METHOD OF PRODUCING VIRUS-LIKE PARTICLES OF PICORNAVIRUS USING A SMALL-UBIQUITIN-RELATED MODIFIER FUSION PROTEIN EXPRESSION SYSTEM
This application is a division of U.S. application Ser. No. 12/683,568, filed on Jan. 7, 2010, which claims priority to U.S. Provisional Application No. 61/143,455, filed on Jan. 9, 2009. The contents of the prior applications are hereby incorporated by reference in their entirety. Virus-like particles (VLPs), formed by self-assembly of viral envelop or capsid proteins, resemble viruses, from which the envelop/capsid proteins derive, but lack viral nucleic acids. Like viruses, they are highly immunogenic; unlike viruses, they are not infectious. Given these two features, VLPs are excellent vaccine candidates. They also have the potential for use in drug delivery due to their capacity to encapsulate a drug during assembly. VLPs can be prepared by conventional recombinant technology. More specifically, one can express viral envelop/capsid proteins in a cell and then assemble the proteins to form particles. The present invention is based on three unexpected discoveries: (1) co-expression in Accordingly, one aspect of this invention relates to an Another aspect of this invention features a method of making a picornaviral capsid protein complex (e.g., a pivornavirus-like particle) using the In yet another aspect, this invention features a method for eliciting an immune response against a FMDV by administering to a subject in need thereof (e.g., a cloven-hoofed animal) an effective amount of a FMDV-like particle, which can include capsid proteins VP0, VP1, and VP3. Also within the scope of this invention is use of a FMDV-like particle mentioned above in manufacturing a medicament for eliciting immune responses in a subject (e.g., a human). The details of one or more embodiments of the invention are set forth in the description below. Other features or advantages of the present invention will be apparent from the following drawing and detailed description of several examples and also from the appended claims. Disclosed herein is a method of preparing a capsid protein complex of a picornavirus by co-expressing in To perform the method of this invention, multiple nucleotide sequences, either in one expression cassette or in multiple expression cassettes, can be constructed via conventional recombinant technology. An “expression cassette” is a nucleotide sequence designed for expressing one or more polypeptides of interest in host cells (e.g., Each of the nucleotide sequences mentioned above contains a fragment encoding a Smt3 protein, a fragment encoding a picornaviral capsid protein, and optionally, a fragment encoding a protein tag. These nucleotide sequences, taken together, are capable of expressing all of the capsid proteins, fused with the Smt3 protein and optionally the protein tag, that are necessary for forming a VLP of the picornavirus, from which the capsid proteins are derived. In one example, the nucleotide sequence encoding the Smt3 protein is upstream to the nucleotide sequence encoding the capsid protein and the two sequences are linked via a SfoI restriction site, i.e., The Smt3 protein can be the The “percent identity” of two amino acid sequences is determined using the algorithm of Karlin and Altschul The picornaviral capsid proteins described herein can be naturally occurring capsid proteins of a picornavirus or their functional variants, i.e., having a sequence identity greater than 85% (e.g., 90%, 95%, or 99%) to their naturally occurring counterparts and possessing the same function of forming the shell of a picornaviral particle. Examples of picornaviruses are listed in Table 1 below: Picornavirus also includes hand foot and mouth disease virus, e.g., types A16 A4, A5, A7, A9, and A10 of Coxsackie A virus. The multiple nucleotide sequences, included in one or more expression plasmids, are introduced into an These VLPs can be used as vaccines for inducing immune responses against the picornavirus that the VLPs resemble. To achieve this goal, a VLP of a picornavirus can be mixed with a pharmaceutically acceptable carrier (e.g., a phosphate buffered saline, a bicarbonate solution, or an adjuvant) to form a pharmaceutical composition and an effective amount of the pharmaceutical composition can be administered to a subject who suffers from or is at risk for infection with that picornavirus. In one example, the pharmaceutical composition contains a VLP that resembles a foot-and-mouth disease virus and is used to reduce the risk of developing foot-and-mouth disease in a cloven-hoofed animal (e.g., cattle, water buffalo, sheep, goats and pigs). In another example, the pharmaceutical composition contains a VLP that resembles a picornavirus capable of causing infections in humans (e.g., the human viruses listed in Table 1 above) and is used to reduce the risk of such human infections. A