Настройки

Укажите год
-

Небесная энциклопедия

Космические корабли и станции, автоматические КА и методы их проектирования, бортовые комплексы управления, системы и средства жизнеобеспечения, особенности технологии производства ракетно-космических систем

Подробнее
-

Мониторинг СМИ

Мониторинг СМИ и социальных сетей. Сканирование интернета, новостных сайтов, специализированных контентных площадок на базе мессенджеров. Гибкие настройки фильтров и первоначальных источников.

Подробнее

Форма поиска

Поддерживает ввод нескольких поисковых фраз (по одной на строку). При поиске обеспечивает поддержку морфологии русского и английского языка
Ведите корректный номера.
Ведите корректный номера.
Ведите корректный номера.
Ведите корректный номера.
Укажите год
Укажите год

Применить Всего найдено 64. Отображено 64.
26-05-2023 дата публикации

High-voltage wire harness cutting equipment

Номер: CN116159948A
Принадлежит:

The invention discloses high-voltage wire harness cutting equipment, and belongs to the field of high-voltage wire harness cutting. The device comprises a workbench, and further comprises a wire feeding device, an anti-deviation assembly, a high-voltage wire harness cutting device and a conveying device. The problems that in the prior art, wire cutting equipment needs manual paying-off, automatic paying-off cannot be achieved, and high-voltage wiring harnesses are prone to deviation are solved, a first motor is matched with a driving gear and a driven gear to enable a paying-off roller to rotate to achieve automatic paying-off operation, the working efficiency is effectively improved, the high-voltage wiring harnesses are clamped and fixed through clamping plates, and the working efficiency is improved. According to the high-voltage wire harness paying-off device, the situation that the high-voltage wire harness deviates in the paying-off process is avoided due to the guide effect of the ...

Подробнее
18-04-2023 дата публикации

Device for automatically measuring thickness of pier column protective layer and spacing between steel bars

Номер: CN115979196A
Принадлежит:

The invention discloses a device for automatically measuring the thickness of a pier column protective layer and the distance between steel bars, and relates to the field of building construction detection equipment, and the technical scheme is that the device comprises two hoops which are arranged in parallel, and the two hoops are connected through a plurality of lifting mechanisms; a rail is fixedly arranged on the lower hoop, a sliding groove is formed in the inner wall of the rail, and a detection mechanism used for detecting the distance between a concrete protection layer and a steel bar is arranged on the sliding groove in a sliding mode; the hoop is formed by sequentially splicing two semi-arc-shaped fixing plates end to end, a plurality of supporting rods and lifting pulleys are fixedly arranged on the inner surface of the hoop, and the supporting rods and the lifting pulleys are alternately arranged. The method has the beneficial effects that the problems of instability and inaccuracy ...

Подробнее
23-05-2023 дата публикации

DC-DC regulation power supply control device based on IGBT isolation

Номер: CN116155114A
Принадлежит:

The invention discloses a DC-DC regulation power supply control device based on IGBT isolation, and relates to the technical field of energy control, and the device comprises an intelligent control module which is used for signal receiving and module control; the voltage regulation module is used for carrying out direct current isolation regulation; the output control module is used for adjusting the input electric energy and carrying out coordinated power supply; the variable adjusting module is used for providing a feedback signal; and the signal control module is used for selecting signal transmission and cooperating with the variable adjustment module to control the electrical variable judgment module to judge the electrical variable degree. According to the IGBT-based isolation DC-DC regulation power supply control device, the intelligent control module regulates a feedback value output by the variable regulation module, the signal control module performs signal transmission and cooperates ...

Подробнее
27-06-2019 дата публикации

AEROSOL GENERATING ARTICLE HAVING LOW TEMPERATURE COMBUSTION HEAT SOURCE

Номер: WO2019119730A1
Принадлежит:

Disclosed is an aerosol generating article having a low temperature combustion heat source, comprising a low temperature combustion smoking article and a matching cigarette; the low temperature combustion smoking article comprises a heat insulation sleeve, an annular heat conductive barrel, a cover, and a heat source cigarette lighter; the annular heat conductive barrel is provided in an annular mounting groove at the left section of the inner wall of the heat insulation sleeve; the cover is provided at the left end of the heat insulation sleeve; the cavity of the annular heat conductive barrel is filled with the low temperature combustion heat source in a sealed manner; a plurality of electric heating columns are provided at the right end of the heat source cigarette lighter; the cover is provided with a plurality of insertion holes matching the plurality of electric heating columns of the heat source cigarette lighter, and after the plurality of electric heating columns are inserted into ...

