Настройки

Укажите год
-

Небесная энциклопедия

Космические корабли и станции, автоматические КА и методы их проектирования, бортовые комплексы управления, системы и средства жизнеобеспечения, особенности технологии производства ракетно-космических систем

Подробнее
-

Мониторинг СМИ

Мониторинг СМИ и социальных сетей. Сканирование интернета, новостных сайтов, специализированных контентных площадок на базе мессенджеров. Гибкие настройки фильтров и первоначальных источников.

Подробнее

Форма поиска

Поддерживает ввод нескольких поисковых фраз (по одной на строку). При поиске обеспечивает поддержку морфологии русского и английского языка
Ведите корректный номера.
Ведите корректный номера.
Ведите корректный номера.
Ведите корректный номера.
Укажите год
Укажите год

Применить Всего найдено 22. Отображено 22.
08-06-2011 дата публикации

Encoding/decoding device based on multi-hop concatenated convolutional code and realization method thereof

Номер: CN0102088338A
Принадлежит:

The invention provides an encoding/decoding device based on a multi-hop concatenated convolutional code in the technical field of wireless communication and a realization method thereof; the device comprises a transmitting end, a receiving end and n concatenated relay nodes; wherein the receiving end comprises a hard judging device, (n+1) grades of sub-decoders and n grades of deinterleavers; andthe sub-decoders are Viterbi decoders or addition SISO (single input single output) decoding modules. By the method provided by the invention, distributed concatenated codes are formed by concatenation characteristics of multi-hop paths in an auxiliary cellular communication system in which the relay nodes are led in, so that an error level better than the error level of a single-hop mode is obtained.

Подробнее
25-04-2023 дата публикации

Capsid protein mutant MutF for improving AAV retina targeting property and application of capsid protein mutant MutF

Номер: CN116003533A
Принадлежит:

The invention discloses a capsid protein mutant MutF capable of improving AAV retina targeting and application of the capsid protein mutant MutF. According to the research of the inventor, the capsid protein mutant MutF obtained by replacing 561-588 amino acids of wild type AAV2 virus capsid protein with DENEIRTTNPVATEQYGDVSTNLQRGNR is surprisingly capable of effectively improving the retina infection ability of the AAV2 virus and fundamentally solving the problem of retina targeting of the AAV2 virus.

Подробнее
30-06-2023 дата публикации

Collector composite structure for traveling wave tube and preparation method of collector composite structure

Номер: CN116364503A
Принадлежит:

The invention provides a collector composite structure for a traveling wave tube and a preparation method thereof, and relates to the technical field of vacuum electronic devices. The method comprises the following steps: preparing an insulating cylinder made of a high-thermal-conductivity boron nitride material by adopting a chemical vapor deposition method, and carrying out secondary processing on redundant parts; a collector electrode made of a pyrolytic graphite material is prepared on the inner wall of the insulating cylinder by adopting a chemical vapor deposition method, so that the collector electrode is connected with the insulating cylinder, and redundant parts are secondarily processed; an electrode tail cover made of a pyrolytic graphite material is prepared by adopting a chemical vapor deposition method, and redundant parts are secondarily processed. According to the collector prepared by the method, vapor-deposited high-purity and high-density pyrolytic boron nitride and pyrolytic ...

Подробнее
04-04-2023 дата публикации

Tool suitable for welding traveling wave tube waveguide bottom window needle assembly and welding method

Номер: CN115889932A
Принадлежит:

A tool is suitable for fixing a traveling wave tube waveguide bottom window needle assembly to be welded, the tool comprises a base and a station used for containing a waveguide bottom and a window needle, the station comprises a containing groove arranged in the middle of the side surface of the base and configured to extend in the horizontal direction, and the containing groove is used for containing the waveguide bottom and the window needle. The lower wall surface of the accommodating groove is suitable for abutting against the lower part of the first-stage step so as to limit the vertical position of the waveguide bottom; the first limiting groove is formed in the side surface of the base below the accommodating groove, extends in the vertical direction and is suitable for being embedded with the protruding part so as to limit the horizontal position of the waveguide bottom; the second limiting groove is formed in the side surface, above the containing groove, of the base, is constructed ...

Подробнее
05-05-2010 дата публикации

Method for inquiring information based on key information of the second generation identity card

Номер: CN0101702168A
Принадлежит:

The invention discloses a method for inquiring information based on key information of the second generation identity card, comprising six steps of constructing information database related to the identity, establishing a key information database, correspondingly associating citizen identity detailed data, inquiring identity information on line, feeding back detailed identity information and tracking inquired details. By collecting the key information of the identity card and completing on-line inquiry processing of the identity information in real time, the application range of the second generation identity card is greatly improved, and the mobility and the convenience are increased such that the method has extremely wide application prospect.

