LABYRINTH SEAL Of ASPIRATION

Corps (48) de joint comprenant une partie annulaire (72) à extension axiale, une partie (70) à extension radiale définissant une surface d'étanchéité principale (50), et coopérant avec la partie (72) à extension axiale pour définir une section transversale de forme globalement en L ; et au moins une dent d'étanchéité annulaire (88) à extension axiale.

METHOD AND SYSTEM FOR IMPLEMENTING AN IMPLANTABLE MEDICAL DEVICE

CONTROL CIRCUIT ENTERS a PORT Of a MICROPROCESSOR AND a BODY MALADJUSTMENT

DEVICE OF TRANSMISSION OF COUPLE

A TORQUE TRANSMISSION DEVICE IN WHICH ROTATION [...][...] A FRICTION CLUTCH

SHOCK ABSORBER Of OSCILLATIONS IN TORSION

MECHANICAL BLOCKING SYSTEM OF PARTS

A torque transmission device.

DEVICE OF TRANSMISSION OF COUPLE

Container for receiving and dispensing of elongated pins such as toothpicks, has receiving chamber for storing pins or toothpicks, where receiving chamber is formed by inner part which is rotatably mounted with its cylindrical outer side

The container has a receiving chamber (3) for storing the pins or toothpicks, where the receiving chamber is formed by an inner part (2) which is rotatably mounted with its cylindrical outer side coaxially in the hollow-cylindrical outer part (1). The inner part has an actuating part, particularly a tongue which is fitted with a cam as analyzer or over an intermediate part at an inner-sided inclined surface, particularly curved path of the outer part.

Hearing assistance system for providing consistent human speech

Broadly speaking, the embodiments disclosed herein describe an apparatus, system, and method that allows a user of a hearing assistance system to perceive consistent human speech. The consistent human speech can be based upon user specific preferences.

Catalyst and process for preparing same

RFI shielded plastic articles and process for making same

An RFI shielded enclosure and a process for making same are disclosed. The process comprises coating at least one surface of the enclosure with a fluid organic binder having a substantial percentage of catalytic particles suspended therein. The particles used cause the electroless deposition of copper or nickel to produce an RFI shielded enclosure having in excess of 40 dB's shielding at frequencies above 10 kiloHertz.

System of electrical distribution.

Valved conduit

Various aspects of the present disclosure are directed toward apparatuses, systems, and methods that include a valved conduit. The valved conduit comprises a conduit having and an exterior surface and an interior surface defining a lumen; and at least one leaflet having an external portion extending from the exterior surface of the conduit and an internal portion extending from the interior surface into the lumen of the conduit. FIG. 3 18386865_1 (GHMatters) P113376.AU.1 WO 2019/089137 3/8 PCT/US2018/050771 320 2 12 ~ 3 18 10 100 212 1 08 330-,W 328 216 322 350 - .. ---- 106 it 322 104 212 102 FIG. 3

Apparatus and method of detecting movement of objects within the abdominal and/or pelvic region

Aspects of an apparatus and method for detecting movement of an object includes a base and a projection member extending between a first second ends, wherein the first end is attached to the base. Further included is a support member at the second end of the projection member, and a guide wire carried by the support member and having a substantially fixed length, wherein the guide wire is movable between a first position and a second position in conjunction with movement of an object. Also included is a sensor located a substantially fixed distance along a path of the guide wire from the support member, wherein the sensor detects movement of the guide wire between the first second positions. Additionally included is a feedback unit in communication with the sensor, wherein the feedback unit is configured to generate feedback corresponding to the detected movement.

Functional epitopes of the Streptococcus pneumoniae PsaA antigen and uses thereof

Un péptido que comprende la secuencia de aminoácidos definida en la SEC ID Nº 1. A peptide comprising the amino acid sequence defined in SEQ ID No. 1.

Microstrip phase shifting reflect array antenna

Hearing assistance system for providing consistent human speech

Broadly speaking, the embodiments disclosed herein describe an apparatus, system, and method that allows a user of a hearing assistance system to perceive consistent human speech. The consistent human speech can be based upon user specific preferences.

Remotely updating a hearing and profile

Broadly speaking, the embodiments disclosed herein describe replacing a current hearing aid profile stored in a hearing aid. In one embodiment, the hearing aid profile is updated by sending a hearing aid profile update request to a hearing aid profile service, receiving the updated hearing aid profile from the hearing aid profile service, and replacing the current hearing aid profile in the hearing aid with the updated hearing aid profile.