pharmaceutically acceptable carrier is a carrier that is compatible with the active ingredient of the composition, and preferably, capable of stabilizing the active ingredient and not deleterious to the subject to be treated. “An effective amount” as used herein refers to the amount of each active agent required to confer therapeutic effect on the subject, either alone or in combination with one or more other active agents. Effective amounts vary, as recognized by those skilled in the art, depending on route of administration, excipient usage, and co-usage with other active agents. To make the pharmaceutical composition mentioned above, the carrier can be selected on the basis of the mode and route of administration, and standard pharmaceutical practice. Suitable pharmaceutical carriers, as well as pharmaceutical necessities for their use, are described in Remington's Pharmaceutical Sciences. The carrier can also be an adjuvant, e.g., a cholera toxin, Methods for preparing vaccines are generally well known in the art, as exemplified by U.S. Pat. Nos. 4,601,903; 4,599,231; 4,599,230; and 4,596,792. Vaccines may be prepared as injectables, as liquid solutions or emulsions. The VLPs described herein may be mixed with physiologically acceptable and excipients compatible. Excipients may include, water, saline, dextrose, glycerol, ethanol, and combinations thereof. The vaccine may further contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents, or an adjuvant to enhance the effectiveness of the vaccines. Methods of achieving adjuvant effect for the vaccine includes use of agents, such as aluminum hydroxide or phosphate (alum), commonly used as 0.05 to 0.1 percent solutions in phosphate buffered saline. Vaccines may be administered parenterally, by injection subcutaneously or intramuscularly. Alternatively, other modes of administration including suppositories and oral formulations may be desirable. For suppositories, binders and carriers may include, for example, polyalkalene glycols or triglycerides. Oral formulations may include normally employed incipients such as, for example, pharmaceutical grades of saccharine, cellulose, magnesium carbonate and the like. These compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations or powders and contain 10-95% of the immunopeptide described herein. The VLP-containing pharmaceutical composition described above is administered in a manner compatible with the dosage formulation, and in an amount that is therapeutically effective, protective and immunogenic. The quantity to be administered depends on the subject to be treated, including, for example, the capacity of the individual's immune system to synthesize antibodies, and if needed, to produce a cell-mediated immune response. Precise amounts of active ingredient required to be administered depend on the judgment of the practitioner. However, suitable dosage ranges are readily determinable by one skilled in the art and may be of the order of micrograms of the polypeptide of this invention. Suitable regimes for initial administration and booster doses are also variable, but may include an initial administration followed by subsequent administrations. The dosage of the vaccine may also depend on the route of administration and varies according to the size of the host. The VLPs can also be used as vehicles for delivering therapeutic or diagnostic agents (e.g., an anti-cancer drug or an imaging molecule), which can be coated on the surface of a nano-particle (e.g., a magnetic bead and a quantum dot). More specifically, during their self-assembly, capsid proteins can pack therapeutic agents into the VLPs they formed. Thus, when performing the U1P1 protease treatment in the presence of a therapeutic agent, the free capsid proteins released from the protease digestion encapsulate the therapeutic agent while self-assembling into VLPs. The resultant VLPs facilitate in vivo delivery of the therapeutic agent when administered to a subject in need via a conventional route. Without further elaboration, it is believed that one skilled in the art can, based on the above description, utilize the present invention to its fullest extent. The following specific examples are, therefore, to be construed as merely illustrative, and not limitative of the remainder of the disclosure in any way whatsoever. All publications cited herein are incorporated by reference. cDNAs encoding FMDV VP0, VP1, and VP3 were amplified by the sticky-end polymerase chain reaction cloning method described in Shih et al. Protein Sci. 11:1714-1719 (2002). The amino acid sequences of the three FMDV capsid proteins are shown below: cDNAs encoding VP0 and VP 1 were cloned into expression vector pHD-Kanrvia cloning sites SfoI and XhoI to produce expression plasmids pHD-Kanr-VP0 and pHD-Kanr-VP1; the cDNA encoding VP3 was cloned into expression vectors pHD-Amprvia the same cloning site