Поиск патентов

05-01-2012 дата публикации

Compositions and methods for modulating activity of capped small rnas

Номер: US20120004279A1

Автор: Dan Cao, Dirk Haussecker, Mark A. Kay

Принадлежит: Leland Stanford Junior University

Compositions and methods for modulating transcription by RNA polymerases are described.

Подробнее

Номер записи: 1

12-01-2012 дата публикации

Transfection of blood cells with mrna for immune stimulation and gene therapy

Номер: US20120009221A1

Автор: Florian Van Der Mülbe, Ingmar Hoerr, Steve Pascolo

Принадлежит: CureVac AG

The present invention relates to a pharmaceutical composition containing blood cells or haemopoietic cells, e.g. red blood cells (erythrocytes), granulocytes, mononuclear cells (PBMCs) and/or blood platelets, in combination with a pharmaceutically acceptable excipient and/or vehicle, wherein the cells are transfected with at least one mRNA comprising at least one region coding for at least one antigen. The invention further discloses a method of preparing the aforesaid pharmaceutical composition and the use of blood cells transfected in this way for the preparation of drugs or pharmaceutical compositions for immune stimulation against the antigens encoded by the mRNA. The subjects according to the invention are used especially for the therapy and/or prophylaxis of carcinoses or infectious diseases and can also be employed in gene therapy.

Подробнее

Номер записи: 2

12-01-2012 дата публикации

Modulation of the immune response

Номер: US20120009222A1

Автор: Daniel Griffith Anderson, David-Huy Nhu Nguyen, Kerry Peter Mahon, Robert S. Langer

Принадлежит: Massachusetts Institute of Technology

The present invention provides lipidoids that can be used to modulate the immune response in a subject. Lipidoids are prepared by the conjugate addition of an amine to an acrylate to acrylamide. The lipidoids form complexes or particles with an immunostimulatory polynucleotide, which are then administerd to a subject. Such compositions have been found to stimulate the production of cytokines and increase both humoral and cell-mediate immune response. The invention also provides pharmaceuti-cal compositions thereof and methods for using the same.

Подробнее

Номер записи: 3

12-01-2012 дата публикации

Preservation of Bioactive Materials By Spray Drying

Номер: US20120009248A1

Автор: Binh Pham, Vu Truong-Le

Принадлежит: MEDIMMUNE LLC

This invention provides methods and compositions to preserve bioactive materials in a matrix of powder particles. Methods provide high-pressure gas spraying and/or near supercritical spraying of formulations followed by drying in a stream of conditioned gas to form stable powder particles containing bioactive materials.

Подробнее

Номер записи: 4

12-01-2012 дата публикации

Respiratory Syncytial Virus Antigenic Compositions and Methods

Номер: US20120009254A1

Автор: James Gorham Boyd, Thomas J. Powell

Принадлежит: Artificial Cell Technologies Inc

Multilayer films comprise polypeptide epitopes from RSV. The multilayer films are capable of eliciting an immune response in a host upon administration to the host. The multilayer films include at least one designed peptide that includes one or more polypeptide epitopes from RSV. Specifically, the multilayer films include two polypeptide epitopes from RSV, such as an epitope that elicits a specific T-cell response such as a cytotoxic T-cell response, and an epitope that elicits a specific antibody response.

Подробнее

Номер записи: 5

09-02-2012 дата публикации

Influenza Vaccines, Antigens, Compositions, and Methods

Номер: US20120034253A1

Автор: Konstantin Musiychuk, Vadim Mett, Vidadi Yusibov

Принадлежит: Fraunhofer USA Inc

The present invention relates to the intersection of the fields of immunology and protein engineering, and particularly to antigens and compositions useful in inducing or enhancing an immune response agains influenza antigens. Provided are recombinant protein antigens, compositions, and methods for the production of such antigens in plants. In some embodiments, influenza antigens include hemagglutinin polypeptides, neuraminidase polypeptides, and/or combinations thereof.

Подробнее

Номер записи: 6

16-02-2012 дата публикации

Compositions and methods for vaccine and virus production

Номер: US20120039939A1

Автор: Chia Chu, Joseph Shiloach, Michael Betenbaugh, Pratik Jaluria

Принадлежит: JOHNS HOPKINS UNIVERSITY

The present invention features methods of producing immunogenic compositions and viruses, methods of treating and preventing viral infection, and methods of producing an immune response using cells that express a polypeptide selected from the group consisting of: cdk13, siat7e, Iama4, cox15, egr1, gas6, map3k9, and gap43, and a virus.

Подробнее

Номер записи: 7

16-02-2012 дата публикации

Microparticulated vaccines for the oral or nasal vaccination and boostering of animals including fish

Номер: US20120040010A1

Автор: Brian Carpenter, Moti Harel

Принадлежит: Individual

The invention relates to a composition and a method for manufacturing semi-dry or dry particles containing a mucoadhesive polymer and a bioactive agent such as, but not limited to, an Immunogenic Substance (e.g., a vaccine), that allows the oral or nasal administration and delivery of the bioactive agent essentially unaltered to mucosal surfaces in the animal, including an aquatic animal.

Подробнее

Номер записи: 8

23-02-2012 дата публикации

Biomolecule Surface Display and Uses Thereof

Номер: US20120045473A1

Автор: Jimmy Kwang

Принадлежит: Temasek Life Sciences Laboratory Ltd

A vaccine for the treatment or prevention of a disease in a subject, wherein said disease is associated with an avian influenza virus, and wherein said vaccine comprises an expression vector comprising a nucleic acid encoding a hemagglutinin peptide, such that in use said hemagglutinin peptide is expressed by said expression vector in said subject.

Подробнее

Номер записи: 9

15-03-2012 дата публикации

Tetravalent influenza vaccine and use thereof

Номер: US20120064117A1

Автор: Hairong Lu, Ted M. Ross, Xianchun Tang

Принадлежит: University of Pittsburgh

Disclosed herein is the finding that baculovirus display of multiple influenza virus hemagglutinin (HA) proteins elicits broadly reactive immune responses against influenza. Thus provided herein are recombinant baculovirus vectors having a first, second, third and fourth nucleic acid sequence, each encoding an influenza hemagglutinin (HA) fusion protein. The first, second, third and fourth nucleic acid sequences each encode an influenza HA with a different amino acid sequence. Also provided are recombinant baculoviruses displaying a first, second, third and fourth influenza virus HA fusion protein in the baculovirus envelope, wherein each HA fusion protein comprises a different HA amino acid sequence. Tetravalent influenza virus vaccines comprising the recombinant baculoviruses disclosed herein are further provided. In addition, methods of immunizing a subject against influenza virus using the tetravalent influenza virus vaccines are provided. In particular examples of the compositions and methods disclosed herein, the HA polypeptides are from H5N1 influenza virus.

Подробнее

Номер записи: 10

22-03-2012 дата публикации

Targeted multi-epitope dosage forms for induction of an immune response to antigens

Номер: US20120070493A1

Автор: Christopher Fraser, David H. Altreuter, Grayson B. Lipford

Принадлежит: Selecta Biosciences Inc

Provided herein are compositions and methods related to MHC II binding peptides. In some embodiments, the peptides are obtained or derived from a common source. In other embodiment, the peptides are obtained or derived from an infectious agent to which a subject has been repeatedly exposed.

Подробнее

Номер записи: 11

29-03-2012 дата публикации

Separation Of Virus And/Or Protein From Nucleic Acids By Primary Amines

Номер: US20120077249A1

Автор: Ganesh Iyer, Senthil Ramaswamy, Steve Cross

Принадлежит: Millipore Corp

A method of purifying biomolecules with an anion exchanger containing a membrane having a surface having a polymer such as a primary or secondary amine ligand formed thereon, such as polyallylamine. The feedstock is introduced to the exchanger in the presence of one or more ionic-modifiers by themselves or in combination with monovalent salt. The ionic modifier alters the binding ability of the primary amines such that they retain a significant binding capacity for highly charged species such as DNA but lose part or almost all of their binding capacity for less charged species such as viruses or proteins at pH above the pI of the virus or protein.

Подробнее

Номер записи: 12

19-04-2012 дата публикации

RSV F VLPs AND METHODS OF MANUFACTURE AND USE THEREOF

Номер: US20120093855A1

Автор: Joel R. Haynes

Принадлежит: Ligocyte Pharmaceuticals Inc

The present invention relates to the field of isolation of enveloped virus-based virus-like particles (VLPs) free of infectious agents. In preferred examples, the field includes methods of inactivation of infectious agents that do not adversely affect the immunogenicity of the enveloped virus-based VLPs. In certain embodiments, the enveloped virus-based VLPs are produced in insect cell based expression systems.

Подробнее

Номер записи: 13

19-04-2012 дата публикации

Influenza vaccine regimens for pandemic-associated strains

Номер: US20120093859A1

Автор: Elena Fragapane, Nicola Groth

Принадлежит: NOVARTIS AG

In contrast to known regimens where pandemic-associated antigens are given 3-4 weeks apart for immunisation, according to the invention two doses of a pandemic-associated antigen are administered to a human 1 week apart, 2 weeks apart or 6 weeks apart. Thus the invention provides a method for immunizing a human, comprising steps of: (a) administering to the human a first vaccine comprising antigen from a pandemic-associated influenza virus strain; and then 1/2/6 week(s) later, (b) administering to the same human a second influenza vaccine comprising antigen from the pandemic-associated influenza virus strain.

Подробнее

Номер записи: 14

19-04-2012 дата публикации

Influenza vaccines with increased amounts of h3 antigen

Номер: US20120093860A1

Автор: Klaus Stohr, Theodore Tsai

Принадлежит: NOVARTIS AG

An influenza vaccine includes an increased amount of H3N2 antigen relative to the normal dose. In a typical embodiment, the vaccine includes hemagglutinins from an A/H1N1 strain, an A/H3N2 strain, and a B strain, wherein (i) the weight ratio of H3N2:H1N1 hemagglutinin is greater than 1 and (ii) the weight ratio of H3N2:B hemagglutinin is greater than 1. In such a vaccine the weight ratio of H1N1:B hemagglutinin will normally be 1. For example, a vaccine may contain hemagglutinin at 15 μg for A/H1N1, 30 μg for A/H3N2 and 15 μg for B.

Подробнее

Номер записи: 15

03-05-2012 дата публикации

Recombinant envelope protein of human immunodeficiency virus (hiv) and vaccine containing the same

Номер: US20120107910A1

Автор: George Dacai Liu

Принадлежит: Individual

The present invention provides a recombinant HIV Env antigenic protein, a virus-like particle and a recombinant HIV virus. The present invention further provides a vaccine comprising the recombinant HIV Env antigenic protein, the virus-like particle or recombinant HIV virus.

Подробнее

Номер записи: 16

17-05-2012 дата публикации

Method to enhance an immune response of nucleic acid vaccination

Номер: US20120121690A1

Автор: Andrew David Bacon, Gregory Gregoriadis, Peter Laing, Wilson Romero Caparros-Wanderley

Принадлежит: Lipoxen Technologies Ltd

A composition comprising liposomes associated with a nucleic acid operatively encoding an antigenic protein and with an assistor protein, wherein the assistor protein shares at least one epitope with the antigenic protein, and wherein the nucleic acid and said assistor protein are associated with the same liposomes is described. The composition provides an improved immune response compared to mixtures of liposomes some of which are associated with the nucleic acid and some of which are associated with the assistor protein.