Remotely updating a hearing aid profile

Broadly speaking, the embodiments disclosed herein describe replacing a current hearing aid profile stored in a hearing aid. In one embodiment, the hearing aid profile is updated by sending a hearing aid profile update request to a hearing aid profile service, receiving the updated hearing aid profile from the hearing aid profile service, and replacing the current hearing aid profile in the hearing aid with the updated hearing aid profile.

Providing notification sounds in a customizable manner

Broadly speaking, the embodiments disclosed herein describe an apparatus, system, and method that allow a user to perceive notifications (audible or otherwise) corresponding to an external event in any manner deemed appropriate.

Recombinant lipidated psaa protein, methods of preparation and use

The present invention relates to recombinant lipidated PsaA proteins and recombinant constructs from which such lipidated PsaA proteins may be expressed. The invention relates further to lipidated PsaA proteins in which lipidation is effected by the use of a heterologous leader sequence derived from the ospA gene of Borrelia burgdorferi, which leader sequence is joined in translational reading frame with the psaA structural gene. The invention also provides methods of preparation of lipidated PsaA proteins and use of such proteins in immunological compositions. Also provided are vaccines comprising immunogenic lipidated PsaA proteins and methods of use of such vaccines in the prevention and treatment of S.pneumoniae infection.

20-dimethylamino-pregnenes and their quaternary halides

Multiphase transformer.

Functional epitopes of Streptococcus pneumoniae PsaA antigen and uses thereof

Provided is a P4 peptide, which contains functional epitopes of the PsaA protein of Streptococcus pneumoniae , and related methods and compositions. P4 peptide mimetics having a conformational structure identical or similar to the conformation of P4 (e.g., SEQ ID NO: 1 and SEQ ID NO:2) are provided. An antibody that specifically binds to the epitope defined by the disclosed peptides is provided. A P4-specific antibody is PsaA-specific since P4 defines an epitope specific for PsaA. Immunogenic compositions comprising the peptide of SEQ ID NO: 1 and a pharmaceutical carrier or the peptide of SEQ ID NO:2 and a pharmaceutical carrier are also provided. Methods of using the peptides and antibodies of the invention are provided.

Functional epitopes of streptococcus pneumoniae psaa antigen and uses thereof

Provided is a P4 peptide, which contains functional epitopes of the PsaA protein of Streptococcus pneumoniae, and related methods and compositions. A peptide that comprises the amino acid sequence defined in SEQ ID NO:1 (an example of the P4 peptide) is provided. Also provided is a peptide comprising the amino acid sequence defined as VPSLFVDSSVDDRPMKTVSQDTNIPIYAQIFTDS (SEQ ID NO:2). P4 peptide mimetics having a conformational structure identical or similar to the conformation of P4 (e.g., SEQ ID NO: 1 and SEQ ID NO:2) are provided. An antibody that specifically binds to the epitope defined by the disclosed peptides is provided. For example, the antibody can specifically bind to a peptide comprising the sequence set forth in SEQ ID NO: 1 and having the conformation defined by the peptide consisting of SEQ ID NO: 1. An antibody that specifically binds to a peptide comprising the sequence set forth in SEQ ID NO:2 and having the conformation defined by the peptide consisting of SEQ ID NO:2 is also provided. A P4-specific antibody is PsaA-specific since P4 defines an epitope specific for PsaA. A vaccine comprising the peptide of SEQ ID NO: 1 and a pharmaceutical carrier is provided. A vaccine comprising a peptide of SEQ ID NO:2 and a pharmaceutical carrier is also provided. Methods of using the peptides and antibodies of the invention are provided. Diagnostic kits comprising a P4 peptide is also provided.

