6. A photodegradable gel characterized in that it is obtained by reacting the photodegradable cross-linking agent according to with a polymer compound having a total of two or more amino groups or hydroxyl groups in a molecule claim 1 ,the amino groups or the hydroxyl groups in the ...

Подробнее
Номер записи: 92
21-06-2018 дата публикации

DRYING FORMULATON FOR HYDROGEL MICROCARRIERS

Номер: US20180171301A1
Автор: Dolley-Sonneville Paula Jean, Henry David, Scibek Jeffrey Joseph, Zhou Yue
Принадлежит:

A method of making a cell culture article is provided. The method includes forming a microcarrier from a microcarrier composition comprising a polygalacturonic acid compound or an alginic acid compound, infiltrating the microcarrier with a drying formulation to form an infiltrated microcarrier, and drying the infiltrated microcarrier to form a dried microcarrier, wherein the drying formulation comprises at least one of a saccharide and a monovalent cation. 1. A method of making a cell culture article , the method comprising:forming a microcarrier from a microcarrier composition comprising a polygalacturonic acid compound or an alginic acid compound;infiltrating the microcarrier with a drying formulation to form an infiltrated microcarrier; anddrying the infiltrated microcarrier to form a dried microcarrier, wherein the drying formulation comprises at least one of a saccharide and a monovalent cation.2. The method according to claim 1 , further comprising sterilizing the dried microcarrier to form a sterilized dried microcarrier.3. The method according to claim 2 , wherein sterilizing the dried microcarrier comprises exposing the dried microcarrier to gamma radiation.4. The method according to claim 1 , further comprising rehydrating the microcarrier.5. The method according to claim 1 , wherein infiltrating the microcarrier with a drying formulation comprises soaking the microcarrier in a solution of the drying formulation.6. The method claim 1 , wherein infiltrating the microcarrier with a drying formulation comprises simultaneously spraying the microcarrier composition and the drying formulation.7. The method according to claim 1 , wherein the drying formulation comprises 1 to 50 wt. % saccharide.8. The method according to claim 1 , wherein the drying formulation comprises 10 to 500 mM monovalent cation.9. The method according to claim 1 , wherein the drying formulation comprises 1 to 50 wt. % saccharide and 10 to 500 mM monovalent cation.10. The method according ...

Подробнее
Номер записи: 93
02-07-2015 дата публикации

Fabricating Device of Three-Dimensional Scaffold and Fabricating Method Thereof

Номер: US20150183144A1
Автор: Lee Yi-Hsuan, Lin Keng-Hui
Принадлежит:

A fabricating device of a three-dimensional (3-D) scaffold comprises a bubble generator, a bubble mixing channel, a coagulating solution channel and a bubble collector. The bubble generator includes a gas channel and a gel solution channel crossing the gas channel. The bubble mixing channel is connected with a first outlet of the bubble generator. The coagulating solution channel is connected with the bubble mixing channel. The bubble collector is connected with a second outlet of the bubble mixing channel. 1. A fabricating device of a three-dimensional (3-D) scaffold , comprising: a gas channel; and', 'a gel solution channel crossing the gas channel;, 'a bubble generator, includinga bubble mixing channel connected with a first outlet of the bubble generator;a coagulating solution channel connected with the bubble mixing channel; anda bubble collector connected with a second outlet of the bubble mixing channel.2. The fabricating device as recited in claim 1 , wherein the coagulating solution channel is disposed on the side of the bubble mixing channel closer to the bubble generator and disposed apart from the first outlet by a distance.3. The fabricating device as recited in claim 1 , wherein the bubble mixing channel includes at least a bent portion.4. The fabricating device as recited in claim 3 , wherein the bent portion is disposed between the second outlet and the intersection of the bubble mixing channel and the coagulating solution channel.5. The fabricating device as recited in claim 1 , wherein an intersection of the gas channel and the gel solution channel is adjacent to the first outlet.6. The fabricating device as recited in claim 1 , wherein an aperture of the bubble mixing channel is between 10 μm and 1 mm.7. The fabricating device as recited in claim 1 , wherein the bubble collector includes a lower plate claim 1 , and the lower plate has a plurality of recesses to accommodate the bubbles.8. The fabricating device as recited in claim 7 , wherein the ...