Подробнее

Номер записи: 17

07-06-2012 дата публикации

Linear expression cassette vaccines

Номер: US20120141577A1

Автор: Adrian Vilalta, Alain Rolland, Marston Manthorpe

Принадлежит: Vical Inc

The disclosure relates to a linear expression cassette (LEC) as a nucleic acid based vector for producing a gene product of interest. Methods of preparing a disclosed LEC, as well as methods for its use to express a gene product in a subject, are also described. An LEC may be used in an animal or human subject to produce a therapeutic and/or immune response in the subject, such as an immunized state.

Подробнее

Номер записи: 18

28-06-2012 дата публикации

Chimeric molecules

Номер: US20120164155A1

Автор: Elizabeth Grgacic

Принадлежит: Macfarlane Burnet Institute for Medical Research and Public Health Ltd

The invention relates to chimeric proteins comprising an antigen and a trimer forming portion or a trimer and virus-like particle forming portion of foamy virus envelope protein (FV TM). The trimer or trimer and virus-like particle forming portion comprises i) full length foamy virus transmembrane protein; ii) foamy virus transmembrane protein absent a functional cytoplasmic domain; iii) foamy virus transmembrane protein absent a functional cytoplasmic domain and transmembrane domain; iv) foamy virus ectodomain comprising N-terminal heptad repeat region and cysteine rich region between N-terminal heptad repeat region and C-terminal α-helical region; v) N-terminal heptad repeat region; vi) a functional variant of any one of i) to v); or vii) any one of i) to vi) lacking an FV fusion peptide domain. In particular, the antigen is an antigen of a virus envelope protein, such as HIV gp 120. Soluble and membrane bound forms of trimeric and higher oligomeric forms of the chimeric proteins are provided as well as nucleic acid molecules encoding and expressing same, viral-like particles comprising same, compositions including pharmaceutical compositions, host cells and kits. Methods are described for producing immune responses including antibodies determined by the chimeric protein or VLP, as well as methods of screening using the chimeric protein, VLP and/or antibodies.

Подробнее

Номер записи: 19

28-06-2012 дата публикации

Adjuvant composition containing poly-gamma-glutamic acid-chitosan nanoparticles

Номер: US20120164174A1

Автор: Chul Joong Kim, Dong Jin JEONG, Haryoung Poo, Moon-Hee Sung, Sang-Mu Shim, Yong Taik Lim, Young-Ki Choi

Принадлежит: Bioleaders Corp, Industry Academic Cooperation Foundation of CBNU, Industry Academic Cooperation Foundation of Chungnam National University, Industry Academic Cooperation Foundation of Kookmin University, Korea Research Institute of Bioscience and Biotechnology KRIBB

The present invention relates to an adjuvant composition containing poly-gamma-glutamic acid-chitosan nanoparticles and a vaccine composition containing the adjuvant composition, and more particularly to an adjuvant composition containing nanoparticles prepared by ionic bonding between poly-gamma-glutamic acid having ensured safety and chitosan, and a vaccine composition containing the poly-gamma-glutamic acid-chitosan nanoparticles and an antigen. The adjuvant containing the poly-gamma-glutamic acid-chitosan nanoparticles has little or no toxicity and side effects and is added to human or animal vaccines for the prevention and treatment of viral and bacterial infections and cancers to increase the production of antibodies.

Подробнее

Номер записи: 20

26-07-2012 дата публикации

Compositions and methods to treat and control tumors

Номер: US20120189645A1

Автор: Adrian Bot, Bill Phillips, Dan Smith, Lilin Wang, Luis Dellamary

Принадлежит: Multicell Immunotherapeutics Inc

The present application is directed to non-coding RNA motifs that are used in conjunction with an antigen or without an antigen to induce, enhance or modulate an immune response that compromises a B cell and a T cell component.

Подробнее

Номер записи: 21

02-08-2012 дата публикации

Polyanionic polymer adjuvants for haemophilus influenzae b saccharide vaccines

Номер: US20120195937A1

Автор: Dominique Lemoine, Florence Emilie Jeanne Francoise Wauters, Nathalie Marie-Josephe Garcon

Принадлежит: GLAXOSMITHKLINE BIOLOGICALS SA

The present invention relates to immunogenic compositions comprising capsular polysaccharide or oligosaccharide of H. influenzae B (PRP) and methods of making such compositions.

Подробнее

Номер записи: 22

23-08-2012 дата публикации

Chimeric rsv-f polypeptide and lentivirus or alpha-retrovirus gag-based vlps

Номер: US20120213817A1

Автор: Joel R. Haynes

Принадлежит: Ligocyte Pharmaceuticals Inc

The present invention relates to chimeric RSV-F polypeptide and lentivirus or alpha-retrovirus GAG-based virus-like particles (VLPs). The present invention also includes methods of making and using such chimeric VLPs. In certain embodiments, the GAG polypeptide of the chimeric VLPs comprises an HIV or ALV GAG polypeptide.

Подробнее

Номер записи: 23

13-09-2012 дата публикации

Novel h5 proteins, nucleic acid molecules and vectors encoding for those, and their medicinal use

Номер: US20120231027A1

Автор: Eric Vaughn, Juergen Daemmgen, Paulino Carlos Gonzalez-Hernandez

Принадлежит: Boehringer Ingelheim Vetmedica Inc

The present invention relates to novel hemagglutinin H5 proteins, nucleic acids and vectors encoding for those as well as vaccines comprising any of such H5 proteins, nucleic acids or vectors encoding for those H5 proteins. Moreover, the present invention also relates to the medicinal use of any of such compositions in humans and animals.

Подробнее

Номер записи: 24

20-09-2012 дата публикации

Production of viral vaccines in suspension on avian embryonic derived stem cell lines

Номер: US20120238001A1

Автор: Arnaud Leon, Majid Mehtali, Patrick Champion-Arnaud

Принадлежит: Vivalis SA

The present invention relates to the development and manufacturing of viral vaccines. In particular, the invention relates to the field of industrial production of viral vectors and vaccines, more in particular to the use of avian embryonic stem cells, preferably the EBx® cell line derived from chicken embryonic stem cells, for the production of viral vectors and viruses. The invention is particularly useful for the industrial production of viral vaccines to prevent viral infection of humans and animals.

Подробнее

Номер записи: 25

27-09-2012 дата публикации

Methods for identifying a virulent strain of a virus

Номер: US20120244521A1

Автор: Gennadi V. Glinsky

Принадлежит: Individual

The present invention relates to methods for identifying a virulent strain of a virus, particularly and influenza virus, by detecting specific mutations in the amino acid sequence of the hemagglutinin (HA) protein and by determining the case fatality rate for hospitalization (CFR/H) as the number of persons hospitalized for infection by the virus who die from the infection compared to the total number of persons hospitalized for infection, wherein the identification of mutations in the HA protean and/or an increasing CFR/H over time indicates a virulent strain of the virus.

Подробнее

Номер записи: 26

11-10-2012 дата публикации

Compositions and methods for modulating rsv infection and immunity

Номер: US20120258111A1

Автор: Larry J. Anderson, Les Jones, Ralph A. Tripp

Принадлежит: SERVICES, US Department of Health and Human Services

Compositions and methods are provided for the treatment or prevention of RSV disease by modulating RSV infection and immunity. In particular, amino acid sequences in the RSV G glycoprotein, containing the chemokine motif defined as C-X-X-X-C (or CX3C), are identified that are essential in causing RSV infection and disease. The chemokine motif is biologically active and participates in virus binding to and infection of susceptible cells. The prevention or treatment of RSV infection is achieved by interfering with the motif, such as by administering a vaccine in which the motif is altered or by administration or induction of blocking molecules that inhibit the biological activity of the motif.

Подробнее

Номер записи: 27

11-10-2012 дата публикации

Method to identify a novel class of immunologic adjuvants

Номер: US20120258125A1

Автор: Carol O. Cowing, Christopher Cowing-Zitron

Принадлежит: LANCELL LLC

Methods of identifying an adjuvant capable of activating dendritic cells including measuring expression level genes in skin of an animal prior to exposure to a test compound, wherein the genes are known to be upregulated or downregulated in the skin of the animal in response to topical application of dibutyl phthalate (DBP) to skin of said animal; exposing skin of an animal of the same species to the test compound; measuring expression level of the genes in the skin of the animal after exposure to the test compound; and comparing expression level of the genes measured before and after exposure to the test compound, wherein an increase or decrease in expression level of the genes following exposure to the test compound indicates that the test compound is capable of activating dendritic cells. Also included are compositions that induce dendritic cell migration and modulate expression level of genes in skin cells.

Подробнее

Номер записи: 28

25-10-2012 дата публикации

Adjuvated Influenza Vaccine and Use Thereof

Номер: US20120269852A1

Автор: Alexander J. Kersten, Sara Ann Jackson

Принадлежит: Abbott Biologicals BV

A viral vaccine, specifically an influenza vaccine, comprises a combination of a component (a1) represented by a detoxified or non-toxic mutant of subunit A of an AB type exotoxin, and a component (a2) represented by at least one substance selected from the group consisting of metal salts and mineral salts, in association with a viral immunogen.

Подробнее

Номер записи: 29

25-10-2012 дата публикации

Reverse genetics systems

Номер: US20120270321A1

Автор: Michael Franti, Peter Mason, Philip Dormitzer

Принадлежит: NOVARTIS AG

The invention provides various reverse genetics systems for producing segmented RNA viruses, wherein the systems do not require bacteria for propagation of all of their expression constructs.

Подробнее

Номер записи: 30

01-11-2012 дата публикации

Immunoprotection by oral administration of recombinant lactococcus lactis mini-capsules

Номер: US20120276167A1

Автор: Dominic Man-Kit Lam, Yuhong Xu

Принадлежит: VaxGene Corp

In one embodiment, the present invention provides for an edible mini-capsule form of live, non-persisting, recombinant Lactococcus lactis ( L. lactis ) vaccine against a pathogen such as the highly virulent influenza H5N1 strain. Enteric coated capsule of the present invention induced high levels of hemagglutinin-specific serum IgG and fecal IgA antibody production after oral administration in mice and chickens, and rendered complete protection against a lethal challenge of H5N1 virus in mice. The present invention thus demonstrates a broadly applicable platform technology for producing and administering edible vaccines against bacterial and viral infections.

Подробнее

Номер записи: 31

08-11-2012 дата публикации

Functional mutation in respiratory syncytial virus

Номер: US20120282673A1

Автор: Bin Lu, HONG Jin, Robert Brazas

Принадлежит: MEDIMMUNE LLC

The present invention provides recombinant respiratory syncytial viruses that have an attenuated phenotype and that comprise one or more mutations in the viral P, M2-1 and/or M2-2 proteins, as well as live attenuated vaccines comprising such viruses and nucleic acids encoding such viruses. Recombinant RSV P, M2-1 and M2-2 proteins are described. Methods of producing attenuated recombinant RSV, and methods of quantitating neutralizing antibodies that utilize recombinant viruses of family Paramyxoviridae, are also provided.