Epitope peptides immunogenic against (streptococcus pneumoniae)

Surfaces

Frame structure for track-type vehicle

A modular construction for a crawler assembly in track-type vehicles and a structural arrangement of the crawler assembly with the vehicle frame are described. In each crawler assembly there is a central side frame member which is integral with the vehicle frame and extends laterally from it for carrying the crawler track in the intermediate portion of its travel. Each central side frame member is equipped with upwardly-extending track support rollers carrying the crawler track while downwardly-extending track rollers are provided for guiding the crawler track and supporting the vehicle on the surface on which it is traveling. The idler roller is carried by a first modular member which is bolted to a first end of the side frame member. A second modular member carrying the crawler sprocket is bolted to the other end of the central side frame member. In order to provide track rollers immediately adjacent the idler roller and the crawler sprocket bogies are pivotally mounted, respectively, at each end of the central side frame member, and these bogies carry, respectively, a pair of track rollers. The bogies are arranged to extend, respectively, to points adjacent the idler roller and the crawler sprocket.

Method for detecting low power on an FPGA interface device

A method is disclosed for alerting a user of a low power condition on, for instance, an FPGA interface device. An interface device having a microcontroller and an associated power plane for powering the microcontroller and other component on the interface device includes a detection circuit coupled to monitor the voltage level of the associated power plane. When the voltage level of the voltage plane falls below a predetermined threshold voltage, the detection circuit sends a low power flag to a host system. The low power flag, which is preferably sent to the host system using a USB port connection, alerts the host system of the low power condition on the interface device. The predetermined threshold voltage is selected to be a suitable amount higher than the minimum operating voltage for the microcontroller so as to allow sufficient time for the microcontroller to send the low power flag to the host system. In response thereto, the host system may take suitable action such as, for instance, alerting the user, resetting the microcontroller, aborting a download process, and so on.

Turbine-bucket construction.

Valved conduit

Various aspects of the present disclosure are directed toward apparatuses, systems, and methods that include a valved conduit. The valved conduit may include at least one leaflet and an interior surface that mitigates against thrombus formation within the conduit.

Light cover

A light cover has a transparent element manufactured from polycarbonate and an infrared filter angled so as to reflect infrared radiation emitted from a light source way from both the transparent element and the light source.

Controller for electric generating systems

Recombinant lipidated psaa protein, methods of preparation and use

The present invention relates to recombinant lipidated PsaA proteins and recombinant constructs from which such lipidated PsaA proteins may be expressed. The invention relates further to lipidated PsaA proteins in which lipidation is effected by the use of a heterologous leader sequence derived from the ospA gene of Borrelia burgdorferi, which leader sequence is joined in translational reading frame with the psaA structural gene. The invention also provides methods of preparation of lipidated PsaA proteins and use of such proteins in immunological compositions. Also provided are vaccines comprising immunogenic lipidated PsaA proteins and methods of use of such vaccines in the prevention and treatment of S.pneumoniae infection.

Hydrocarbon cracking catalyst

Hydrocracking catalyst and process

Abstract of the Disclosure An improved hydrocracking catalyst and a process for hydrocracking high boiling nitrogen and sulfur contaminated feedstocks using a novel catalyst are disclosed. The cata-lyst comprises an ultrastable, large pore, crystalline alumin-osilicate material containing less than 1% alkali metal and having a cubic cell size in the range of 24.53 .ANG.-24.57°A, a hydrogenation component and a co-catalytic porous matrix.

Process and apparatus for converting hydrocarbon oils

Electric circuit breaker

Preparation of hydrocarbon conversion catalysts

PREPARATION OF HYDROCARBON CONVERSION CATALYSTS Abstract of the Disclosure Zeolite containing catalyst compositions are prepared by partially crystallizing a zeolite precursor reaction mixture which contains zeolite seed particles capable of initiating the rapid crystallization of zeolite to form a zeolite suspended in an excess of aqueous alkali metal silicate solution. The crystallization reaction is terminated after the desired quantity of zeolite has been formed, and the excess silicate is gelled to form an amorphous hydrogel matrix therefor. Preferably the process is conducted on a continuous basis. The zeolites are useful as hydrocarbon conversion catalysts.

Remotely controlling a hearing device

Systems, methods, and non-transitory computer-readable storage media are provided for remotely controlling a hearing device. A hearing device configured to communicate with a control device transmits status data, including settings, to the control device. The control device displays the status data in an interface configured to receive input specifying new settings, upon which a command is sent to the hearing device to change the current setting. The control device can automatically change the settings based on a determined current environment to be a stored program optimized to the current environment. The current environment can be determined based on the location of the hearing device or another device connected to the control device. Quick mode allows settings to be viewed and changed quickly by displaying multiple related settings as one and overriding interface buttons. Remote listen mode receives audio data from a microphone and transmit it to the hearing device.