to produce expression plasmid pHD-Ampr-VP3. Expression vectors pHD-Amprand pHD-Kanreach include a T7 lac promoter (PT7lac), a T7 terminator (TetT7), a nucleotide sequence encoding a hexa-His tag, and a nucleotide sequence encoding Smt3. See Lee et al., Protein Sci. 17:1241-1248 (2008). A DNA fragment containing PT7lac, His6-Smt3-VP0, and TetT7was PCR amplified from the pHD-Kanr-VP0 plasmid and then subcloned into pHD-Ampr-VP3 construct to produce expression plasmid pHD-Ampr-VP0-VP3, which expresses both His6-Smt3-VP0 and His6-Smt3-VP3 fusion proteins. See Expression plasmids pHD-Ampr-VP0-VP3 and pHD-Kanr-VP1were introduced into the BL21(DE3)-RIL The eluted fraction was subjected to SDS-PAGE analysis to determine protein purity. Upon Coomassie Blue staining, three protein bands were observed on the gel. These proteins have molecular weights close to the theoretical molecular weights of fusion proteins His6-Smt3-VP0, His6-Smt3-VP1, and His6-Smt3-VP3, i.e., 45,175 Da, 37,057 Da and 37,245 Da, respectively. High-pressure liquid chromatography (HPLC) was employed to determine the molecule weight of the fusion proteins (non-denatured) contained in the eluted fraction. First, a calibration curve of Molecular weight vs. Elution volume was generated using a molecular mass standard including thyroglobulin, ferritin, catalase, bovine serum albumin, ovalbumin and lysozyme; supplied by GE healthcares. The standard was loaded onto a HiLoad 16/60 Superdex column (GE Healthcare) and eluted with an elution buffer containing 50 mM Tris-HCl (pH 7.4), 300 mM NaCl, and 0.2 mM EGTA (pH 8.0) at a flow rate of 1.0 ml/min. The eluted fractions were measured continuously for their optical densities at 280 nm. The average elution volume (Kay) of each protein component in the standard was calculated as follows: Kav=(Ve−V0)/(Vt−V0), where Ve and Vt represent elution volume of the protein component and DTT, respectively, and V0(void volume) was determined using blue dextran 2000 (GE, Healthcare). A calibration curve was produced based on the average elution volume of each protein component in the standard versus its molecular weight. See Next, the eluted fraction containing the fusion proteins His6-Smt3-VP0, His6-Smt3-VP1, and His6-Smt3-VP3 was loaded onto the same HiLoad 16/60 Superdex column and eluted using the same elution buffer at the same flow rate noted above. Its average elution volume was calculated following the formula also described above. Based on the average elution volume, the molecular weight(s) of the protein component(s) contained in the eluted fraction was determined in view of the calibration curve. The result thus obtained indicates that the eluted fraction contained a single protein component having the molecular weight of ˜112 kDa. See The His6-Smt3-VP0/His6-Smt3-VP1/His6-Smt3-VP3 ternary protein complex described in Example 1 above was treated with U1P1 protease to remove the His6-Smt3 moiety, following the procedures described in Lee et al., Protein Sci. 17:1241-1248 (2008). SDS-PAGE analysis showed that the protease-digested product contains three proteins having molecular weights ˜32 kDa, 29 kDa and 26 kDa, which correspond to the theoretical molecular weights of VP0, VP3, and VP1, respectively. An Edman degradation assay was then performed to determine the N-termini amino acid residues of these three proteins. Results thus obtained showed that they were identical to the N-termini amino acid residues of VP0, VP1, and VP3. It confirms that the proteins contained in the protease-digested products were indeed FMDV capsid proteins V0, VP1, and VP3. The protease-treated product was then subjected to the HPLC assay described above. The results showed that VP0, VP1, and VP3 contained in this product formed a complex at a ratio of 1:1:1. This complex was analyzed by electron microscopy as follows. A droplet (4 μl) of a sample containing the protease-digested product was placed on a copper grid (300 mesh, Pelco, USA) coated with fresh carbon for 1 min at room temperature. Any excess fluid was carefully removed from the edge of the grid using a Whatman #1 filter paper (Whatman Inc., USA). The sample was then stained with 2.5% uranyl acetate for 4 min and excess fluid was removed afterwards. The stained sample was air dried at room temperature and then subjected to analysis using Bio-transmission electron microscopy (EM), using a Tecnai G2 Spirit Bio TWIN (FEI Co., Netherlands) at an acceleration voltage of 120 kV. Images were recorded using a slowscan CCD camera (Gatan MultiScan 600) at a resolution of at least 1024×1024 pixels. Results thus obtained showed that the protease-digested product contains round-shaped particles having an average diameter of around 25 nm. This diameter is very close to the average diameter of FMDV viral particles, i.e., 27 nm (see Grubman et al., Clin Microbiol Rev. 17:465-493 (2004). These results indicate that