Подробнее

Номер записи: 32

27-12-2012 дата публикации

Methods and compositions for the production of recombinant virus vectors

Номер: US20120329136A1

Автор: Weidong Xiao

Принадлежит: Individual

A method for the production of a replication-deficient recombinant virus vector is disclosed. The replication-deficient recombinant virus vector has a recombinant virus genome with one or more defective viral genes. The method comprises infecting a host cell with a carrier virus having a carrier virus genome encoding one or more trans factors or variants thereof, incubating the infected host cell for a desired period of time, and isolating the replication-deficient recombinant virus vector. The carrier virus is a cytoplasmic virus that retains the carrier virus genome in the cytoplasm of the host cell. The host cell contains the recombinant viral genome and retains the recombinant viral genome in a nucleus of the host cell. Also disclosed is a carrier virus for the production of a replication-deficient recombinant virus vector.

Подробнее

Номер записи: 33

27-12-2012 дата публикации

Pathogen Restriction Factors

Номер: US20120331576A1

Автор: Abraham Brass, Stephen Elledge

Принадлежит: Brigham and Womens Hospital Inc, General Hospital Corp

The use of interferon induced transmembrane protein 1, 2, or 3 (IFITM1, 2, or 3) as a viral restriction factor, and methods of using the same to produce virus, transgenic animals expressing exogenous IFITM1, 2, or 3, and methods of treating or inhibiting viral infections by targeting a gene identified herein

Подробнее

Номер записи: 34

03-01-2013 дата публикации

Monoclonal antibodies specific to hemagglutinin and neuraminidase from influenza virus h5-subtype or n1-subtype and uses thereof

Номер: US20130004497A1

Автор: Fang He, Hong Liang Qian, Hwei-Sing Kwang

Принадлежит: Temasek Life Sciences Laboratory Ltd

Monoclonal antibodies and related binding proteins that bind specifically to the envelope glycoprotein of H5 subtypes or neuraminidase glycoprotein of N1 subtypes of avian influenza virus (AIV) are provided. The monoclonal antibodies and related binding proteins are useful for the detection of H5 and N1 subtypes of AIV, including H5N1 subtypes and provide means for the diagnosis, surveillance and treatment of dangerous viral infections.

Подробнее

Номер записи: 35

03-01-2013 дата публикации

Process for manufacturing vaccines

Номер: US20130004532A1

Автор: Pierre Duvivier, Ralph Leon BIERMANS

Принадлежит: GLAXOSMITHKLINE BIOLOGICALS SA

The present application discloses an improved method for conducting saccharide—protein conjugation reactions using carbodiimide condensation chemistry. Depending on the nature of the saccharide or protein carrier involved, the quality of the conjugate may be improved by adding one of the reaction components slowly to the reaction mixture. Immunogenic compositions are further provided comprising the saccharide-protein conjugates made by the methods disclosed.

Подробнее

Номер записи: 36

07-02-2013 дата публикации

Reverse genetics methods for virus rescue

Номер: US20130034582A1

Автор: Bjorn Keiner, Jennifer Uhlendorff, Michael Franti, Mikhail Matrosovich, Peter Mason, Philip Dormitzer, Pirada Suphaphiphat

Принадлежит: NOVARTIS AG

A method for rescuing a virus by reverse genetics is provided in which cells are added after transfection.

Подробнее

Номер записи: 37

21-02-2013 дата публикации

Methods and Compositions Related to Glycoprotein-Immunoglobulin Fusions

Номер: US20130045205A1

Автор: Charles J. Arntzen, Hugh S. Mason, Seong Hee Bhoo, Sun Hee Rosenthal

Принадлежит: Arizona Board of Regents of ASU

Disclosed herein are compositions and methods for eliciting immune responses against HCV antigens. In particular embodiments, the compounds and methods elicit immune responses against all or a segment of HCV glycoprotein E1 and/or HCV glycoprotein E2.

Подробнее

Номер записи: 38

28-02-2013 дата публикации

Preparation method of virus expressing alpha-galactose epitope and vaccine

Номер: US20130052219A1

Автор: Haruko Ogawa, Kunitoshi Imai, Takahiro Tagami

Принадлежит: NATIONAL AGRICULTURE AND FOOD RESEARCH ORGANIZATION, Obihiro University of Agriculture and Veterinary Medicine NUC

A method for producing an α-Gal-expressing virus having enhanced immune response to viruses, without requiring the use of any enzyme; an influenza virus vaccine having a high effect (antigenicity), which is produced using an α-Gal-expressing virus produced by the method; and others. Specifically disclosed are: a method for producing an α-galactose epitope (Galα1-3Galβ1-4GlcNAc-R: α-Gal hereinafter)-expressing virus, which comprises the steps of: (1) introducing an α1,3- galactosyltransferase gene in an expressible condition into a cell line that does not express α-Gal to obtain a cell line capable of expressing α-Gal; (2) inoculating a virus into the cell line capable of expressing α-Gal to obtain a cell line infected with a virus; and (3) culturing the cell line infected with the virus to obtain a virus expressing α-Gal from the culture medium..

Подробнее

Номер записи: 39

21-03-2013 дата публикации

Bunyavirus vaccine

Номер: US20130071429A1

Автор: Benjamin Brennan, Richard Michael Elliott

Принадлежит: University of St Andrews

The present invention provides attenuated viruses for use as vaccines and for the treatment and/or prevention of viral diseases and/or infections.

Подробнее

Номер записи: 40

04-04-2013 дата публикации

Vaccines comprising cholesterol and cpg as sole adjuvant-carrier molecules

Номер: US20130084306A1

Автор: Heather Lynn Davis, Paul J. Dominowski, Risini Weeratna

Принадлежит: Coley Pharmaceutical Group Inc

Described are vaccines having one or more antigens cholesterol and CpG. Aspects of the invention relate to the use of the vaccines of the invention for the treatment and/or prevention of human and animal disorders.

Подробнее

Номер записи: 41

04-04-2013 дата публикации

Method for the identification of t cell epitopes

Номер: US20130085260A1

Автор: Jean-Daniel Doucet, Rejean Lapointe

Принадлежит: Centre Hospitalier de lUniversite de Montreal CHUM

A novel method to identify relevant T-cell epitopes recognized by CD8 + or CD4 − T lymphocytes is described. The method is based on the use of mRNA fragments synthesized from cDNA encoding portions of a polypeptide of interest. mRNA fragments are introduced into antigen-presenting cells to deduce an epitope's localization in a polypeptide of interest, such as a protein antigen.

Подробнее

Номер записи: 42

11-04-2013 дата публикации

Dengue and west nile viruses proteins and genes coding the foregoing, and their use in vaccinal, therapeutic and diagnostic applications

Номер: US20130089558A1

Автор: Chantal Combredet, Frédéric Tangy, Marie Pascale Frenkiel, Philippe Despres

Принадлежит: CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE CNRS, Institut Pasteur de Lille

The present invention relates to the development of viral vectors expressing different immunogens from the West Nile Encephalitis Virus (WNV) or the Dengue virus which are able to induce protective humoral and cellular immune responses against WNV or Dengue virus infections. More specifically, the present invention relates to three (3) antigens from WNV (the secreted envelope glycoprotein (E), the heterodimer glycoproteins (pre-M-E) and the NSI protein) and from Dengue virus (the secreted envelope glycoprotein (e), the heterodimer glycoproteins (pre-m-e) and the nsl protein) and their use in vaccinal, therapeutic and diagnostic applications.

Подробнее

Номер записи: 43

11-04-2013 дата публикации

Oral vaccine compromising an antigen and a toll-like receptor agonist

Номер: US20130089570A1

Автор: Corey Patrick MALLETT, Daniel Larocque, Martin Plante, Nadia Ouaked

Принадлежит: GLAXOSMITHKLINE BIOLOGICALS SA

The present invention provides an immunogenic composition comprising one or more antigens and a Toll-like receptor (TLR) agonist in an orally (e.g. sublingually) administered composition.

Подробнее

Номер записи: 44

25-04-2013 дата публикации

Recombinant non-pathogenic marek's disease virus constructs encoding infectious laryngotracheitis virus and newcastle disease virus antigens

Номер: US20130101619A1

Автор: Gary Petersen, Mohamad Morsey, Paulus Jacobus Antonius Sondermeijer, Stephanie COOK

Принадлежит: Intervet Inc

The present invention discloses novel recombinant multivalent non-pathogenic Marek's Disease virus constructs that encode and express both Infectious Laryngotracheitis Virus and Newcastle Disease virus protein antigens, and methods of their use in poultry vaccines.

Подробнее

Номер записи: 45

23-05-2013 дата публикации

Pharmaceutical composition

Номер: US20130129738A1

Автор: Akira Sakurai, Futoshi Shibasaki

Принадлежит: TOKYO METROPOLITAN INSTITUTE OF MEDICAL SCIENCE

Disclosed is an influenza virus infection inhibitor. Specifically disclosed is a pharmaceutical composition that is composed of an inhibitor such as an antibody which recognizes a peptide comprising the amino acid sequence of RERRRKKR (SEQ ID NO: 1) and inhibits the action of introducing an RR sequence into a cell. The influenza virus infection inhibitor is produced so as to contain the pharmaceutical composition.

Подробнее

Номер записи: 46

23-05-2013 дата публикации

Influenza vaccine

Номер: US20130129770A1

Автор: A.D.M.E. Osterhaus, Bror Morein, Karin Bengtsson Lövgren

Принадлежит: ERASMUS UNIVERSITY MEDICAL CENTER, ISCONOVA AB

The present invention relates to a composition comprising at least one ISCOM complex and at least one ectodomain from at least one hemagglutinin (HA) domain and at least one ectodomain from at least one neuraminidase (NA) domain from one or more influenza virus, wherein the extodomains represent ectodomains isolated from the influenza virus. The invention also regards a kit. The composition may be used as an immune stimulating medicine, immune modulating pharmaceutical or a vaccine e.g. against influenza for vertebrates, e.g. birds and mammals.

Подробнее

Номер записи: 47

30-05-2013 дата публикации

Compositions, methods and uses for poxvirus elements in vaccine constructs

Номер: US20130136767A1

Автор: Dan T. Stinchcomb, Jeremy Jones, Jorge E. Osorio, Timothy D. Powell

Принадлежит: Inviragen Inc

Embodiments of the present invention generally disclose methods, compositions and uses for generating and expressing poxvirus constructs. In some embodiments, constructs may contain an influenza virus gene segment. In certain embodiments, methods generally relate to making and using compositions of constructs including, but not limited to, poxvirus vaccine compositions. In other embodiments, vaccine compositions are reported of use in a subject.

Подробнее

Номер записи: 48

13-06-2013 дата публикации

Organic peroxide compounds for microorganism inactivation

Номер: US20130149194A1

Автор: Jens Peter Gregersen, Thomas Grundemann

Принадлежит: Individual

Multifunctional organic peroxides are used as microbiological inactivators and/or for degrading nucleic acids. These include at least one carbon atom and at least two organic peroxide groups. The inactivator is ideally a hydroperoxide. The invention is particularly useful during preparation of viral vaccines.