Selective nickel stripping compositions and method of stripping

ABSTRACT Stripping solutions comprising hydrogen peroxide and sulfamic acid in correlated amounts are effective for the rapid and selective removal of nickel from mild steel surfaces and nickel, nickel alloy and nickel reaction products from alloy substrates.

Process for improving the physical and catalytic properties of fluid cracking catalysts

A process for significantly improving the physical and catalytic properties of fluid cracking catalysts (FCC) is disclosed. The invention is a process for manufacturing a fluid cracking catalyst. The process includes adding an effective amount of an acid stable surfactant or an alkaline stable surfactant to a slurry of clay particles and sodium silicate particles. The process then includes forming a sol binder and spray drying the particles. Forming of the dried particles into a catalyst product then occurs.

Tube forming method

Controls for material handling magnets

Prosthetic valve with expandable frame and associated systems and methods

Aspects of the disclosure relate to prosthetic valves having a frame, a frame cover, and a leaflet construct. Some aspects are directed to a diametric taper for the prosthetic valve for achieving enhanced performance of the prosthetic valve under operational conditions, enhanced compressibility and delivery characteristics, and other additional or alternative advantages. Other aspects are directed toward unique assembly and attachment methods for securing leaflet constructs to support structures. Other aspects are directed toward features for interacting with transcatheter delivery systems. Still other aspects are directed to such apparatuses, systems, and methods for valve replacement, such as cardiac valve replacement.

Apparatus for distributing solids

Functional epitopes of streptococcus pneumoniae psaa antigen and uses thereof

Provided is a P4 peptide, which contains functional epitopes of the PsaA protein of Streptococcus pneumoniae, and related methods and compositions. A peptide that comprises the amino acid sequence defined in SEQ ID NO:1 (an example of the P4 peptide) is provided. Also provided is a peptide comprising the amino acid sequence defined as VPSLFVDSSVDDRPMKTVSQDTNIPIYAQIFTDS (SEQ ID NO:2). P4 peptide mimetics having a conformational structure identical or similar to the conformation of P4 (e.g., SEQ ID NO: 1 and SEQ ID NO:2) are provided. An antibody that specifically binds to the epitope defined by the disclosed peptides is provided. For example, the antibody can specifically bind to a peptide comprising the sequence set forth in SEQ ID NO: 1 and having the conformation defined by the peptide consisting of SEQ ID NO: 1. An antibody that specifically binds to a peptide comprising the sequence set forth in SEQ ID NO:2 and having the conformation defined by the peptide consisting of SEQ ID NO:2 is also provided. A P4-specific antibody is PsaA-specific since P4 defines an epitope specific for PsaA. A vaccine comprising the peptide of SEQ ID NO: 1 and a pharmaceutical carrier is provided. A vaccine comprising a peptide of SEQ ID NO:2 and a pharmaceutical carrier is also provided. Methods of using the peptides and antibodies of the invention are provided. Diagnostic kits comprising a P4 peptide is also provided.

Frame construction for power shovels and the like

In a machine having an upper moveable frame, a frame for supporting the upper moveable frame including a rigid grid structure, an upper plate disposed on and rigidly secured to the grid structure and a pad for supporting the upper moveable frame, such support pad being disposed unattached to the grid structure and rigidly attached to the upper plate.

Weaving mechanism

Hook and eye.

Fluid containing structure

A conduit or other fluid containing structure includes a metal tube having end portions which are exposed for connecting purposes and a liner portion of reduced wall thickness between the end portions. An impregnated braid surrounds the liner portion for rigidifying the same. When the conduit is used as a self-sealing fuel line the thickness of the liner is such that it does not possess enough strength to take on a permanent outward deformation in the presence of the impregnated braid surrounding it, and consequently petalling does not occur. In that application the impregnated braid is surrounded by a sealant capable of swelling when contacted by the fuel, and the sealant is encircled by another impregnated braid to protect and maintain it in place.

Apparatus for heating water.

Process for improving the physical and catalytic properties of fluid cracking catalysts

A B S T R A C T A process for significantly improving the physical and catalytic properties of faujasite containing fluid cracking catalysts (FCC) employing a sol binder by incorporating acid stable surfactants into the catalyst component streams prior to spray drying.

