Graphene oxide loaded cuprous oxide antibacterial fiber as well as preparation method and application thereof

The invention relates to the technical field of fiber materials, and discloses a graphene oxide loaded cuprous oxide antibacterial fiber as well as a preparation method and application thereof. The antibacterial fiber comprises a polymer fiber and graphene oxide loaded cuprous oxide dispersed in the polymer fiber, and a polymer for preparing the polymer fiber is one or more of polyamide, polyester, polylactic acid, polypropylene or polyethylene. The content of the graphene oxide loaded cuprous oxide in the graphene oxide loaded cuprous oxide antibacterial fiber is 0.1-10 wt%. Copper ions in the graphene oxide loaded cuprous oxide are uniformly integrated on the surface of graphene under the coordination effect, and the graphene oxide loaded cuprous oxide is firm in attachment, not easy to fall off and good in long-acting antibacterial effect; in the graphene oxide loaded cuprous oxide antibacterial fiber, the addition amount of the graphene oxide loaded cuprous oxide is low, the dispersity ...

Log-periodic antenna miniaturization method based on gradient factor

The invention provides a log-periodic antenna miniaturization method based on a gradient factor. The log-periodic antenna miniaturization method comprises the following steps: confirming structure parameters tau and sigma of a log-periodic antenna; estimating the values of gradient factors delta tau and delta sigma of the structure parameters tau and sigma based on the requirements that the standing wave inside a log-periodic antenna band is smooth and minimum; adjusting the values of the gradient factors delta tau and delta sigma based on the requirement that the gain at any frequency in the log-periodic antenna band is the higher the better; and calculating the longitudinal length L of the log-periodic antenna according to the formula as shown in the specification. Therefore, due to introduction of the gradient factors delta tau and delta sigma, the longitudinal size of the log-periodic antenna is effectively reduced, the balance between in-band characteristic balance of the antenna and ...

Nedepine quick releasing and slow releasing agent

The present invention relates to a kind of method for preparing quickacting, slow-releasing, release-controlling, etc. Nifedipine-containing pellets, basing on selecting covering shape as matrix type, the medicament and aqueous polymer suspension are mixed, meanwhile the adhesive is added, by tuilizing fluid bed the mixed suspension is covered on the surface of candy core to make pellets, thus the result of slow-release is obtained.

Cervical cancer inhibiting fusion protein

产生高含量次微米雾滴的超音波雾化器

An ultrasonic atomizer for generating high-content sub-micron drops features that the HF (3 or 5 MHz) is used as oscillating frequency and several piezoelectric plates are used to increase the number of sub-micron drops. It is composed of an AC/DC converter, a HF oscillator, a power amplifier, a liquid storage container, and at least one piezoelectric plate arranged on the bottom of said liquid storage container.

Fusion protein of PRRS virus used as swine procreation and respiratory tract syndrome vaccine

The invention provides a fusion protein of a Porcine Reproductive and Respiratory Syndrome Virus (PRRSV), which comprises the three parts: a) pseudomonas exotoxin A of removal structure domain III; b) the fusion protein composed of ORF6 partial sequence and ORF5 partial sequence of the PRRSV American strain with an amino acid sequence of GSSLDDFCYDSTAPQKVLLAFSITYASNDSSSHLQLIYNLTLCELNGTDWLANKFDWA, wherein capitalized words represent single letter amino acid codes; c) a sequence of KDEL-KDEL-KDEL, wherein the capitalized words in the word of KDEL represent the single letter amino acid codes; and the fusion protein composed of the ORF6 partial sequence and the ORF5 partial sequence is arranged between the pseudomonas exotoxin A of the removal structure domain III and the sequence of KDEL-KDEL-KDEL.

Nivadipine controlled-release agent

Method for controlling medicine dosage

A method for controlling medicine application includes such steps as providing a medicine containing at least one active component in the form of solid, semi-solid, or organic solution, mixng it withwater or aqueous solution to form a medicinal mixture solution, and providing ultrasonic vibration to the solution to atomize it, resulting in the small drops containing said active component. With said method, the active component can be transferred between different carriers (solid, liquid, etc.).

FUSION PROTEINS FOR USE AS IMMUNOGENIC ENHANCERS FOR INDUCING ANTIGEN-SPECIFIC T CELL RESPONSES

A vaccine composition comprising a fusion protein for inducing enhanced pathogen antigen-specific T cell responses is disclosed. The fusion protein comprises: (a) an antigen-presenting cell (APC)-binding domain or a CD91 receptor-binding domain, located at the N-terminus of the fusion protein; (b) a translocation peptide of 34-112 amino acid residues in length, comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 4, 2, 3, or 6, located at the C-terminus of the APC-binding domain or the CD91 receptor-binding domain; and (c) an antigen of a pathogen, located at the C-terminus of the translocation peptide; (d) a nuclear export signal, comprising the amino acid sequence of SEQ ID NO: 13; and (e) an endoplasmic reticulum retention sequence, located at the C-terminus of the fusion protein.

Fusion protein of PRRS virus used as swine procreation and respiratory tract syndrome vaccine

The invention provides a sub-unit PRRS vaccine PE-PQGAB-K3 which is composed of counteragent value fusion proteins. The invention is a PQGAB structure peptide which is formed by a pseudomonas exotoxin site I (binding site-translocation site (II)) frame-shifting with PRRSV ORF5 and an ORF6N terminal combining with a cell receptor, and a code of KDEL-RDEL-KDEL(KEDL3) is added at a carboxyl terminal of fusion proteins. Serum obtained after mouse or pigs are immunized by the invention PE-PQGAB-K3 can inhibit the PRRSV growing and propagating in MAC-19cells, wherein the counteragent value can reach to 16 to 32.

Two-phase fluid mesh capacitance tomography method

This invention discloses biphase current mesh capacitor tomography. The one pole of the insert mesh capacitor is a metal core in the insulation wire and the other pole is formed by the contact surface of conduct phase and mesh or wet surface in the biphase current and its surface insulation layer serves as dielectric between electrodes and identifies the capacitor value. The insert mesh capacitor sensor high-speed scan the biphase current in the pipe driven by electric or self rotation apparatus and gets the project information to different directions on the pipe section of biphase current and gets real time image of the biphase current. The insert capacitor sensor identifies local distribution information of the biphase current on whole pipe or container section and directly gets the real time image of the biphase current.