Подробнее

Номер записи: 49

20-06-2013 дата публикации

Compositions and Methods for the Therapy and Diagnosis of Influenza

Номер: US20130158238A1

Автор: Andres G. Grandea, III, Gordon King, Jennifer Mitcham, Matthew Moyle, Ole Olsen, Phil Hammond, Thomas C. Cox

Принадлежит: Theraclone Sciences Inc

The present invention provides novel human anti-influenza antibodies and related compositions and methods. These antibodies are used in the diagnosis and treatment of influenza infection.

Подробнее

Номер записи: 50

20-06-2013 дата публикации

Optimized promoter sequence

Номер: US20130158246A1

Автор: Gary Kobinger, Heinz Feldmann, Kaylie Tran

Принадлежит: Canada Minister of National Health and Welfare

A modified CAG promoter which is capable of driving high levels of expression of sequences of interest inserted downstream therefrom is herein described.

Подробнее

Номер записи: 51

04-07-2013 дата публикации

Soluble Forms of Hendra and Nipah Virus G Glycoprotein

Номер: US20130171131A1

Автор: Christopher C. Broder, Katharine N. Bossart

Принадлежит: Individual

This invention relates to soluble forms of G glycoprotein from Hendra and Nipah virus. In particular, this invention relates to compositions comprising soluble forms of G glycoprotein from Hendra and Nipah virus and also to diagnostic and therapeutic methods using the soluble forms of G glycoprotein from Hendra and Nipah virus. Further, the invention relates to therapeutic antibodies including neutralizing antibodies, and vaccines for the prevention and treatment of infection by Hendra and Nipah viruses.

Подробнее

Номер записи: 52

04-07-2013 дата публикации

Influenza vaccine

Номер: US20130171182A1

Автор: Lucy Phillipa Beales, Michael Anthony Whelan, William Malcolm Rosenberg

Принадлежит: iQur Ltd

The invention provides a protein comprising a first and a second copy of hepatitis B core antigen (HBcAg) in tandem, in which one or both of the copies of HBcAg comprises influenza virus A surface polypeptide M2 or a fragment thereof in the e 1 loop.

Подробнее

Номер записи: 53

04-07-2013 дата публикации

Immunogenic composition

Номер: US20130171188A1

Автор: Carine Capiau, Dominique Boutriau, Jan Poolman, Philippe Denoel, Pierre Duvivier, Ralph Leon Biemans

Принадлежит: GLAXOSMITHKLINE BIOLOGICALS SA

The present application discloses an immunogenic composition comprising a Hib saccharide conjugate, at least one additional bacterial, for example N. meningitidis, saccharide conjugate(s), and a further antigen selected from the group consisting of whole cell pertussis and hepatitis B surface antigen, wherein the saccharide dose of the Hib saccharide conjugate is less than 5 μg.

Подробнее

Номер записи: 54

11-07-2013 дата публикации

Functional influenza virus-like particles (vlps)

Номер: US20130177587A1

Автор: Peter M. Pushko, Robin A. Robinson

Принадлежит: Novavax Inc

Recombinant influenza virus proteins, including influenza capsomers, subviral particles, virus-like particles (VLP), VLP complexes, and/or any portions of thereof, are provided as a vaccine for influenza viruses. The invention is based on the combination of two vaccine technologies: (1) intrinsically safe recombinant vaccine technology, and (2) highly immunogenic, self-assembled protein macromolecules embedded in plasma membranes and comprised of multiple copies of influenza virus structural proteins exhibiting neutralizing epitopes in native conformations. More specifically, this invention relates to the design and production of functional homotypic and heterotypic recombinant influenza virus-like particles (VLPs) comprised of recombinant structural proteins of human influenza virus type A/Sydney/5/94 (H3N2) and/or avian influenza virus type A/Hong Kong/1073/99 (H9N2) in baculovirus-infected insect cells and their application as a vaccine in the prevention of influenza infections and as a laboratory reagent for virus structural studies and clinical diagnostics.

Подробнее

Номер записи: 55

11-07-2013 дата публикации

Lipid Based Adjuvants for DNA Plasmids

Номер: US20130177591A1

Автор: Alexis Parisot, Caroline Edlund Toulemonde

Принадлежит: Merial LLC

The present invention provides for a novel vaccine formulation comprising plasmid DNA and a lipid adjuvant. The invention also provides for prime-boost vaccination methods wherein two sequential administration of the same plasmid-based DNA vaccine provide companion animals with protection against rabies for at least one year.

Подробнее

Номер записи: 56

18-07-2013 дата публикации

Computationally optimized broadly reactive antigens for influenza

Номер: US20130183342A1

Автор: Brendan M. Giles, Ted M. Ross

Принадлежит: Individual

Described herein is the development of a computationally optimized influenza HA protein that elicits broadly reactive immune response to all H5N1 influenza virus isolates. The optimized HA protein was developed through a series of HA protein alignments, and subsequent generation of consensus sequences, for clade 2 H5N1 influenza virus isolates. The final consensus HA amino acid sequence was reverse translated and optimized for expression in mammalian cells. It is disclosed herein that influenza virus-like particles containing the optimized HA protein are an effective vaccine against H5N1 influenza virus infection in animals.

Подробнее

Номер записи: 57

25-07-2013 дата публикации

Lipids suitable for liposomal delivery of protein coding rna

Номер: US20130189351A1

Автор: Andrew Geall

Принадлежит: NOVARTIS AG

RNA is encapsulated within a liposome for in vivo delivery. The RNA encodes a polypeptide of interest, such as an immunogen for immunisation purposes. The liposome includes at least one compound selected from the group consisting of compounds of formula (I) and formula (XI).

Подробнее

Номер записи: 58

25-07-2013 дата публикации

Multi plasmid system for the production of influenza virus

Номер: US20130189762A1

Автор: George Kemble, Gregory Duke

Принадлежит: MEDIMMUNE LLC

Vectors and methods for the production of influenza viruses suitable as recombinant influenza vaccines in cell culture are provided. Bi-directional expression vectors for use in a multi-plasmid influenza virus expression system are provided. Additionally, the invention provides methods of producing influenza viruses with enhanced ability to replicate in embryonated chicken eggs and/or cells (e.g., Vero and/or MDCK) and further provides influenza viruses with enhanced replication characteristics. In addition, the present invention includes an improved method of rescue, wherein animal cells (e.g., SF Vero cells) are electroporated with plasmids and vectors of the invention.

Подробнее

Номер записи: 59

01-08-2013 дата публикации

H3 equine influenza a virus

Номер: US20130195906A1

Автор: Alexander I. Karasin, Christopher W. Olsen, Gabriele A. Landolt

Принадлежит: WISCONSIN ALUMNI RESEARCH FOUNDATION

The invention provides an isolated H3 equine influenza A virus, as well as methods of preparing and using the virus, and genes or proteins thereof.

Подробнее

Номер записи: 60

01-08-2013 дата публикации

Small liposomes for delivery of immunogen encoding rna

Номер: US20130195969A1

Автор: Andrew Geall, Ayush Verma

Принадлежит: NOVARTIS AG

Nucleic acid immunisation is achieved by delivering RNA encapsulated within a liposome. The RNA encodes an immunogen of interest, and the liposome has a diameter in the range of 60-180 nm, and ideally in the range 80-160 nm. Thus the invention provides a liposome having a lipid bilayer encapsulating an aqueous core, wherein: (i) the lipid bilayer has a diameter in the range of 60-180 nm; and (ii) the aqueous core includes a RNA which encodes an immunogen. These liposomes are suitable for in vivo delivery of the RNA to a vertebrate cell and so they are useful as components in pharmaceutical compositions for immunising subjects against various diseases.

Подробнее

Номер записи: 61

15-08-2013 дата публикации

Universal influenza a vaccines

Номер: US20130209512A1

Автор: Dongming Zhou, Hildegund C. J. Ertl

Принадлежит: Wistar Institute of Anatomy and Biology

Universal flu vaccines are disclosed. The vaccines induce broad and sustained protection against a wide range of influenza A viruses, reduce the need for annual vaccination campaigns with vaccines based upon viral strains predicted to be the predominant circulating strains, and ameliorate the threat of future pandemics that can potentially kill millions.

Подробнее

Номер записи: 62

29-08-2013 дата публикации

Methods of Making Hemagglutinin Proteins

Номер: US20130224798A1

Автор: Albert E. Price, James W. Huleatt, Langzhou Song, Lynda G. Tussey, Robert K. Evans, Thomas J. Powell, Valerian Nakaar

Принадлежит: Vaxinnate Corp

Methods of making a protein that stimulates a protective immune response in a subject include separating a portion of a protein from a naturally occurring influenza viral hemagglutinin to form a protein portion. The protein portion includes at least a portion of a globular head, and at least a portion of at least one secondary structure having at least one β-sheet at a bottom of the globular head that causes the globular head to essentially retain its tertiary structure. The protein portion made by the methods of the invention lacks a transmembrane domain, a cytoplasmic domain and an HA2 subunit. A nucleic acid sequence encoding the protein portion is transformed into a prokaryotic host cell.

Подробнее

Номер записи: 63

05-09-2013 дата публикации

Herpesvirus of turkeys vectored vaccine against avian influenza in poultry

Номер: US20130230556A1

Автор: Iwan Verstegen, Paulus Jacobus Antonius Sondermeijer

Принадлежит: Individual

The present application applies to the field of veterinary vaccines, in particular of vaccines for poultry against avian influenza. The vaccine is based on a recombinant viral vector expressing the haemagglutinin protein of an influenza virus, wherein the vector is herpes virus of turkeys (HVT) and the haemagglutinin gene is driven by a glycoprotein B gene promoter from a mammalian herpesvirus. A vaccine comprising this HVT+HA vector can be used to induce a protective immune response against avian influenza in poultry, and to reduce the spread of AIV. The invention also relates to methods, uses, and vaccines involving the HVT+HA vector.

Подробнее

Номер записи: 64

19-09-2013 дата публикации

Peptide Sequences and Compositions

Номер: US20130243804A1

Автор: Gregory Alan Stoloff, Wilson Romero Caparros-Wanderley

Принадлежит: Peptcell Ltd

Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-6, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ ID 1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ ID 2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ ID 3 DLIFLARSALILRGSVAHKSC SEQ ID 4 PGIADIEDLTLLARSMVVVRP SEQ ID 5 LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ ID 6 IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.

Подробнее

Номер записи: 65

10-10-2013 дата публикации

Recombinant viral vectors

Номер: US20130266611A1

Автор: Aaron J. Wilson, Christopher L. Parks, Maoli Yuan, Maria J. Chiuchiolo, Ross W. B. Lindsay, Sanjay Phogat, Svetlana Rabinovich

Принадлежит: International AIDS Vaccine Initiative Inc

The present relation relates to recombinant vesicular stomatitis virus for use as prophylactic and therapeutic vaccines for infectious diseases of AIDS. The present invention encompasses the preparation and purification of immunogenic compositions which are formulated into the vaccines of the present invention.