Подробнее
Номер записи: 94
28-05-2020 дата публикации

TISSUE SCAFFOLD

Номер: US20200164104A1
Автор: Garcia-Gareta Elena, SAWADKAR Prasad
Принадлежит:

There is provided a tissue scaffold and a method for making a tissue scaffold. The tissue scaffold comprises elastin and optionally fibrin and/or collagen. The elastin in the scaffold may be cross-linked. The elastin that is cross-linked preferably comprises solubilised elastin and is unfractionated. 1. A method for forming a tissue scaffold , comprising cross-linking a composition , the composition comprising elastin , wherein the elastin is unfractionated and comprises solubilised elastin.2. A method according to claim 1 , comprising a step of solubilising elastin.3. A method for forming a tissue scaffold claim 1 , comprising cross-linking a composition comprising unfractionated solubilised elastin.4. A method according to claim 3 , comprising a step of solubilising elastin to form the composition comprising unfractionated solubilised elastin.5. A method according to any preceding claim claim 3 , wherein the elastin is claim 3 , or has been claim 3 , solubilised by contacting with oxalic acid.6. A method according to any preceding claim claim 3 , wherein the elastin is claim 3 , or has been claim 3 , solubilised at a temperature less than 100° C.7. A method according to claim 6 , wherein the step of solubilising the elastin is claim 6 , or has been claim 6 , carried out at a temperature less than or equal to 50° C.8. A method according to claim 7 , wherein the step of solubilising the elastin is claim 7 , or has been claim 7 , carried out at a temperature of 15 to 30° C.9. A method according to any preceding claim claim 7 , wherein the composition that is cross-linked comprises insoluble elastin.10. A method for forming a tissue scaffold claim 7 , comprising cross-linking a composition claim 7 , the composition comprising soluble elastin and insoluble elastin.11. A method according to any preceding claim claim 7 , wherein the composition that is cross-linked comprises collagen and/or fibrin.12. A method according to or claim 7 , or any claim dependent on or claim ...

Подробнее
Номер записи: 95
06-06-2019 дата публикации

Method for Obtaining Female Germline Stem Cells from Follicular Aspirates

Номер: US20190169568A1
Автор: WU Ji
Принадлежит:

Provided is a method for obtaining female germline stem cells from follicular aspirates. 1. A method for separating female germline stem cells from follicular aspirates , comprising:(1) separating ovarian tissues or cell masses from the follicular aspirates and performing cell dispersion to obtain single cells; and(2) inoculating and culturing the cells obtained in step (1) on inactivated feeder layer cells, and sorting female germline stem cell marker-positive cells from the cultured cells.2. The method of claim 1 , further comprising:(3) proliferation-culturing and subculturing the female germline stem cell marker-positive cells obtained in step (2) on feeder layer cells.3. The method of claim 1 , wherein step (1) comprises: filtering the follicular aspirates by using a cell strainer with a pore size of 30-100 μm claim 1 , with solids retained on the strainer as the ovarian tissues or cell masses.4. The method of claim 3 , wherein the solids retained on the strainer as the ovarian tissues or cell masses are separated from the strainer claim 3 , and the ovarian tissues or cell masses are separated from the follicular aspirates by the method of centrifugation.5. The method of claim 1 , wherein step (1) claim 1 , before performing the cell dispersion claim 1 , further comprises: further treating the obtained ovarian tissues or cell masses to remove red blood cells.6. The method of claim 1 , wherein in step (1) claim 1 , the cell dispersion is performed by using one or more enzymes selected from the group consisting of collagenase IV claim 1 , trypsin claim 1 , trypsin substitute claim 1 , or Acutase.7. The method of claim 1 , wherein in step (2) claim 1 , the feeder layer cells include STO cells claim 1 , MEF cells or SNL cells.8. The method of claim 1 , wherein the inactivated feeder layer cells in step (2) are mitomycin C-inactivated feeder layer cells; or the culture period on the feeder layer cells is 10-18 days in step (2).9. The method of claim 1 , wherein in ...