Vise

Resid fluid cracking catalyst

FLUID CRACKING CATALYST Abstract of the Disclosure A process for preparing a fluid cracking catalyst by mixing clay with an inorganic binder, such as sodium silicate, spray drying the resulting mixture, water washing to remove excess sodium, calcining at a temperature of 1800 to 1900°F., adding water, sodium hydroxide, meta-koalin and nucleation centers to the resulting mass, hot aging the resulting mass for a period of 14 to 16 hours at 150 to 212°F. to insure zeolite formation, filtering to remove the mother liquor, washing, rare earth exchang-ing the washed product, flash drying and recovering the finished product.

Vehicle navigation display

A mobile navigation system includes a graphical display for presentation of map information. Map features are selected for presentation on a display. Characteristics for display are also selected. The characteristics for display include a scale for display that varies across the display. An image for display is generated from the selected features according to a selected scale.

Means for cooling valves

Hydrocarbon cracking catalysts

Liquid polishing composition

Solid particle manufacture

Process for producing dry zinc salt and granular protein fodder mixture suitable for foddering ruminants

Hydrocarbon conversion catalyst preparation

A dense, highly attrition resistant catalyst is prepared by reacting an alkali-metal silicate and aluminate under conditions which produce a thermally and hydrothermally stable cogel having a substantial surface area in pores ranging from about 25 to 75A°. The catalyst includes excess silicate obtained as a by-product from a Type Y zeolite synthesis.

Preparation of zeolites

Development of a real-time pcr assay for detection of pneumococcal dna and diagnosis of pneumococcal disease

Disclosed are compositions and methods for detecting a specific sequence of the psaA gene using real-time PCR for diagnosis of Pneumococcal Disease.

Dew point measuring device

Epitope peptides immunogenic against streptococcus pneumoniae

The invention provides a nucleic acid encoding the 37-kDa pneumococcal surfa ce adhesion A protein (PsaA) from Streptococcus pneumoniae. Also provided are isolated nucleic acids comprising a unique fragment of at least 10 nucleotid es of the 37-kDa protein. The invention also provides purified polypeptides encoded by the nucleic acid encoding the 37-kDa protein from and the nucleic acids comprising a unique fragment of at least 10 nucleotides of the 37-kDa protein. The invention further provides monoclonal antibodies which selectively bind PsaA. In addition peptides are provide that immunospecifically bind to the monoclonal antibodies of the invention, and that are immunogenic against Streptococcus pneumoniae infection. Also provid ed are vaccines comprising such immunogenic polypeptides, and methods of conferring protective immunity against Streptococcus pneumoniae infection by administering therapeutic compositions comprising the immunogenic peptides o f the invention. Also provided are methods of detecting the presence of Streptococcus pneumoniae in a sample using antibodies or antigens, and metho ds of preventing and treating Streptococcus pneumoniae infection in a subject. In addition a method of identifying the sequence of a peptide potentially capab le of eliciting protective immunity against a pathogenic microorganism is provided.

Gear train and method of aligning component gears thereof

A method of assembling a gear train including at least two shafts each journaled in at least one gear and bearing, in a support assembly, comprising forming openings in the support assembly having cross sectional areas greater than the cross sectional areas of the bearings, positoning the bearings in the openings, meshing the gears to provide a desired clearance and alignment of the shafts, inserting a moldable, hardenable material in the openings between the support assembly and the bearings and then hardening the material to fix the position of the bearings and, correspondingly, assure the desired clearance of the gears and alignment of the shafts without requiring accurate machining of the openings in the support assembly.

Tire tester

Method for distilling mineral oils

Selection of text prediction results by an accessory

A method for entering text in a text input field using a non-keyboard type accessory includes selecting a character for entry into the text field presented by a portable computing device. The portable computing device determines whether text suggestions are available based on the character. If text suggestions are available, the portable computing device can determine the text suggestions and send them to the accessory, which in turn can display the suggestions on a display. A user operating the accessory can select one of the text suggestions, expressly reject the text suggestions, or ignore the text suggestions. If a text suggestion is selected, the accessory can send the selected text to the portable computing device for populating the text field.

Message-based identification of an electronic device

A message-based identification process can facilitate reliable interoperation between accessories and host devices. During an identification process, the devices can negotiate an operating agreement that specifies particular communications (e.g., messages) that each device is permitted to send to or receive from the other, for example by having one device send a list of specific messages that it intends to send to and/or receive from the other. The other device can review the proposal and either accept or reject it. If a proposal is accepted, the devices can begin interoperating using messages that were included in the agreed-upon proposal while ignoring any received messages that were not included in the agreed-upon proposal.