Подробнее

Номер записи: 66

17-10-2013 дата публикации

Vaccine for inducing an improved immune reaction

Номер: US20130273101A1

Автор: Jin Wook Jang, Kwang Sung Kim, Na Gyong Lee, Won Il Yoo, Yang Je Cho

Принадлежит: Eyegene Inc

The present invention relates to a pharmaceutical vaccine composition comprising: (a) a pathogen-derived antigen selected from the group consisting of Mycobacterium tuberculosis antigen, Bacillus anthracis antigen, HAV (hepatitis A virus) antigen, HBV (hepatitis B virus) antigen, HCV (hepatitis C virus) antigen, HIV (human immunodeficiency virus) antigen, influenza virus antigen, HSV (herpes simplex virus) antigen, Hib ( Haemophilus influenzae type b) antigen, Neisseria meningitidis antigen, Corynebacterium diphtheriae antigen, Bordetella pertussis antigen, Clostridium tetani antigen and Varicella virus antigen; (b) a deacylated non-toxic LOS (lipooligosaccharide); and (c) a pharmaceutically acceptable carrier.

Подробнее

Номер записи: 67

24-10-2013 дата публикации

Dna vaccine against multitypes of avian influenza viruses and influenza virus-like particles comprising adjuvant-fused m2 protein

Номер: US20130280296A1

Автор: Shih-Chang Lin, Suh-Chin Wu

Принадлежит: National Tsing Hua University NTHU

A DNA vaccine comprising hyperglycosylated mutant HA gene, which is derived from avian influenza virus, is provided. A DNA vaccine composition comprising: (a) the DNA vaccine; and (b) a booster is also provided. An influenza virus-like particle comprising adjuvant-fused M2 protein is further provided. A method for eliciting an immune response against a plurality of avian influenza virus subtypes in a subject, comprising delivering the DNA vaccine or the DNA vaccine composition to tissue of the subject is also provided

Подробнее

Номер записи: 68

07-11-2013 дата публикации

PVRL4 (Nectin4) is a Receptor for Measles Virus

Номер: US20130295114A1

Автор: Christopher D. Richardson

Принадлежит: Individual

PVRL4 is a tumor marker that is highly expressed on the surfaces of many carcinomas. Disclosed herein are compositions and methods that provide impetus for using measles virus as an oncolytic agent against PVRL4+ carcinomas and use of PVRL4-binding agents to interfere with viral infection.

Подробнее

Номер записи: 69

07-11-2013 дата публикации

Method for expression of small antiviral rna molecules with reduced cytotoxicity within a cell

Номер: US20130295615A1

Автор: Carlos Lois-Caballe, David Baltimore, Dong Sung An, Irvin S.Y. Chen, Xiao-Feng Qin

Принадлежит: California Institute of Technology CalTech, UNIVERSITY OF CALIFORNIA

In one aspect, the invention provides methods and compositions for the expression of small RNA molecules within a cell using a retroviral vector (FIG. 1 A). Small interfering RNA (siRNA) can be expressed using the methods of the invention within a cell. In a further aspect, the invention provides methods for producing siRNA encoding lentivirus where the siRNA activity may interfere with the lentiviral life cycle. In yet a further aspect, the invention provides methods for expression of a small RNA molecule within a cell, such as an siRNA capable of downregulating CCR5, wherein expression of the small RNA molecule is relatively non-cytotoxic to the cell. The invention also includes small RNA molecules, such as an siRNA capable of downregulating CCR5, that are relatively non-cytotoxic to cells.

Подробнее

Номер записи: 70

07-11-2013 дата публикации

Infectious cDNA of an approved vaccine strain of measles virus, use for immunogenic compositions

Номер: US20130296541A1

Автор: Chantal Combredet, Frédéric Tangy, Michel Brahic, Valérie Labrousse-Najburg

Принадлежит: Institut Pasteur de Lille

The invention relates to a cDNA molecule which encodes the nucleotide sequence of the full length antigenomic (+)RNA strand of a measles virus (MV) originating from an approved vaccine strain. It also contains the preparation of immunogenic compositions using said cDNA.

Подробнее

Номер записи: 71

14-11-2013 дата публикации

Immunogenic Bordetella Bronchiseptica Compositions

Номер: US20130302369A1

Автор: Jeffrey E. Galvin, Joseph Michael Bricker, Omar Yousif Abdelmagid, Shelly Lynn Shields

Принадлежит: Jeffrey E. Galvin, Joseph Michael Bricker, Omar Yousif Abdelmagid, Shelly Lynn Shields

Provided herein are compositions, combinations, and methods comprising Bordetella bronchiseptica and isolated pertactin, which are effective in treating or preventing respiratory infections, such as kennel cough, in animals.

Подробнее

Номер записи: 72

21-11-2013 дата публикации

Human binding molecules capable of neutralizing influenza virus h3n2 and uses thereof

Номер: US20130309248A1

Автор: Mandy A. C. Jongeneelen, Mark Throsby, Robert H.E. Friesen, Theodorus H.J. Kwaks

Принадлежит: Crucell Holand BV

Described are binding molecules, e.g., human monoclonal antibodies, that bind to influenza virus comprising HA of the H3 subtype, e.g., H3N2, and have a broad neutralizing activity against such influenza virus. Described are polynucleotides encoding the binding molecules, their sequences and compositions comprising the binding molecules and methods of identifying or producing the binding molecules. The binding molecules can be used in the diagnosis, prophylaxis, and/or treatment of influenza virus H3N2 infection. The binding molecules may provide cross-subtype protection, such that infections with H3, H7, and/or H10-based influenza subtypes can be prevented and/or treated.

Подробнее

Номер записи: 73

21-11-2013 дата публикации

Methods for Producing Yeast-Based Vaccines

Номер: US20130309269A1

Автор: Alex Franzusoff, Deborah Quick

Принадлежит: Globeimmune Inc

The invention provides methods for culturing yeast at a neutral pH level. Yeast cultured under neutral pH conditions exhibit desirable characteristics useful for biological purposes, such as the development of vaccines, prophylactics and therapeutics. The invention also provides for compositions and kits comprising yeast grown using the methodologies disclosed herein.

Подробнее

Номер записи: 74

28-11-2013 дата публикации

Method for improving the production of influenza viruses and vaccine seeds

Номер: US20130315954A1

Автор: Jean-Christophe Bourdon, Manuel Rosa-Calatrava, Olivier Terrier

Принадлежит: CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE CNRS, Hospices Civils de Lyon HCL, Universite Claude Bernard Lyon 1 UCBL, UNIVERSITY OF DUNDEE

The present invention relates to a method for improving the production of an influenza virus, and in particular influenza vaccine seeds, or a vaccine directed against an influenza virus, characterized in that the production is carried out in the presence of an inhibitor of the interaction between the Mdm2 protein and the p53 protein.

Подробнее

Номер записи: 75

05-12-2013 дата публикации

Schmallenberg virus (sbv) vaccine, methods of production, and uses thereof

Номер: US20130323277A1

Автор: Alexander BRIX, Axel Lischewski, Jeffrey P. Knittel, Katharina Hedwig TOEPFER, Konrad Stadler, Veljko NIKOLIN

Принадлежит: BOEHRINGER INGELHEIM VETMEDICA GMBH

The present invention relates to the field of vaccines and medicaments for the prophylaxis and treatment of infectious diseases in ruminants. In particular, it relates to inactivated Schmallenberg virus (SBV) useful as vaccine or medicament for preventing or treating viremia, the transmission and clinical symptoms, in particular malformations in newborn ruminants such as cattle, sheep and goats, induced by SBV.

Подробнее

Номер записи: 76

19-12-2013 дата публикации

Vaccination in newborns and infants

Номер: US20130336998A1

Автор: Benjamin Petsch, Karl-Josef Kallen, Lothar Stitz, Margit SCHNEE, Thomas Kramps

Принадлежит: CureVac AG

The present invention relates to vaccines comprising at least one mRNA encoding at least one antigen for use in the treatment of a disease in newborns and/or infants, preferably exhibiting an age of not more than 2 years, preferably of not more than 1 year, more preferably of not more than 9 months or even 6 months, wherein the treatment comprises vaccination of the newborn or infant and eliciting an immune response in said newborn or infant. The present invention is furthermore directed to kits and kits of parts comprising such a vaccine and/or its components and to methods applying such a vaccine or kit.

Подробнее

Номер записи: 77

16-01-2014 дата публикации

Method to produce a medicinal product comprising a biologically active protein and the resulting product

Номер: US20140017318A1

Автор: Kevin O'Connell, Sandhya BUCHANAN

Принадлежит: Intervet Inc

The present invention pertains to a method for producing a medicinal product comprising a biologically active protein comprising the steps of providing an aqueous composition comprising a solvent, the biologically active protein and between 20% w/w and 60% w/w of a non-polymeric sugar, freezing the composition, thereby forming at least one frozen body comprising the solvent in frozen form, putting the frozen body in a drying apparatus while being carried by a support, the support comprising one or more restraining elements that define one or more boundaries of the support, wherein at most 30% of the surface of the body is contiguous with the one or more restraining elements, reducing the pressure in the drying apparatus below atmospheric pressure, providing heat to the body in order to sublimate the frozen solvent of the body and obtain a dried body. The invention also pertains to a product obtainable by this method.

Подробнее

Номер записи: 78

23-01-2014 дата публикации

Live attenuated virus vaccines for la crosse virus and other bunyaviridae

Номер: US20140023679A1

Автор: Brian R. Murphy, Richard S. Bennett, Stephen S. Whitehead

Принадлежит: US Department of Health and Human Services

The invention relates to vaccine compositions including CEV serogroup immunogens, attenuated and inactivated viruses of the CEV serogroup and chimeric Bunyaviridae. Also disclosed are methods of treating or preventing CEV serogroup infection in a mammalian host, methods of producing a subunit vaccine composition or an immunogenic composition, isolated polynucleotides comprising a nucleotide sequence encoding a CEV serogroup immunogen, methods for detecting La Crosse virus (LACV) infection in a biological sample and infectious chimeric Bunyaviridae.

Подробнее

Номер записи: 79

23-01-2014 дата публикации

Method for increasing the replication capacity of an influenza virus in cultured cells

Номер: US20140024101A1

Автор: Anne Aublin-Gex, Benoit de Chassey, Laurene Meyniel-Schicklin, Patrice Andre, Vincent Lotteau

Принадлежит: Institut National de la Sante et de la Recherche Medicale INSERM, Universite Claude Bernard Lyon 1 UCBL

The present invention relates to methods for increasing the replication capacity of an influenza virus in cultured cells. More particularly, the present invention relates to a method for increasing the replication capacity of an influenza virus in a cell comprising the steps consisting of i) infecting said cell with said influenza virus and ii) culturing said infected cell with a least one molecule selected from the group consisting of Dibucaine, Aprindine, Amiloride, Mevinolin, Simvastatin, Promathazine, Pranlukast, Nimodipine, Ibutilide hemifumarate Salt, Risperidone and derivatives or analogues thereof.

Подробнее

Номер записи: 80

13-02-2014 дата публикации

Replication deficient influenza virus for the expression of heterologous sequences

Номер: US20140045245A1

Автор: Andrej Egorov, Christian Kittel, Markus Wolschek, Michael Bergmann, Thomas Muster

Принадлежит: Baxter Healthcare SA

The present invention relates to a novel replication deficient influenza virus comprising a modified NS1 segment coding for a NS1 protein lacking a functional RNA binding domain and functional effector domain and having a heterologous sequence inserted between the splice donor site and the splice acceptor site of the NS gene segment. The virus can be used as vector for expression of various proteins like chemokines, cytokines or antigenic structures and to produce vaccines. A fusion peptide comprising part of the N-terminus of an NS1 protein and a signal sequence fused to the C-terminus of said NS1 peptide is also provided.