U1P1 protease treatment converted the His6-Smt3-VP0/His6-Smt3-VP1/His6-Smt3-VP3 ternary protein complex to virus-like particles containing FMDV capsid proteins VP0, VP1, and VP3. The VLPs of FMDV prepared by the method described in Example 2 above was examined as follows to determine their activity in inducing immune responses. First, HEK293 cells, transfected with p5xNFκB-Luc, EGFP-N1 (as a control plasmid), pcDNA3.1-TLR2, or pcDNA3.1 (as a blank control), were treated with (a) 1 μm Pam3csk4 (a TLR2 ligand; a positive control), (b) Tris buffer (20 mM Tris-Cl, pH 8.0, and 100 mM NaCl; a blank control), (c) 90 μg/ml BEI-inactivated FMDV (a positive control), and (d) VLPs at various doses (i.e., 0.6, 1, and 3 μg/ml). Twenty-four hours after treatment, the luciferase activities, indicating NFκB activation, were determined in the cells and normalized against the EGFP levels in the same cells. The results thus obtained indicate that, similar to the treatment of Pam3csk4 or inactivated FMDV, treatment of the VLPs induced NFκB activation. Next, activation of bone marrow derived dendritic cells (BMDCs) by the FMD VLPs were examined as follows. BMDCs were isolated from wild-type or TLR2−/−C57BL/6 mice via routine technology. BMDCs were then stimulated with 1 μg/ml Pam3csk4, 0.1 μm VLPs, or 0.5 μm VLPs for 36 hours at 37° C. Afterwards, the supernatants of the cell cultures were collected and their IL-6 levels were examined by ELISA. The data shows that, like Pam3csk4, VLPs at both doses induced IL-6 secretion in BMDCs from the wild-type mice, but not in BMDCs from the TLR2−/−mice. The levels of cytokines IL-6, IL-12, and TNF-alpha were examined in BMDCs in the presence or absence of the VLPs (1 μm) 48 hours after treatment. The VLPs were found to stimulate BMDCs to secrete all of these cytokines. This result indicates that VLPs activated BMDCs. Finally, the VLPs were administered to guinea pigs to examine their ability in eliciting antibody responses. Guinea pigs were immunized via intramuscular injection with 100 μg, 200 μg, 300 μg VLPs, or PBS (blank control). Serum samples were collected from the immunized guinea pigs at different time points (0, 1, 2, 3, 4, 5, and 6 weeks after immunization) and the titers of VP1-specific antibodies were examined by ELISA. The results indicate that the titers of anti-VP1 antibodies in guinea pigs immunized with the VLPs were much higher than those in the control animals. The serum samples mentioned above were inactivated at 56° C. for 30 minutes and then co-incubated with 100 TCID50 viral particles. The serum-virus mixtures were incubated with BHK-21 cells. Forty-eight hours after the incubation, the viral titer in each mixture was examined. Table 2 below lists the dilution fold of each serum sample, at which the 100 TCID50 virus was neutralized by 50%. This dilution fold is reversely proportional to the viral titer in that serum sample. The results shown in Table 2 above demonstrate that the VLPs induced neutralizing antibodies that suppressed proliferation of the 100 TCID50 virus. All of the features disclosed in this specification may be combined in any combination. Each feature disclosed in this specification may be replaced by an alternative feature serving the same, equivalent, or similar purpose. Thus, unless expressly stated otherwise, each feature disclosed is only an example of a generic series of equivalent or similar features. From the above description, one skilled in the art can easily ascertain the essential characteristics of the present invention, and without departing from the spirit and scope thereof, can make various changes and modifications of the invention to adapt it to various usages and conditions. Thus, other embodiments are also within the claims. A method for producing picornaviral capsid protein complexes (e.g., picornavirus like particles) in E. coli using a small-ubiquitin-related fusion protein expression system and an E. coli strain used in practicing this method. Also disclosed is use of the picornaviral capsid protein complexes like thus prepared for eliciting immune responses. 1. A method of eliciting an immune response against a foot-and-mouth disease virus in a subject, comprising administering to a subject in need thereof an effective amount of a virus-like particle of a foot-and-mouth disease virus. 2. The method of 3. The method of providing an culturing the collecting the cells of the isolating the capsid protein complexes and treating the complexes with an U1p1 protease, thereby producing a virus-like particle composed of the capsid proteins, 4. The method of 5. The method of 6. The method of 7. The method of 8. The method of 9. The method of RELATED APPLICATION
BACKGROUND OF THE INVENTION
SUMMARY OF THE INVENTION
BRIEF DESCRIPTION OF THE DRAWINGS
DETAILED DESCRIPTION OF THE INVENTION
5′ . . . GGC▾GCC . . . 3′ 3′ . . . CCG▴CGG . . . 5′,
coding for Gly-Gly.