Cracking catalyst composition

CRACKING CATALYST COMPOSITION Abstract of the Disclosure An improved catalytic cracking catalyst composition which contains a rare earth exchanged crystalline aluminosilicate zeolite, clay, alumina, an inorganic oxide sol binder or typical alumina-silica type binder and combinations thereof and a minor quantity of platinum and/or palladium. A catalyst is particularly effective for the catalytic cracking of hydrocarbon feedstocks which contain high levels of sulfur and/or heavy metals.

Recombinant lipidated PsaA protein, methods of preparation and use

A hybrid nucleic acid molecule comprising a first nucleic acid sequence encoding a signal sequence of a lipoprotein other than PsaA and a second nucleic acid sequence encoding a mature PsaA protein, or fragment thereof, wherein the signal sequence of the lipoprotein, preferably OspA of a Borrelia species, is contiguous with the second nucleic acid sequence.; a process for the production of a recombinant lapidated PsaA protein; a recombinant PsaA protein produced by the process; an immunological composition comprising the recombinant psaA protein; the use of the immunological composition for the manufacture of a medicament for immunizing a host against pneumococcal infection; and an immunogenic composition for intranasal administration to a host susceptible to pneumococcal carriage to elicit a protective immunological response against colonization with Streptococcus pneumoniae in the nasopharynx, which comprises an immunizing amount of recombinant lapidated PsaA. (62) Divided out of 506428

Motor controller

Lamp

Silica-alumina hydrogel catalyst

#5557 SILICA-ALUMINA HYDROGEL CATALYST Abstract A dense, attrition resistant catalyst is prepared by precipitating a silica alumina hydrogel at high pH, and subsequently reacting the alkaline hydrogel with sufficient acid aluminum salt at a pH below 4 to obtain an acidic hydrogel slurry. The slurry is then processed into a catalyst by spray drying, washing and ion exchanging. The catalyst may include substantial quantities of clay and/or crystalline aluminosilicate zeolites.

Prosthetic valve with expandable frame and associated systems and methods

Aspects of the disclosure relate to prosthetic valves having a frame, a frame cover, and a leaflet construct. Some aspects are directed to a diametric taper for the prosthetic valve for achieving enhanced performance of the prosthetic valve under operational conditions, enhanced compressibility and delivery characteristics, and other additional or alternative advantages. Other aspects are directed toward unique assembly and attachment methods for securing leaflet constructs to support structures. Other aspects are directed toward features for interacting with transcatheter delivery systems. Still other aspects are directed to such apparatuses, systems, and methods for valve replacement, such as cardiac valve replacement.

Immortalization of human endothelial cells

Hydrocarbon cracking process

HYDROCARBON CRACKING PROCESS Abstract of the Disclosure A mixture of rare earth hydrogen Y type zeolite, and hydrogen or transition metal exchanged mordenite, calcium exchanged type A zeolite, or hydrogen exchanged erionite is used as a catalyst for the conversion of hydrocarbons. The rare earth hydrogen Y, and exchanged mordenite, type A zeolites, or hydrogen exchanged erionite may be advantageously combined with amorphous matrix components such as silica, alumina, silica-alumina hydrogel and/or clay to form cracking catalyst compositions of the fluid or moving bed type which are particularly active for the production of C3 and C4 hydrocarbons, and/or which show improved coke selectivity.

Motor controller

System of power transmission and distribution

Message-based identification of an electronic device

A message based identification process can facilitate reliable interoperation between accessories and host devices. During an identification process, the devices can negotiate an operating agreement that specifies particular communications (e.g., messages) that each device is permitted to send to or receive from the other, for example by having one device send a list of specific messages that it intends to send to and/or receive from the other. The other device can review the proposal and either accept or reject it. If a proposal is accepted, the devices can begin interoperating using messages that were included in the agreed upon proposal while ignoring any received messages that were not included in the agreed upon proposal.