Подробнее

Номер записи: 81

20-02-2014 дата публикации

Novel h5 proteins, nucleic acid molecules and vectors encoding for those, and their medicinal use

Номер: US20140050755A1

Автор: Eric Martin VAUGHN, Juergen Daemmgen, Paulino Carlos Gonzalez-Hernandez

Принадлежит: Boehringer Ingelheim Vetmedica Inc

The present invention relates to novel hemagglutinin H5 proteins, nucleic acids and vectors encoding for those as well as vaccines comprising any of such H5 proteins, nucleic acids or vectors encoding for those H5 proteins. Moreover, the present invention also relates to the medicinal use of any of such compositions in humans and animals.

Подробнее

Номер записи: 82

20-03-2014 дата публикации

Influenza hemagglutinin and neuraminidase variants

Номер: US20140079726A1

Автор: HONG Jin, Kanta Subbarao, Xing Cheng

Принадлежит: MEDIMMUNE LLC

Polypeptides, polynucleotides, reassortant viruses, immunogenic compositions and vaccines comprising influenza hemagglutinin and neuraminidase variants and method using thereof are provided.

Подробнее

Номер записи: 83

10-04-2014 дата публикации

Methods of treatment using an aminosterol composition

Номер: US20140099281A1

Автор: Michael Zasloff

Принадлежит: Individual

This invention relates to stable aminosterol phosphate compositions. The aminosterol phosphate compositions permit administration without associated tissue damage and achieve a sustained release effect.

Подробнее

Номер записи: 84

10-04-2014 дата публикации

Method for preventing the unfolding of a (poly)peptide and/or inducing the (re-)folding of a (poly)peptide

Номер: US20140099697A1

Автор: Jens Altrichter, Kristina KEMTER, Martin Scholz

Принадлежит: Leukocare AG

The present invention relates to a method for preventing the unfolding of a (poly)peptide during drying and/or inducing the (re-)folding of a (poly)peptide after drying, comprising the step of embedding the (poly)peptide in an aqueous solution, wherein the solution comprises (i) at least three different amino acids; or (ii) at least one dipeptide or tripeptide; and wherein the solution is free or substantially free of (a) sugar; and (b-i) protein; and/or (b-ii) denaturing compounds; and (c) silanes.

Подробнее

Номер записи: 85

04-01-2018 дата публикации

METHODS FOR INDUCING AN IMMUNE RESPONSE VIA BUCCAL AND/OR SUBLINGUAL ADMINISTRATION OF A VACCINE

Номер: US20180000724A1

Автор: Choi Jin Huk, Croyle Maria A., SCHAFER Stephen Clay

Принадлежит:

Vaccine compositions that may be administered to a subject via the buccal and/or sublingual mucosa are provided. Methods for administration and preparation of such vaccine compositions are also provided. 120.-. (canceled)21. An immunogenic composition comprising an amorphous , substantially solid film having an average thickness of 0.05 to 5 mm , which is soluble in an aqueous solution , said film comprising an antigen , a sugar and an amphipathic surfactant.22. The composition of claim 21 , wherein the sugar is selected from group consisting of: glucose claim 21 , dextrose claim 21 , fructose claim 21 , lactose claim 21 , maltose claim 21 , xylose claim 21 , sucrose claim 21 , corn sugar syrup claim 21 , sorbitol claim 21 , hexitol claim 21 , maltilol claim 21 , xylitol claim 21 , mannitol claim 21 , melezitose claim 21 , raffinose claim 21 , and a combination thereof23. The composition of claim 21 , wherein the amphipathic surfactant comprises poly(maleic anhydride-alt-1 octadecene).24. The composition of claim 21 , wherein the poly(maleic anhydride-alt-1 octadecene) is substituted with 3-(dimethylamino) propylamine.25. The composition of claim 21 , further comprising a buffer.26. The composition of claim 21 , further comprising a water-soluble polymer.27. The composition of claim 21 , further comprising a salt.28. The composition of claim 21 , wherein the antigen comprises a polypeptide antigen.29. The composition of claim 21 , wherein the antigen is from a virus claim 21 , bacteria claim 21 , parasite or prion.30. The composition of claim 29 , wherein the antigen comprises a virus.31. The composition of claim 21 , wherein the virus is an adenovirus.32. The composition of claim 31 , wherein the adenovirus is an adenovirus type 5.33. The composition of claim 30 , wherein the virus encodes a heterologous antigen.34. The composition of claim 21 , wherein the composition is produced by a method comprising:(i) providing an aqueous solution comprising the antigen, the ...

Подробнее

Номер записи: 86

07-01-2016 дата публикации

OLIGOMERIC INFLUENZA IMMUNOGENIC COMPOSITIONS

Номер: US20160000900A1

Автор: DU Lanying, Jiang Shibo, Zhao Guangyu, Zhou Yusen

Принадлежит:

Embodiments are provided for network resource allocation considering user experience, satisfaction, and operator interest. An embodiment method by a network component for allocating network resources includes evaluating, for a user, a QoE for each flow of a plurality of flows in network traffic in according with a QoE model, and further evaluating, for an operator, a revenue associated with the flows in accordance with a revenue model. A plurality of priorities that correspond to the flows are calculated in accordance with the QoE for the user and the revenue for the operator. The method further includes identifying a flow of the flows with a highest value of the priorities, and allocating a network resource for the flow. In an embodiment, the QoE model is a satisfaction model that provides a measure of user satisfaction for each flow in accordance with a subscription or behavior class of the user. 1. A fusion protein comprising:an immunogen sequence including an influenza A virus matrix protein M2e domain, or a fragment thereof, and an influenza A virus hemagglutinin fusion peptide (FP) domain, or a fragment thereof; andan immunopotentiator sequence.2. The fusion protein of claim 1 , wherein the FP domain is from influenza A virus hemagglutinin subtype 1 claim 1 , 2 claim 1 , 3 claim 1 , 4 claim 1 , 5 claim 1 , 6 claim 1 , 7 claim 1 , 8 claim 1 , 9 claim 1 , 10 claim 1 , 11 claim 1 , 12 claim 1 , 13 claim 1 , 14 claim 1 , 15 claim 1 , 16 claim 1 , 17 claim 1 , or 18.3. The fusion protein of claim 1 , wherein the FP domain and the M2e domain are independently from an influenza A virus selected from an H1N1 virus claim 1 , an H1N2 virus claim 1 , an H2N2 virus claim 1 , an H3N2 virus claim 1 , an H5N1 virus claim 1 , an H7N2 virus claim 1 , an H7N3 virus claim 1 , an H7N7 virus claim 1 , an H7N9 virus claim 1 , an H9N2 virus claim 1 , or an H10N8 virus.4. The fusion protein of claim 1 , wherein the amino acid sequence of the FP domain is at least 90% identical to one ...

Подробнее

Номер записи: 87

07-01-2021 дата публикации

ACTIVATION OF RESIDENT MEMORY T CELLS FOR CANCER IMMUNOTHERAPY

Номер: US20210000935A1

Автор: JR. David B., Masopust, Vezys Vaiva D.

Принадлежит:

Provided herein are methods of treating cancer by activating resident memory T cells using one or more antigenic peptides. 123-. (canceled)24. A method of increasing the efficacy of immunotherapy in an individual , comprising administering an adjuvant to a solid tumor , wherein the adjuvant comprises at least two antigenic peptides from one or more viruses or bacteria against which the individual has previously developed an immune response.25. The method of claim 24 , wherein the one or more viruses or bacteria against which the individual has previously developed an immune response are pathogenic or infectious.26. The method of claim 24 , wherein the viruses are selected from the group consisting of an influenza virus claim 24 , a cold virus claim 24 , an adenovirus claim 24 , an adeno-associated virus claim 24 , a cytomegalovirus (CMV) claim 24 , a measles virus claim 24 , an Epstein-Barr virus (EBV) claim 24 , human papillomavirus (HPV) claim 24 , a norovirus claim 24 , a polyoma virus claim 24 , a hepatitis A claim 24 , B and/or C virus claim 24 , a Zika virus claim 24 , a respiratory syncytial virus (RSV) claim 24 , and a herpes simplex virus (HSV)).27Escherichia coli, Salmonella, Helicobacter pylori, Staphylococcus aureus, StreptococcalCampylobacter. The method of claim 24 , wherein the bacteria are selected from the group consisting of spp. claim 24 , or spp.) claim 24 ,28. The method of claim 24 , wherein the viruses or bacteria are a virus or bacteria against which the individual previously has been inoculated.29Clostridium tetani.. The method of claim 28 , wherein the viruses or bacteria are selected from the group consisting of varicella-zoster virus (VZV)) claim 28 , polio claim 28 , Rubella spp. claim 28 , mumps claim 28 , Diphtheria claim 28 , and30. The method of claim 24 , wherein the adjuvant comprises at least three antigenic peptides from one or more viruses or bacteria.31. The method of claim 24 , wherein the administering is intratumorally.32. ...

Подробнее

Номер записи: 88

07-01-2021 дата публикации

ENGINEERED SPIKE PROTEINS OF HANTAVIRUSES AND USES THEREOF

Номер: US20210000940A1

Автор: BIGNON SILVA Eduardo Andrés, GUARDADO CALVO Pablo, REY Félix Augusto, TISCHLER Nicole

Принадлежит:

Hantavirus spike proteins with modifications to stabilize (Gn/Gc)n heterodimer contacts and/or Gc homodimer contacts and/or Gn/Gn oligomer contacts on the spike to enable their use as immunogens in next-generation vaccine design. The spike proteins have been covalently stabilized by at least one disulphide inter-chain bond between Gn/Gc heterodimers and/or between Gc homodimers and/or between Gn homo-oligomers as they are presented at the surface of infectious virions. Also, spike stabilization by introduction of cavity-filling amino acids with a bulky side chain at the above-mentioned contacts. The spike proteins can be soluble Gn/Gc ectodomains in solution and/or incorporated as (Gn/Gc)n hetero-oligomers onto virus-like particles (VLPs) and/or used for pseudotyping virus vectors and/or form part of a stabilized recombinant virus. The spike proteins can be used to select ligands and/or can be used for preventing or treating infections by one or more hantaviruses. 1. A stabilized hantaviral spike comprising at least one homodimer of mutants Gc , or at least one heterodimer of a mutant Gn and a mutant Gc , or at least one oligomer of mutants Gn , or a combination thereof.2. A stabilized hantaviral spike according claim 1 , comprising at least one homodimer of mutants Gc having each at least one amino acid mutation (substitution) at a position selected from the group consisting of: 676 claim 1 , 677 claim 1 , 678 claim 1 , 679 claim 1 , 680 claim 1 , 681 claim 1 , 682 claim 1 , 683 claim 1 , 832 claim 1 , 833 claim 1 , 834 claim 1 , 835 claim 1 , 836 claim 1 , 837 claim 1 , 838 claim 1 , 839 claim 1 , 840 claim 1 , 841 claim 1 , 842 claim 1 , 843 claim 1 , 844 claim 1 , 845 claim 1 , 846 claim 1 , 847 claim 1 , 951 claim 1 , 952 claim 1 , 953 claim 1 , 954 claim 1 , 955 claim 1 , 956 claim 1 , 957 and 958 claim 1 , the indicated positions being determined by alignment with SEQ ID NO: 1.3. The stabilized hantaviral spike according to claim 2 , comprising at least one ...