Подробнее
Номер записи: 96
28-05-2020 дата публикации

ENGINEERED SUBSTRATES FOR HIGH-THROUGHPUT GENERATION OF 3D MODELS OF TUMOR DORMANCY, RELAPSE AND MICROMETASTASES FOR PHENOTYPE SPECIFIC DRUG DISCOVERY AND DEVELOPMENT

Номер: US20200165572A1
Автор: Grandhi Taraka Sai Pavan, Potta Thrimoorthy, Rege Kaushal
Принадлежит: Arizona Board of Regents on behalf of Arizona State University

Methods to form a novel aminoglycoside based hydrogel for high-throughput generation of 3D dormant, relapsed and micrometastatic tumor microenvironments are disclosed. In addition, methods of screening agents against tumor cells grown in the 3D environments disclosed herein that include, for example, screening of lead drugs and therapies for an effect on dormant, relapsed and/or micrometastatic tumor cells. 2. The hydrogel of claim 1 , wherein a mole ratio between said aminoglycoside and said polymeric compound is from about 1:1.5 to 1:3.3. The hydrogel of claim 1 , wherein said aminoglycoside is (2S)-4-amino-N-[(1R claim 1 ,2S claim 1 ,3S claim 1 ,4R claim 1 ,5S)-5-amino-2-[(2S claim 1 ,3R claim 1 ,4S claim 1 ,5S claim 1 ,6R)-4-amino-3 claim 1 ,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-4-[(2R claim 1 ,3R claim 1 ,4S claim 1 ,5S claim 1 ,6R)-6-(aminomethyl)-3 claim 1 ,4 claim 1 ,5-trihydroxyoxan-2-yl]oxy-3-hydroxycyclohexyl]-2-hydroxybutanamide claim 1 , and/or salt or hydrate thereof.7. The hydrogel of claim 2 , further comprising a mechanical stiffness of about 7 kilopascals (KPa) to about 100 KPa.8. The hydrogel of claim 2 , further comprising a non-adhesive surface.9. A method to generate a 3D tumor microenvironment (3DTM) using the cross-linked hydrogel of claim 1 , comprising overlaying a first plurality of cancer cells and culturing said cancer cells under conditions and for a duration sufficient to form a spheroidal 3DTM.10. The method of claim 9 , wherein the plurality of cancer cells comprises a seeding density of 1 claim 9 ,000 to 50 claim 9 ,000 cells.11. The method of claim 9 , wherein a size of the spheroidal 3DTM is dependent on the seeding density of the plurality of cancer cells.12. The method of claim 9 , wherein the plurality of cancer cells is selected from the group consisting of T24 bladder cancer cells claim 9 , PC3 prostate cancer cells claim 9 , PC3-eGFP prostate cancer cells claim 9 , and MDA-MB-231 breast cancer cells.13. The method of ...

Подробнее
Номер записи: 97
30-06-2016 дата публикации

SOLUBILIZATION OF ANTIGEN COMPONENTS FOR REMOVAL FROM TISSUES

Номер: US20160184478A1
Автор: GRIFFITHS Leigh G., PAPALAMPROU Angeliki, WONG Maelene L.
Принадлежит: The Regents of the University of California