Process for improving the physical and catalytic properties of a fluid cracking catalyst

A process for significantly improving the physical and catalytic properties of fluid cracking catalysts (FCC) is disclosed. The invention is a process for manufacturing a fluid cracking catalyst. The process includes adding an effective amount of an acid stable surfactant or an alkaline stable surfactant to a slurry of clay particles and sodium silicate particles. The process then includes forming a sol binder and spray drying the particles. Forming of the dried particles into a catalyst product then occurs.

Multiple antigenic peptides immunogenic against streptococcus pneumoniae

Streptococcus pneumoniale 37-kDa surface adhesion A protein

The invention provides a nucleic acid encoding the 37-kDa protein from Streptococcus pneumoniae . Also provided are isolated nucleic acids comprising a unique fragment of at least 10 nucleotides of the 37-kDa protein. The invention also provides purified polypeptides encoded by the nucleic acid encoding the 37-kDa protein from and the nucleic acids comprising a unique fragment of at least 10 nucleotides of the 37-kDa protein. Also provided are antibodies which selectively binds the polypeptides encoded by the nucleic acid encoding the 37-kDa protein and the nucleic acids comprising a unique fragment of at least 10 nucleotides of the 37-kDa protein. Also provided are vaccines comprising immunogenic polypeptides encoded by the nucleic acid encoding the 37-kDa protein and the nucleic acids comprising a unique fragment of at least 10 nucleotides of the 37-kDa protein. Further provided is a method of detecting the presence of Streptococcus pneumoniae in a sample comprising the steps of contacting a sample suspected of containing Streptococcus pneumoniae with nucleic acid primers capable of hybridizing to a nucleic acid comprising a portion of the nucleic acid encoding the 37-kDa protein, amplifying the nucleic acid and detecting the presence of an amplification product, the presence of the amplification product indicating the presence of Streptococcus pneumoniae in the sample. Further provided are methods of detecting the presence of Streptococcus pneumoniae in a sample using antibodies or antigens, methods of preventing and treating Streptococcus pneumoniae infection in a subject.

Relay

Apparatus and method for combining multiple laser beams in laser material processing systems

Each one of multiple laser sources are independently separately mounted on a laser material processing platform and their beam paths are combined by a combiner which includes one or more optical elements mounted in the laser material processing platform which make the beam paths parallel and colinear. The combined beams are then moved in X and Y planes relative to a workpiece supported in the laser material processing platform under the control of a computer in the performance of work in accordance with a work program. The beam path of each laser source and the optical axis of the beam delivery system are each pre-aligned to the same predetermined reference and automatically coincide upon installation such that these components are rapidly and interchangeably interfaceable. The beams are orthogonally polarized and the optical elements of the combiner transmit one beam while reflecting another beam. While two laser beams are shown, an infinite number of laser beams may be used.

Process of converting hydrocarbon compounds

Compounds and methods for preventing or treating sensory hair cell death

Motor controller

Device and method for programming multiple arrays of semiconductor devices

A method in accordance with the present invention includes programming a plurality of semiconductor devices simultaneously, thereby dramatically increasing the number of devices programmed within a predetermined time. In one embodiment, this method includes arranging a first plurality of semiconductor devices into an array configuration. The first array is then programmed while a second plurality of semiconductor devices is arranged into the array configuration. The second array is then programmed, while the first array is unloaded and a third plurality of semiconductor devices is arranged into the array configuration. The present invention further includes the step of moving the first plurality of semiconductor devices in the array configuration to a programming position and the step of transferring the first plurality of semiconductor devices to an unloading position. The steps of moving or transferring includes providing a vacuum, mechanical pick-up, or magnetic pick-up for moving the semiconductor devices. In one embodiment, the step of loading is performed by a first arm capable of three dimensional movement, and the step of unloading is performed by a second arm capable of three dimensional movement independent of the first arm. In this embodiment, the step of moving or transferring is performed with a dual head array mechanism capable of moving independently from the first and second arms.

Motor controller

Motor controller

Self-catalyzing rapid degradable polyester polymers and preparation method and use thereof

The present invention discloses a self-catalyzing rapid degradable polyester polymer, its preparation method and use thereof. The polyester polymers provided in this invention not only have good machinery processing performance, but also can be quickly degraded in appropriate of environment with water and the degradation is not relying on micro-organism or bacterial, therefore the invention effectively resolved the environment pollution problems resulted in the applications of such kind of polyester polymers. It satisfied the wide application demands and especially it ensured such kind of polymers can be applied in beverage bottle, food package films, especially mulch films, shopping bags and other food package containers. In addition, the method of preparation in present invention is simple and at low cost, the raw materials are easy to be obtained at low price. It is suitable to volume production and has practical value and application potentials.