Подробнее
03-03-2016 дата публикации

METHOD FOR ESTABLISHING THREE-LINE ASSORTED BREEDING SYSTEM FOR ARGOPECTEN IRRADIANS CONCENTRICUS-ARGOPECTEN PURPURATUS HYBRID SCALLOPS AND APPLICATION THEREOF

Номер: WO2016029491A1
Принадлежит:

A method for establishing a three-line assorted breeding system for Argopecten irradians concentricus-Argopecten purpuratus hybrid scallops and application thereof. The three lines comprise a sterile male line, a maintenance line, and a restorative line of the Argopecten irradians concentricus-Argopecten purpuratus hybrid scallop, wherein Argopecten irradians concentricus-Argopecten purpuratus hybrid scallops are a hybrid progeny of Argopecten irradians concentricus ova and for Argopecten purpuratus sperm. First establishing a large quantity of Argopecten irradians concentricus and Argopecten purpuratus first generation hybrids, and finding therein sterile; then successively backcrossing using Argopecten purpuratus sperm, respectively selectively breeding a sterile male line-maintenance line combination in which all progeny are sterile males, and a sterile male line-restorative line combination in which all progeny are hermaphrodites; and finally hybridising the sterile male line and maintenance ...

Подробнее
11-06-2020 дата публикации

TOBACCO GRANULE TYPE TOBACCO PRODUCT INCOMBUSTIBLE IN HEATING AND MANUFACTURING METHOD THEREFOR

Номер: WO2020113796A1
Принадлежит:

A tobacco granule type tobacco product incombustible in heating and manufacturing method therefor. The tobacco granule type tobacco product incombustible in heating comprises a tobacco granule segment (1) and a filter tip segment; the tobacco granule segment (1) is that a front-end plugging structure (13) and a tail-end plugging structure (14) are respectively fixed to the front end and the tail end of a hollow paper tube (11), tobacco granules (12) are filled between the front-end plugging structure (13) and the tail-end plugging structure (14), and the tail-end plugging structure (14) is close to the filter tip segment. The tobacco product releases sufficient and stable smoke, the tobacco granules do not fall, a cigarette can be directly pulled out, and the manufacturing process is simple and easy.

Подробнее
12-05-2023 дата публикации

Cuttable aerosol circulation barrier element for granular heating cigarette

Номер: CN116098318A
Принадлежит:

The invention discloses a cuttable aerial fog circulation blocking element for a particle type heating cigarette, the raw materials of the cuttable aerial fog circulation blocking element comprise 5-40% of a softening agent, and the cuttable aerial fog circulation blocking element has the elasticity modulus of 5-60 MPa and the maximum compression stress of 30-120 N. When the blocking element is applied to particle type heating cigarettes, the blocking element has the advantages that supplied materials are orderly, online slitting can be achieved, and the actual requirement for high-speed production of the particle type heating cigarettes is well met.

Подробнее
29-08-2023 дата публикации

High-quality and high-efficiency harvesting equipment and harvesting method for pilose antler mushrooms

Номер: CN116649161A
Принадлежит:

The invention relates to a high-quality and high-efficiency harvesting device and method for pilose antler mushrooms, and the device comprises a roller type conveying and limiting platform which is used for conveying a pilose antler mushroom basket with pilose antler mushroom cultivation bottles to a root cutting position and limiting the pilose antler mushroom basket; the adjustable root cutting platform is used for cutting the roots of the pilose antler mushrooms in the pilose antler mushroom cultivation bottle at the root cutting position; the flexible bionic supporting and taking mechanism is mounted on the mechanical arm and used for supporting and taking the cut velvet antler mushrooms and then placing the velvet antler mushrooms on the velvet antler mushroom conveying platform; according to the bottle-cultivation velvet antler mushroom root cutting machine, integrated operation of intermittent accurate conveying and positioning of bottle-cultivation velvet antler mushroom baskets ...