Подробнее
06-06-2023 дата публикации

Polypeptide for improving brain targeting of AAV virus and application thereof

Номер: CN116217661A
Принадлежит:

The invention discloses a polypeptide for improving brain targeting of AAV (adeno-associated virus) and application of the polypeptide. The inventor finds that the capsid protein mutant MutE obtained by replacing 586-588 amino acids of wild type AAV9 virus capsid protein with SDGTVANPFR can effectively improve the AAV virus brain tissue infection ability, reduce the infection ability to the liver and fundamentally solve the problem of AAV vector brain targeting.

Подробнее
17-12-2008 дата публикации

Website system and method for implementing share of relationship among persons

Номер: CN0101324879A
Автор: CUI GAO, GAO CUI
Принадлежит:

The invention relates to a website system for realizing the business relationship or interpersonal relationship sharing, and a method. In order to ensure that more people develop good personal networks and lay the solid foundation for the own career, the invention provides a website system for realizing the business relationship or interpersonal relationship sharing, and the method. The website system comprises a member registering module, a member logging module, a buddy inviting module, a buddy list module, a buddy recommending module, a topic module, an information module, a member searching module, a circle module, a personal statistics module, an environment setting module and a back-stage management module.

Подробнее
23-06-2023 дата публикации

Cold extrusion method of slow-wave assembly for traveling wave tube

Номер: CN116313691A
Принадлежит:

The invention provides a cold extrusion method for a slow-wave assembly for a traveling wave tube, and relates to the technical field of vacuum electronic devices. The method comprises the following steps: firstly, on the basis of a preset resilience value, a wound spiral line and a core rod are tightly adhered by adopting an adhesive, a clamping rod and the spiral line with the core rod are sequentially put into a plurality of groups of clamping assemblies, guide molds and limiting molds are assembled at two ends, and the plurality of groups of clamping assemblies, the clamping rod and the spiral line with the core rod are locked by using screws; and then, the positioned clamping rods and the spiral line are pushed into the composite tube shell, the multiple clamping assemblies are sequentially disassembled, and after the clamping assemblies are assembled in place, the guide mold and the limiting mold are disassembled. And immersing the assembled assembly into an organic solvent such as ...

Подробнее
18-04-2023 дата публикации

Assembling die for centering high-frequency assembly of traveling wave tube and assembling method of assembling die

Номер: CN115971753A
Принадлежит:

The invention relates to an assembly mold for centering a traveling wave tube high-frequency assembly and an assembly method thereof, and the assembly mold for centering the traveling wave tube high-frequency assembly comprises a core tube device, an input end cover located at the first end of the core tube device, and a plurality of pole shoes and a plurality of connecting rings which sleeve the core tube device and are alternately arranged, the assembling die comprises a base, a positioning groove, a first baffle, a second baffle and an adjusting device, wherein the positioning groove penetrates through the base in the longitudinal direction. According to the assembling die, the concentricity, straightness and perpendicularity of the assembly can be guaranteed at the same time, consistency is good, discreteness is small, and meanwhile the assembling die and the assembling method can guarantee the consistency of cold state assembling precision and hot welding assembling precision. The ...

Подробнее
16-04-2014 дата публикации

Fault detection device and method of exhaust gas recirculation engine

Номер: CN103726930A
Принадлежит:

The embodiment of the invention provides a fault detection device and method of an exhaust gas recirculation engine. The fault detection device is provided with a first circulation water valve for the recirculation engine, and particularly comprises a controller, the first circulation water valve, a temperature sensor and a processor, wherein the controller is used for closing a recirculation valve and closing the first circulation water valve according to instructions, the first circulation water valve is used for controlling first circulation water to start or stop circulation, the first circulation water is circulation water of a recirculation system, the temperature sensor is used for detecting the temperature of second circulation water after the recirculation valve is closed to obtain a first water temperature, and detecting the temperature of the second circulation water after the first circulation water valve is closed to obtain a second water temperature, the second circulation ...

Подробнее
14-05-2014 дата публикации

Ultrahigh-coercivity sintered neodymium-iron-boron magnet and preparation method thereof

Номер: CN103794322A
Принадлежит:

The invention discloses an ultrahigh-coercivity sintered neodymium-iron-boron magnet and a preparation method thereof. The ultrahigh-coercivity sintered neodymium-iron-boron magnet comprises a main phase and a crystal boundary adding phase. The main phase comprises low-HA main alloy and high-HA main alloy. The high magnetocrystalline anisotropy field HA main alloy and the low-HA main alloy are used as the main phase, so that the heavy rare earth element diffuses from the high-HA phase to the low-HA phase in the sintering and heat treatment process to initially improve the coercivity; in addition, alloy components and the preparation technology can be controlled at the same time, the content of Nd2Fe14B in the magnet is improved, and it is ensured that the magnet has the high magnetic energy product. The crystal boundary adding phase can further achieve crystalline grain surface magnetic hardening and improve the coercivity, the microscopic structure is optimized, and the coercivity is further ...