Controller for motor-driven traveling devices

Process for preparing transferrin-indole-dihydroindole alkaloid derivatives

Hydrotalcite sulfur oxide sorption

Hydrotalcite-like materials are stable in the crystalline oxide structure an d essentially reversible in anion exchange. A novel process of sulfur oxide sorption is provided utilizing these hydrotalcite materials as contact solids. Large crystalline sheet materials having increased sorption of SO x are provided by incorporation of certain organic acid anion ic species to modify the hydrotalcite/brucite structure. Typical industrial applications include sulfur removal from fluid catalyst cracking process, cold-side combustion gas sulfur abatement and cleaner coal gasification.

Prosthetic valve with expandable frame and associated systems and methods

A prosthetic valve configured to be diametrically collapsible into a compact delivery configuration, the prosthetic valve comprising: a support structure having an outer side and an inner side and a central longitudinal axis and including, a frame including a plurality of frame members and a plurality of commissure posts, and a plurality of constraint retainers configured to slidably receive one or more constraints of a delivery catheter, the frame extending from a distal end to a proximal end; and a leaflet construct including a plurality of leaflets spaced circumferentially about the leaflet construct, the plurality of leaflets being operatively coupled to the frame. FIG.1 17940104_1 (GHMatters) P112989.AU.1 65 C1-" CC14 a'' C-'t C-14C I 1/26

Selection of text prediction results by an accessory

A method for entering text in a text input field using a non-keyboard type accessory includes selecting a character for entry into the text field presented by a portable computing device. The portable computing device determines whether text suggestions are available based on the character. If text suggestions are available, the portable computing device can determine the text suggestions and send them to the accessory, which in turn can display the suggestions on a display. A user operating the accessory can select one of the text suggestions, expressly reject the text suggestions, or ignore the text suggestions. If a text suggestion is selected, the accessory can send the selected text to the portable computing device for populating the text field.

Amorphous inorganic gel - vk3

Prosthetic valve with expandable frame and associated systems and methods

Aspects of the disclosure relate to prosthetic valves having a frame, a frame cover, and a leaflet construct. Some aspects are directed to a diametric taper for the prosthetic valve for achieving enhanced performance of the prosthetic valve under operational conditions, enhanced compressibility and delivery characteristics, and other additional or alternative advantages. Other aspects are directed toward unique assembly and attachment methods for securing leaflet constructs to support structures. Other aspects are directed toward features for interacting with transcatheter delivery systems. Still other aspects are directed to such apparatuses, systems, and methods for valve replacement, such as cardiac valve replacement.

Upset lock pin for chain belts

Tensioning apparatus and system for clamping joints

A new system and apparatus for detachably joining a first component to a second component is disclosed, along with a method for detachably joining two components. Embodiments of the present invention include a tensioning apparatus and system for clamping joints. The tensioning apparatus may include a wedge block and a fastening device. The clamping joint may be a tongue and groove joint that is tightened using the tensioning apparatus.

Valved conduit

VALVED CONDUIT ABSTRACT A valved conduit (101) comprising: a conduit (200) including a first conduit (210) having a first conduit distal end (214) and a second conduit (260) having a second conduit proximal end (262), the conduit has a conduit inner surface (202) and a conduit outer surface (204) the first conduit distal end defining a plurality of commissure slots (217); and a valve structure (120) including at least one leaflet (310), each leaflet having a free edge (312) and a leaflet attachment edge (326), the leaflet attachment edge disposed between the first conduit distal end and the second conduit proximal end that are coaxial therebetween defining a junction (280), wherein the leaflet attachment edge is coupled between the first conduit distal end and the second conduit proximal end, wherein the first conduit distal end, the leaflet attachment edge, and the second conduit proximal end are coupled together with suture (700). FIG.16 20/22 101 .01260 -262 280 700 214 500,-210 FIG. 16

Verfahren zur verbesserung der physikalischen und katalytischen eigenschaften eines fluidisierten krackkatalysators

Prosthetic valve with expandable frame

Sheave with replaceable rim

Monterings- og dispenseranordning for en sylindrisk pakking med viklede fleksible plastposer el.l.