Amino acid sequence of Smt3 (SEQ ID NO: 1) MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRR LMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHRE QIGG
It can also be a functional variant of this yeast Smt3, which is a polypeptide that shares a high sequence homology with Smt3 (i.e., having a sequence identity any percentage from 85% to 100%, such as at least 90%, 95%, 98%, or 99%) and possesses the function of yeast Smt3. When fused with a picornavirus capsid protein, the Smt3 protein can be cleaved by an U1p1 protease to generate a free Smt3 protein having -Gly-Gly (encoded by the SfoI restriction site) at its C-terminus. See Mossessova et al., Mol. Cell 5:865-876 (2000). “U1p1 protease” is a polypeptide having the protease activity of Representative Genus and Species of Picornavirus Genus Species Enterovirus Bovine enterovirus Human enterovirus A Human enterovirus B Human enterovirus C Human enterovirus D Poliovirus Porcine enterovirus A Porcine enterovirus B Simian enterovirus A Rhinovirus Human rhinovirus A Human rhinovirus B Hepatovirus (also classed Hepatitis A virus as Heparnavirus Avian encephalomyelitis-like viruses Cardiovirus Encephalomyocarditis virus Theilovirus Aphthovirus Foot-and-mouth disease virus Equine rhinitis A virus Parechovirus Human parechovirus Ljungan virus Erbovirus Equine rhinitis B virus Kobuvirus Aichi virus Bovine kobuvirus Teschovirus Porcine teschovirus EXAMPLE 1
Preparation of Protein Complex Containing His6-Smt3-VP0, His6-Smt3-VP1, and His6-Smt3-VP3 Fusion Proteins
Amino acid sequence of FMDV capsid protein VP0 (SEQ ID NO: 2) N T G S I I N N Y Y M Q Q Y Q N S M D T Q L G D N A I S G G S N E G S T D T T S T H T N N T Q N N D W F S K L A N T A F S G L F G A L L A D K K T E E T T L L E D R I L T T R N G H T T S T T Q S S V G V T Y G Y A T A E D F V S G P N T S G L E T R V V Q A E R F F K T H L F D W V T S D P F G R C H L L E L P T D H K G V Y G S L T D S Y A Y M R N G W D V E V T A V G N Q F N G G C L L V A M V P E L R S I S K R E L Y Q L T L F P H Q F I N P R T N M T A H I T V P Y L G V N R Y D Q Y K V H K P W T L V V M V A A P L T V N N E G A P Q I K V Y A N I A P T N V H V A G E L P S K E Amino acid sequence of FMDV capsid protein VP1 (SEQ ID NO: 3) T T S A G E S A D P V T A T V E N Y G G E T Q V Q R R Q H T D I A F I L D R F V K V K P K E Q V N V L D L M Q I P A H T L V G A L L R T A T Y Y F S D L E L A V K H E G D L T W V P N G A P E T A L D N T T N P T A Y H K E P L T R L A L P Y T A P H R V L A T V Y N G S S K Y G D T S T N N V R G D L Q V L A Q K A E R T L P T S F N F G A I K A T R V T E L L Y R M K R A E T Y C P R P L L A I Q P S D A R H K Q R I V A P A K Q L L Amino acid sequence of FMDV capsid protein VP3 (SEQ ID NO: 4) G I F P V A C S D G Y G G L V T T D P K T A D P V Y G K V F N P P R N L L P G R F T N L L D V A E A C P T F L H F D G D V P Y V T T K T D S D R V L A Q F D L S L A A K H M S N T F L A G L A Q Y Y T Q Y S G T I N L H F M F T G P T D A K A R Y M V A Y A P P G M E P P K T P E A A A H C I H A E W D T G L N S K F T F S I P Y L S A A D Y A Y T A S D V A E T T N V Q G W V C L F Q I T H G K A D G D A L V V L A S A G K D F D L R L P V D A R T Q EXAMPLE 2
Preparation of FMDV-Like Particles
EXAMPLE 3
Immune Responses Elicited by FMDV-Like Particles
Dilution Folds to Achieve 50% Neutralization Weeks 0 1 2 3 4 5 6 Control ≦3 ≦3 ≦3 ≦3 ≦3 ≦3 ≦3 VLP (200 μg) ≦3 ≦3 16 256 256 256 256 VLP (300 μg) ≦3 ≦3 32 16 16 256 256 Other Embodiments