Подробнее
05-05-2023 дата публикации

Capsid protein MutD capable of improving AAV packaging capacity and application of capsid protein MutD

Номер: CN116063404A
Принадлежит:

The invention discloses a capsid protein MutD capable of improving AAV packaging capability and application of the capsid protein MutD. The research of the inventor finds that the adeno-associated virus variant prepared by substituting a wild type AAV2 capsid protein sequence with five amino acids N563, A566, E578, G587 and H588 can significantly improve the AAV2 virus packaging ability, and fundamentally solves the problems of production flux and production cost of AAV2.

Подробнее
23-04-2014 дата публикации

Protection method and protection device for engine and engine supercharger

Номер: CN103742256A
Принадлежит:

The invention provides a protection method and a protection device for an engine and an engine supercharger. The protection method for the engine supercharger comprises the following steps that: a first set supercharge pressure data acquired from a pressure-temperature sensor on an air inlet tube of the engine is preset to a pressure warning value, a second set supercharge pressure data acquired from the pressure-temperature sensor is preset to a torsional limit value; the supercharge pressure data of the pressure-temperature sensor is acquired in real time when the engine is in a stable working condition; a safety alarm instruction is sent when the supercharge pressure data achieves the pressure warning value; a torsional limit instruction is generated when the supercharge pressure data achieves the torsional limit value. According to the embodiments of the invention, the pressure value of the air inlet tube of the engine can be monitored in real time, thus guaranteeing that an alarm can ...

Подробнее
04-04-2023 дата публикации

Petroleum coke mixing device

Номер: CN115888522A
Принадлежит:

The invention relates to the technical field of petroleum coke blending, in particular to a petroleum coke blending device. A petroleum coke mixing device comprises a first shell, a second shell fixedly connected to the top of the first shell, a third shell fixedly connected to the top of the second shell, a material collecting opening formed in the outer side face of the third shell, an air blowing opening formed in the position, corresponding to the material collecting opening, of the outer side face of the third shell, and an auxiliary material dispersing assembly arranged in the third shell. A mixing buffer assembly is arranged in the second shell, and a mixing discharging assembly is arranged in the first shell. According to the petroleum coke mixing device, separation of large-particle-size petroleum coke and small-particle-size petroleum coke is achieved through wind circulation of the air blowing opening and the material collecting opening in the first shell, and the small-particle-size ...

Подробнее
07-04-2023 дата публикации

Detection system and detection method for thermal deformation of cathode-focusing electrode of traveling wave tube

Номер: CN115931957A
Принадлежит:

The invention discloses a detection system and a detection method for thermal deformation of a cathode-focusing electrode of a traveling wave tube. The detection system comprises a heating device, an infrared temperature detection device and a geometric quantity measurement device. According to the heating device, an accommodating space is formed in a vacuum chamber, the accommodating space is suitable for placing a cathode-focusing electrode of a traveling wave tube to be measured, and a transparent observation window is arranged on the vacuum chamber; the vacuum gauge tube is arranged in the vacuum chamber to detect the vacuum degree in the accommodating space; the power supply is arranged outside the vacuum chamber and is electrically connected with the cathode-focusing electrode of the traveling wave tube to be tested; the vacuum pump is communicated with the vacuum chamber, and the vacuum pump is suitable for vacuumizing the vacuum chamber to prevent the cathode-focusing electrode ...

Подробнее
10-06-2015 дата публикации

Traditional Chinese preparation for treating Wegener granulomatosis and preparation method thereof

Номер: CN104689252A
Принадлежит:

The invention discloses a traditional Chinese preparation for treating Wegener granulomatosis. The traditional Chinese preparation is composed of radix astragali, radix codonopsis, fried atractylodes macrocephala koidz, poria cocos, parched white peony root, angelica sinensis, sedum rosea, rhizoma chuanxiong, salviae miltiorrhizae, fried peach seeds, flos carthami, dipsacus asperoids, eucommia ulmoides, fructus psoraleae, cassia twig, hirudo, trogopterus dung, olibanum, myrrh, corydalis yanhusuo, curcuma, rhizoma phragmitis, polygonatum kingianum, rhizoma imperatae, puerarin and crude radix glycyrrhizae according to a weight ratio. The traditional Chinese preparation has the effects of tonifying Qi, lifting yang, clearing damp, promoting diuresis, tonifying the liver and kidney, strengthening spleen, calming the heart and the like, and can effectively treat the Wegener granulomatosis.