Подробнее

Номер записи: 89

07-01-2016 дата публикации

Compositions and Methods for the Production of Virus-Like Particles

Номер: US20160000901A1

Автор: Christopher S. Jones, Michael N. Blackburn, Nabil Elshourbagy

Принадлежит: Shifa Biomedical Corp

Compositions and methods for synthesizing virus-like particles (VLPs) and methods of use thereof are provided.

Подробнее

Номер записи: 90

05-01-2017 дата публикации

MONOVALENT H5 VACCINE

Номер: US20170000877A1

Автор: He Fang, Kwang Hwei-Sing Jimmy, MOOKKAN Prabakaran

Принадлежит: TEMASEK LIFE SCIENCES LABORATORY LIMITED

The present invention relates to a monovalent H5N1 vaccine. More specifically, the present invention relates to the development of a monovalent H5 vaccine strain using hemagglutinin (HA) engineering to elicit cross-clade protection. The present invention also relates to an epitope-chimeric H5 and to a reverse genetics (RG) influenza virus expressing the epitope-chimeric H5. 1. An isolated modified H5 protein selected from the group consisting of a modified H5 protein having the amino acid sequence set forth in SEQ ID NO:6 and a modified H5 protein having the amino acid sequence set forth in SEQ ID NO:8.2. The isolated modified H5 protein of which is the modified H5 protein having the amino acid sequence set forth in SEQ ID NO:6.3. The isolated modified H5 protein of which is the modified H5 protein having the amino acid sequence set forth in SEQ ID NO:8.4. A nucleic acid molecule encoding the modified H5 protein of .5. The nucleic acid molecule of having the nucleotide sequence set forth in SEQ ID NO:5.6. The nucleic acid molecule of having the nucleotide sequence set forth in SEQ ID NO:7.7. A vector comprising the nucleic acid molecule of .8. A host cell comprising the vector of .9. A recombinant avian influenza virus comprising the modified H5 protein of .10. The recombinant avian influenza virus of comprising a nucleic acid molecule encoding the modified H5 protein.11. The recombinant avian influenza virus of having the nucleotide sequence set forth in SEQ ID NO:5.12. The recombinant avian influenza virus of having the nucleotide sequence set forth in SEQ ID NO:7.13. A composition comprising the modified H5 protein of .14. A composition comprising the recombinant avian influenza virus of .15. The composition of which further comprises a pharmaceutically acceptable carrier.16. The composition of which further comprises an adjuvant.17. The composition of which is a vaccine.18. A method of eliciting a protective immune response to an avian influenza virus in a ...

Подробнее

Номер записи: 91

02-01-2020 дата публикации

INFLUENZA VIRUS REASSORTMENT

Номер: US20200000909A1

Автор: Dormitzer Philip, Keiner Bjoern, Mason Peter, Suphaphiphat Pirada, Trusheim Heidi

Принадлежит: Seqirus UK Limited

New influenza donor strains for the production of reassortant influenza A viruses are provided. 132-. (canceled)33. A non-naturally occurring reassortant influenza A virus comprising six backbone viral segments , a hemagglutinin (HA) segment , and a neuraminidase (NA) segment , wherein the reassortant influenza A virus comprises PB1 and PB2 viral segments from a same donor strain and (1) the PB1 viral segment comprises a nucleotide sequence that encodes a viral polypeptide with at least 80% identity to SEQ ID NO: 18 and (2) the PB2 viral segment comprises a nucleotide sequence that encodes a viral polypeptide with at least 80% identity to SEQ ID NO: 19.34. The reassortant influenza A virus of claim 33 , wherein the PB1 viral segment comprises a nucleotide sequence that encodes a viral polypeptide with at least 90% identity to SEQ ID NO: 18.35. The reassortant influenza A virus of claim 33 , wherein the PB1 viral segment comprises a nucleotide sequence that encodes a viral polypeptide with at least 99% identity to SEQ ID NO: 18.36. The reassortant influenza A virus of claim 33 , wherein the PB2 viral segment comprises a nucleotide sequence that encodes a viral polypeptide with at least 90% identity to SEQ ID NO: 19.37. The reassortant influenza A virus of claim 33 , wherein the PB2 viral segment comprises a nucleotide sequence that encodes a viral polypeptide with at least 99% identity to SEQ ID NO: 19.38. The reassortant influenza A virus of claim 33 , wherein the PB1 viral segment comprises a nucleotide sequence that encodes a viral polypeptide with at least 90% identity to SEQ ID NO: 18 and the PB2 viral segment comprises a nucleotide sequence that encodes a viral polypeptide with at least 90% identity to SEQ ID NO: 19.39. The reassortant influenza A virus of claim 33 , wherein the PB1 viral segment comprises a nucleotide sequence that encodes a viral polypeptide with at least 99% identity to SEQ ID NO: 18 and the PB2 viral segment comprises a nucleotide sequence ...

Подробнее

Номер записи: 92

03-01-2019 дата публикации

METHODS AND COMPOSITIONS RELATED TO INCREASING THE FIDELITY OF INFLUENZA A VIRUS FOR VACCINE DEVELOPMENT

Номер: US20190000958A1

Автор: Cox Andrew, Dewhurst Stephen

Принадлежит:

Disclosed are compositions and methods for related to mutant influenza viruses with increased fidelity. 1. A modified influenza A virus comprising one or more mutations in the influenza RNA polymerase , wherein the one or more mutations causes an increased fidelity of the polymerase.2. The modified influenza A virus of claim 1 , wherein the one or more mutations of the influenza RNA polymerase comprises at least one mutation in the PB1 or PA subunit of the RNA polymerase.3. The modified influenza A virus of claim 2 , wherein the influenza RNA polymerase comprises a mutation at one or more residues of an alpha helix of the PB1 subunit of the influenza RNA polymerase; a mutation at one or more residues of the loop formed by the amino acids corresponding to residues 77-80 of the PB1 subunit of the influenza RNA polymerase as set forth in SEQ ID NO: 4; a mutation at one or more residues of the loop formed by the amino acids corresponding to residues 228-240 of the PB1 subunit of the influenza RNA polymerase as set forth in SEQ ID NO: 4; a mutation at one or more residues of the loop formed by the amino acids corresponding to residues 306-311 of the PB1 subunit of the influenza RNA polymerase as set forth in SEQ ID NO: 4; or a substitution at one or more residues corresponding to residues 480 or 481 of the PB1 subunit of the influenza RNA polymerase as set forth in SEQ ID NO: 4.4. The modified influenza A virus of claim 3 , wherein the influenza RNA polymerase comprises a mutation at one or more residues of the alpha helix corresponding to residues 383 to 395 of the PB1 subunit of the influenza RNA polymerase as set forth in SEQ ID NO: 4.5. The modified influenza A virus of claim 4 , wherein the mutation comprises a Lysine to Aspartic acid substitution at a residue corresponding to residue 387 or 391 of the PB1 subunit of the influenza RNA polymerase as set forth in SEQ ID NO: 4.6. (canceled)7. (canceled)8. (canceled)9. The modified influenza A virus of claim 3 , wherein ...

Подробнее

Номер записи: 93

03-01-2019 дата публикации

NUCLEIC ACID VACCINES

Номер: US20190000959A1

Автор: BOUCHON Axel, Ciaramella Giuseppe, Huang Eric Yi-Chun

Принадлежит: ModernaTX, Inc.

The invention relates to compositions and methods for the preparation, manufacture and therapeutic use ribonucleic acid vaccines (NAVs) comprising polynucleotide molecules encoding one or more antigens. 1. A method of vaccinating a subject comprising administering to the subject a nucleic acid vaccine comprising one or more RNA polynucleotides comprising an open reading frame encoding an antigenic polypeptide that is derived from an infectious agent , wherein the RNA polynucleotide is formulated within a cationic lipid nanoparticle having a molar ratio of about 20-60% ionizable cationic lipid: about 5-25% non-cationic lipid: about 25-55% sterol; and about 0.5-15% PEG-modified lipid , wherein the nucleic acid vaccine elicits an immune response having a longer lasting antibody titer than an antibody titer elicited by a reference nucleic acid vaccine comprising the one or more RNA polynucleotides not formulated within a cationic lipid nanoparticle having a molar ratio of about 20-60% ionizable cationic lipid: about 5-25% non-cationic lipid: about 25-55% sterol; and about 0.5-15% PEG-modified lipid.2. The method of claim 1 , wherein the method comprises administering to the subject a single dosage of between 0.001 mg/kg and 0.005 mg/kg of the nucleic acid vaccine in an effective amount to vaccinate the subject.3. The method of claim 1 , wherein the open reading frame is codon-optimized.4. The method of claim 1 , wherein the ionizable cationic lipid nanoparticle has a polydispersity value of less than 0.4.5. The method of claim 1 , wherein the polynucleotide has a poly-A tail of 80-250 nucleotides in length.6. The method of claim 1 , wherein a second dose of the nucleic acid vaccine is administered to the subject.7. The method of claim 1 , wherein the RNA polynucleotide includes a chemical modification selected from the group consisting of pseudouridine claim 1 , N1-methylpseudouridine claim 1 , 2-thiouridine claim 1 , 4′-thiouridine claim 1 , 5-methylcytosine claim 1 , ...

Подробнее

Номер записи: 94

03-01-2019 дата публикации

VACCINE CONTAINING IMMOBILIZED VIRUS PARTICLES

Номер: US20190000960A1

Автор: Abe Motoharu, Ikeda Kazuyuki, Kimachi Kazuhiko, OHARA YUKI, Onuma Hiroto, Tsurudome Yukari, Watanabe Akihiro, YAMAUE Ryo

Принадлежит:

The present invention relates to a vaccine containing fixed virus particles, wherein a summed fever response of three rabbits to the fixed virus particles in a pyrogen test is less than 80% based on a summed fever response of three rabbits to original virus particles of the fixed virus particles or corresponding inactivated virus particles. 1. A vaccine containing fixed virus particles , whereina summed fever response of three rabbits to the fixed virus particles in a pyrogen test is less than 80% based on a summed fever response of three rabbits to original virus particles of the fixed virus particles or corresponding inactivated virus particles.2. The vaccine according to claim 1 , wherein the summed fever response of three rabbits to the fixed virus particles in the pyrogen test is 1.3° C. or lower.3. A vaccine containing fixed virus particles claim 1 , whereinan amount of an inflammatory cytokine produced from human peripheral blood mononuclear cells stimulated with the fixed virus particles is less than 80% based on an amount of the inflammatory cytokine produced from human peripheral blood mononuclear cells stimulated with original virus particles of the fixed virus particles or corresponding inactivated virus particles.4. The vaccine according to claim 1 , wherein the original virus particles of the fixed virus particles comprise orthomyxovirus particles claim 1 , flavivirus particles claim 1 , or picornavirus particles.5. The vaccine according to claim 4 , wherein the virus particles comprise influenza virus particles claim 4 , Japanese encephalitis virus particles claim 4 , or hepatitis A virus particles.6. The vaccine according to claim 5 , wherein the virus particles comprise influenza virus particles.7. The vaccine according to claim 6 , wherein the influenza virus particles comprise influenza A virus particles or influenza B virus particles.8. The vaccine according to claim 6 , wherein the influenza virus particles comprise influenza virus particles ...