The present invention relates to methods for removing antigens from tissues by sequentially destabilizing and/or depolymerizing cytoskeletal components and removing and/or reducing water-soluble antigens and lipid-soluble antigens. The invention further relates to tissue scaffolding and decellularized extracellular matrix produced by such methods. 177-. (canceled)78. A tissue scaffold produced by the method comprising:a) solubilizing water-soluble antigens in the tissue by contacting the tissue with a first solution comprising a first buffering agent, a first reducing agent, a first protease inhibitor, and one or more salts suitable for maintaining protein solubility, wherein the first solution does not comprise an amphiphile, such that the water-soluble antigens are dissolved in the first solution;b) separating the tissue from the solubilized water-soluble antigens in the first solution;c) solubilizing lipid-soluble antigens in the tissue by contacting the tissue with a second solution comprising a second buffering agent, a second reducing agent, a second protease inhibitor, one or more salts suitable for maintaining protein solubility and an amphiphile, such that the lipid-soluble antigens are dissolved in the second solution; andd) separating the tissue from the solubilized lipid-soluble antigens in the second solution; thereby producing the tissue scaffold.79. (canceled)80. A decellularized extracellular matrix (ECM) produced by the method comprising:a) solubilizing water-soluble antigens in the tissue by contacting the tissue with a first solution comprising a first buffering agent, a first reducing agent, a first protease inhibitor, and one or more salts suitable for maintaining protein solubility, wherein the first solution does not comprise an amphiphile, such that the water-soluble antigens are dissolved in the first solution;b) separating the tissue from the solubilized water-soluble antigens in the first solution;c) solubilizing lipid-soluble antigens in ...

Подробнее
Номер записи: 98
08-07-2021 дата публикации

Composition and method for preserving or culturing ocular cells

Номер: US20210207088A1
Автор: Naoki Okumura, Noriko Koizumi
Принадлежит: Doshisha Co Ltd

The present disclosure provides a composition and method for preserving ocular cells. More specifically, the present disclosure provides a composition for preserving ocular cells, or culturing the cells after preservation, comprising albumin and dimethyl sulfoxide, and a cell formulation comprising the ocular cells, albumin, and dimethyl sulfoxide, and a treatment/prevention method using the same. The present disclosure also provides a method of preserving corneal endothelial cells, comprising suspending ocular cells in the composition to provide a suspension and freezing the suspension. In some embodiments, ocular cells are corneal cells (e.g., corneal endothelial cells).

Подробнее
Номер записи: 99
08-07-2021 дата публикации

DRYING FORMULATION FOR HYDROGEL MICROCARRIERS

Номер: US20210207098A1
Автор: Dolley-Sonneville Paula Jean, Henry David, Scibek Jeffery Joseph, Zhou Yue
Принадлежит:

A method of making a cell culture article is provided. The method includes forming a microcarrier from a microcarrier composition comprising a polygalacturonic acid compound or an alginic acid compound, infiltrating the microcarrier with a drying formulation to form an infiltrated microcarrier, and drying the infiltrated microcarrier to form a dried microcarrier, wherein the drying formulation comprises at least one of a saccharide and a monovalent cation. 113-. (canceled)14. A cell culture article comprising:a polygalacturonic acid compound or an alginic acid compound; anda drying formulation comprising at least one of a saccharide and a monovalent cation,wherein the cell culture article is free of water.15. The cell culture article according to claim 14 , wherein the drying formulation comprises 1 to 50 wt. % saccharide.16. The cell culture article according to claim 14 , wherein the drying formulation comprises 0.5 to 20 wt. % monovalent cation.17. The cell culture article according to claim 14 , wherein the drying formulation comprises 1 to 50 wt. % saccharide and 0.5 to 20 wt. % monovalent cation.18. The cell culture article according to claim 14 , wherein the drying formulation comprises a non-volatile liquid material.19. The cell culture article according to claim 18 , wherein the non-volatile liquid material is selected from the group consisting of DMSO and a low molecular weight polyethylene glycol.20. The cell culture article according to claim 14 , wherein the polygalacturonic acid compound or the alginic acid compound is cross-linked with calcium.21. The cell culture article of claim 14 , wherein the cell culture article comprises a microcarrier comprising the polygalacturonic acid compound or the alginic acid compound claim 14 , wherein the drying formulation is infiltrated into the microcarrier.22. The cell culture article of claim 14 , wherein the drying formulation comprises 10 to 500 mM monovalent cation.23. The cell culture article of claim 14 , ...

Подробнее
Номер записи: 100