Подробнее
19-11-2014 дата публикации

Control system and control method for controlling opening of engine EGR valve

Номер: CN104153896A
Принадлежит:

The invention discloses a control system and control method for controlling opening of an engine EGR valve. The control method comprises the following steps of pre-setting a characteristic curve EGR_MAP of EGR in an ECU, acquiring the total suction intensity M of an engine cylinder and exhaust oxygen concentration X of the position of an engine exhaust pipe under the current working conditions through the ECU, and acquiring actual EGR waste parameters at the time according to the exhaust oxygen concentration X and the total suction intensity M; searching for the characteristic curve EGR_MAP of EGR by means of the engine speed and fuel-injection quantity acquired by the ECU under the working conditions, and therefore, acquiring calibrated EGR waste parameters under the current working state; outputting a control signal for regulating the opening of the EGR valve according to the condition that the difference range of the actual EGR waste parameters and the calibrated ...

Подробнее
05-05-2023 дата публикации

Capsid protein mutant MutC capable of improving packaging capacity of AAV virus and application of capsid protein mutant MutC

Номер: CN116063405A
Принадлежит:

The invention discloses a capsid protein mutant MutC capable of improving AAV virus packaging capability and application of the capsid protein mutant MutC. According to the present invention, the research results show that the capsid protein mutant MutC obtained by replacing the 561-588 site amino acids of the wild type AAV2 virus capsid protein with the QAEIATTNPVATEQWGCTNNQANMNGVDTATANIDEEWP can effectively improve the AAV virus packaging ability, and can fundamentally solve the problems of AAV2 production flux and production cost; ...

Подробнее
11-08-2023 дата публикации

Intelligent factory data optimization acquisition method based on digital twinning

Номер: CN116578890A
Принадлежит:

The invention relates to the technical field of electric digital data processing, in particular to a digital twinning-based intelligent factory data optimization acquisition method, which comprises the following steps of: acquiring a historical monitoring data set, current monitoring data and a historical clustering cluster set corresponding to target factory equipment for digital twinning; performing discrete analysis processing on each historical cluster in the historical cluster set; determining a subordinate similarity index between the current monitoring data and each historical cluster; determining a reference value corresponding to each parameter forming the monitoring data; determining a target membership degree between the current monitoring data and the historical clustering cluster; and classifying the current monitoring data and the historical clustering cluster set to obtain a target clustering cluster set so as to realize optimization of data acquisition. According to the ...

Подробнее
16-07-2008 дата публикации

Safety indicating apparatus and method for agreeing with overtaking for motor vehicle

Номер: CN0101219649A
Автор: CUI GAO, GAO CUI
Принадлежит:

The invention relates to a safe indicator device for agreeing overtaking used in motor vehicles and the method; a switch button of an indicator light is equipped on a steering wheel or another place which does not affect driving in the vehicle, and the switch button is connected with the indicator light for safe overtaking at the back of the vehicle. The indicator light for safe overtaking at the back of the vehicle is equipped near an existing car light or another place which does not affect beauty. The color of the indicator light for safe overtaking can adopt the existing yellow or red or other colors. When seeing an overtaking signal sent by a behind vehicle inclined to overtake, the driver can touch the switch button of the indicator light, and the indicator light for safe overtaking at the back of the vehicle flashes to indicate that the behind vehicle can overtake safely. The device and method can allow the vehicle to carry out overtaking safely under the precondition of determining ...

Подробнее
05-06-2020 дата публикации

Simple pile head steel bar straightening device

Номер: CN0210676745U

The utility model relates to the technical field of building construction. The utility model discloses a simple pile head reinforcing steel bar straightening device. Bottom support, wheels are fixedlyconnected to the periphery of the bottom of the bottom support. Sleeves are fixedly connected to the left end and the right end of the top of the bottom bracket; a bearing is fixedly connected to thebottom of an inner cavity of the sleeve; the top of the bearing is fixedly connected with a screw rod of which one end penetrates through and extends out of the sleeve; a driving wheel is fixedly connected to the top of the screw on the right side, a servo motor is fixedly connected to the top of the driving wheel, a driven wheel is fixedly connected to the top of the screw on the left side, a transmission belt located on the outer surface of the driving wheel is movably connected to the outer surface of the driven wheel, and hanging rings are fixedly connected to the tops of the sides, opposite ...

Подробнее