Подробнее

Номер записи: 95

03-01-2019 дата публикации

VACCINE COMPOSITIONS

Номер: US20190000961A1

Автор: Drew Jeffrey

Принадлежит:

The present invention relates to the use of an excipient which is a compound of formula (I) or a physiologically acceptable salt or ester thereof: wherein: Rrepresents Calkyl; Rrepresents hydrogen or Calkyl; and Rrepresents Calkyl, for increasing the immunogenicity of an influenza antigen, which use comprises (a) freezing, (b) heat-treating, and/or (c) freeze-drying an aqueous composition comprising the influenza antigen and the excipient. 2. Use according to claim 1 , in which the compound of formula (I) is dimethylglycine or trimethylglycine.3. Use according to claim 2 , in which the compound of formula (I) is dimethylglycine.4. Use according to any one of to claim 2 , in which the aqueous composition further comprises one or more sugars.5. Use according to claim 4 , in which the one or more sugars are sucrose and raffinose.6. Use according to any one of the preceding claims claim 4 , in which the aqueous composition further comprises an adjuvant.7. Use according to claim 6 , in which the adjuvant is an aluminium salt adjuvant8. Use according to any one of the preceding claim 6 , in which the immunogenicity of the influenza antigen is increased during the (a) freezing claim 6 , (b) heat-treating claim 6 , and/or (c) freeze-drying of the aqueous composition.9. A method for increasing the immunogenicity of an influenza antigen claim 6 , said method comprising (a) freezing claim 6 , (b) heat-treating claim 6 , and/or (c) freeze-drying an aqueous composition comprising the influenza antigen claim 6 , an excipient as defined in any one of to claim 6 , optionally one or more sugars as defined in or and optionally an adjuvant as defined in or .10. A vaccine composition obtainable by the method defined in .11. A vaccine composition as defined in claim 10 , for use in the prevention of an influenza infection in a human or animal patient.12. A vaccine composition for use according to claim 11 , wherein the patient is (a) a child claim 11 , an elderly patient and/or a ...

Подробнее

Номер записи: 96

03-01-2019 дата публикации

RESPIRATORY SYNCYTIAL VIRUS VACCINE

Номер: US20190000962A1

Автор: YAN Huimin, YANG Jingyi, ZHAO Bali

Принадлежит: Wuhan Sanli BioTechnology Company Limited

A respiratory syncytial virus (RSV) vaccine comprising a recombinant fusion protein antigen. In one embodiment, the recombinant fusion protein antigen comprises a phosphoprotein (P) moiety, wherein the P moiety is a polypeptide that shares at least 90% identity to the polypeptide represented by SEQ ID NO 2 or SEQ ID NO 4; and a flagellin moiety, wherein the flagellin moiety is a polypeptide that shares at least 90% identity to the polypeptide represented by SEQ ID NO 8; whereby the P moiety and flagellin moiety are covalently coupled so as to form a linear polypeptide. 1. A respiratory syncytial virus (RSV) vaccine comprising a recombinant fusion protein antigen; wherein the recombinant fusion protein antigen comprises:a phosphoprotein (P) moiety, wherein the P moiety is a polypeptide that shares at least 90% identify to the polypeptide represented by SEQ ID NO 2 or SEQ ID NO 4; anda flagellin moiety, wherein the flagellin moiety is a polypeptide that shares at least 90% identity to the polypeptide represented by SEQ ID NO 8;where the P moiety and flagellin moiety are covalently coupled so as to form a linear polypeptide.2. The RSV vaccine of claim 1 , wherein the P moiety is a polypeptide that shares at least 98% identity to the polypeptide represented by SEQ ID NO 2 or SEQ ID NO 4; and wherein the flagellin moiety is a polypeptide that shares at least 98% identity to the polypeptide represented by SEQ ID NO 8.3. The RSV vaccine of claim 1 , wherein the P moiety is a polypeptide that shares at least 99% identity to the polypeptide represented by SEQ ID NO 2 or SEQ ID NO 4; and wherein the flagellin moiety is a polypeptide that shares at least 99% identity to the polypeptide represented by SEQ ID NO 8.4. The RSV vaccine of claim 1 , wherein the P moiety is a polypeptide represented by SEQ ID NO 2 or SEQ ID NO 4; and therein the flagellin moiety is a polypeptide represented by SEQ ID NO 8.5. The RSV vaccine of claim 1 , wherein the recombinant fusion protein antigen ...

Подробнее

Номер записи: 97

03-01-2019 дата публикации

ADJUVANT COMPOSITION CONTAINING AT LEAST ONE INFLUENZA VIRUS NEUTRALIZING AND BINDING MOLECULE AND VACCINE COMPOSITION CONTAINING SAME

Номер: US20190000968A1

Автор: Ahn Jung Sun, Chang Shin Jae, CHOI Jung Ah, Keum Sun Ju, Kim Pan Kyeom, Lee Soo Young, Lim Byung Pil, Park Eun Bee, Park Sang Tae, SONG Man Ki

Принадлежит: CELLTRION INC.

This invention relates to an adjuvant composition containing at least one binding molecule for neutralizing influenza virus and a vaccine composition containing the same. The composition containing at least one binding molecule for neutralizing influenza virus is capable of increasing the effects of a vaccine, and can thus be used as an adjuvant, which increases an immune response upon vaccine administration, and is very useful in the prevention of diseases caused by viruses. 19-. (canceled)10. A method of enhancing an immune response to a target antigen , comprising administering a vaccine composition comprising at least one binding molecule for neutralizing an influenza virus and a target antigen to a host.11. A method of preparing an immunological product , comprising:(a) immunizing a host by administering a vaccine composition comprising at least one binding molecule for neutralizing an influenza virus and a target antigen to the host; and(b) obtaining an immunological product from the immunized host, wherein the immunological product is a T cell, a B cell or an antibody against a target antigen comprised in the vaccine composition.12. A method of enhancing an immune response to an influenza A virus in a Subject which comprises administering to the subject a vaccine composition comprising a complex of the influenza A virus and an antibody directed to the influenza A virus.13. The method of claim 12 , wherein the antibody is specifically bound to the influenza A virus and the complex binds to an Fc receptor of immune cells.14. The method of claim 12 , wherein the ratio by weight of the influenza A virus to the antibody directed to the influenza A virus in the complex is between 1:0.02 and 1:200.15. The method of claim 12 , wherein the antibody directed to the influenza A virus bind to at least one epitope selected from the group consisting of i) an epitope comprising an amino acid residue selected from the group consisting of the amino acids at positions 18 claim ...

Подробнее

Номер записи: 98

03-01-2019 дата публикации

REDUCED FOAMING VACCINE COMPOSITIONS

Номер: US20190000978A1

Автор: Genin Noel Yves Henri Jean

Принадлежит:

The present invention relates to novel stable compressed vaccine composition comprising least one anhydrous antigenic component comprising a stabilizer susceptible to foaming when the composition is mixed with liquid diluent; and an effective amount of a sugar alcohol. 1. A process for reducing the foaming of a solid vaccine composition when mixed with a liquid diluent , wherein the composition comprises at least one anhydrous antigenic component comprising a stabilizer susceptible to foaming and an effervescent agent;wherein the process comprises adding an effective amount of die foam controlling agent which is a sugar alcohol to the solid vaccine composition, wherein the effective amount of sugar alcohol is about 15% to 40% by weight of the composition, andupon dissolution of the composition, the effervescent agent reacts and gas is formed in situ.2. The process according to claim 1 , wherein the process further comprises:compressing the solid vaccine composition to form a compressed vaccine composition.3. The process according to claim 1 , wherein the at least one anhydrous antigenic component is lyophilized or dried.4. The process according to claim 1 , wherein the stabilizer comprises one or more amino acid or salts thereof claim 1 , protein or salts thereof claim 1 , albumin claim 1 , gelatin claim 1 , or combinations thereof.5. The process according to claim 1 , wherein the at least one anhydrous antigenic component is newcastle disease virus claim 1 , infectious bronchitis virus claim 1 , fowl pox virus claim 1 , avian encephalomyelitis virus claim 1 , marek's disease virus claim 1 , trichophyton verrucosum claim 1 , avian paramyxovirus claim 1 , mycobacterium paratuberculosis claim 1 , meleagrid herpesvirus claim 1 , orf virus claim 1 , or sheep pox virus.6. The process according to claim 1 , wherein the at least one anhydrous antigenic component is newcastle disease virus or infectious bronchitis virus.7. The process according to claim 1 , wherein the ...

Подробнее

Номер записи: 99

06-01-2022 дата публикации

METHOD

Номер: US20220003767A1

Автор: KAPANIDIS Achillefs, ROBB Nicole, Taylor Jonathan

Принадлежит:

Provided herein is a method of functionalizing a particle, as well as methods of optically tracking a particle, isolating enveloped viral particles from a sample, quantifying enveloped virus particles in a sample and assessing enveloped viral aggregation in a sample. Kits are also provided. The particle is typically a viral particle. 1. A method of functionalizing a particle with a negatively charged polymer; the particle having a negatively charged surface and a lipid coating; wherein the method comprises contacting said particle with (i) a polyvalent cation and (ii) said polymer; such that the polymer binds to the particle thereby functionalizing the particle.2. A method according to wherein the particle is a nanoparticle.3. A method according to or wherein the particle is an enveloped virus particle.4. A method according to wherein the virus is selected from herpesviridae claim 3 , poxviridae claim 3 , pneumoviridae claim 3 , hepadnaviridae claim 3 , flaviviridae claim 3 , togaviridae claim 3 , coronaviridae claim 3 , hepatitis D virus claim 3 , orthomyxoviridae claim 3 , paramyxoviridae claim 3 , rhabdoviridae claim 3 , bunyaviridae claim 3 , filoviridae claim 3 , baculoviridae and retroviridae;wherein preferably the virus is an influenza virus.5. A method according to or wherein the virus is present in a biological fluid claim 3 , wherein preferably the biological fluid is allantoic fluid or is a cell culture medium.6. A method according to any one of the preceding claims wherein the polyvalent cation is a divalent metal cation; wherein preferably the polyvalent cation is Ca; optionally wherein the Ca is provided as CaCl).7. A method according to any one of the preceding claims wherein the negatively charged polymer is a polynucleotide claim 3 , a polypeptide claim 3 , a polysaccharide or a negatively charged polyether;wherein preferably the negatively charged polymer is a polynucleotide, preferably an oligonucleotide.8. A method according to any one of the ...

Подробнее

Номер записи: 100

Настройки

Небесная энциклопедия

Мониторинг СМИ

Форма поиска