Подробнее
28-04-2022 дата публикации

ELECTRONIC DEVICE AND WEARABLE DEVICE

Номер: WO2022083261A1
Автор: ZHOU, Shun
Принадлежит:

The present application relates to the technical field of smart devices. Disclosed are an electronic device and a wearable device. In the electronic device, a contact surface is provided on an outer surface of a housing; an accommodating space is formed inside the housing; a first connector is provided on the housing and is used for electrical connection to a power source to transmit electric energy for the electronic device; first and second electrodes are provided on the contact surface at intervals and are used as measuring electrodes of an ECG signal detection circuit; each of the first and second electrodes is electrically connected to the first connector; and a main board is electrically connected to the first connector and is used for obtaining ECG parameters according to ECG signals acquired by the first and second electrodes. In the present application, the first and second electrodes for the ECG signal detection circuit are provided on the housing, and the first and second electrodes ...

Подробнее
25-06-2020 дата публикации

INFRARED DETECTOR WITH HIGH-EFFICACY RESONANT CAVITY AND PREPARATION METHOD THEREFOR

Номер: WO2020125324A1
Принадлежит:

Disclosed are an infrared detector with a high-efficacy resonant cavity (11) and a preparation method therefor. For improving the integration level of a chip, the resonant cavity (11) of the detector is located inside a silicon wafer; and compared with a traditional infrared detector, a vacuum cavity where a sensitive layer thin film (3) is located is only a few microns high, the cavity space is greatly reduced, a high vacuum is easily formed and maintained, and the sensitive layer heat loss caused by air convection is prevented. The sensitive layer thin film (3) is located directly in the middle of the resonant cavity (11), and an upper reflecting layer (2) is a semi-transparent semi-reflective thin metal layer on a back face of an upper substrate (1); and a lower reflecting layer (4) is a totally reflective thick metal layer on an upper surface of a lower substrate (5), and when reflected once in the resonant cavity (11), light can pass through the sensitive layer thin film (3) twice, ...

Подробнее
28-04-2023 дата публикации

Synthesis method of niclosamide artificial antigen

Номер: CN116023469A
Принадлежит:

The invention discloses a synthesis method of a niclosamide artificial antigen, and relates to the technical field of chemical synthesis, the niclosamide artificial antigen is synthesized by using a niclosamide ethanolamine salt, the synthesized niclosamide artificial antigen is reported for the first time at home and abroad, and the blank in the technical field of a niclosamide immunological detection method is filled. And a foundation is laid for establishment of a niclosamide enzyme-linked immunosorbent assay rapid detection method. The synthesis method is simple, and the niclosamide artificial antigen is successfully synthesized for the first time by strictly controlling reaction conditions, reaction time and raw material ratio. Through determination, the coupling ratio of the niclosamide artificial antigen synthesized by the niclosamide ethanolamine salt is 1: 13.5.

Подробнее
11-08-2023 дата публикации

Rapid testing method for concrete aggregate accumulation void ratio

Номер: CN116577255A
Принадлежит:

According to the rapid testing method for the concrete aggregate accumulation void ratio, the shape of a container used in the measuring process is not limited, the testing method is convenient and rapid, and the data repeatability is good. Compared with the prior art, the method for rapidly testing the accumulation void ratio of the concrete aggregate can rapidly calculate the accumulation void ratio of the aggregate by adding water to submerge the aggregate in the container, respectively weighing the weights before and after adding water, combining the apparent density of the aggregate and the density data of water, and utilizing a calculation formula provided by the invention. The method for rapidly testing the accumulation void ratio of the concrete aggregate can eliminate the adverse effect of segregation in the accumulation process. The method solves the problem that the existing void ratio test method can cause segregation and large discreteness of test data.

Подробнее
25-08-2023 дата публикации

Communication test equipment reliability prediction method and device, equipment and storage medium

Номер: CN116644590A
Принадлежит:

The invention discloses a communication test equipment reliability prediction method and device, equipment and a storage medium, and relates to the technical field of communication. The communication test equipment reliability prediction method comprises the following steps: decomposing a system, and determining each design element; calculating the failure rate of each design element, selecting a reliability technical measure correlation coefficient, and calculating the total failure rate of the system; calculating system reliability MTBF according to the total failure rate of the system; if the reliability meets the index requirement, system reliability prediction is completed; and if the reliability does not meet the requirements, modifying system module parameters, parts or devices, software and reliability measures until the reliability meets the requirements. The method can be applied to reliability prediction and system design of the handheld communication comprehensive tester, and ...

Подробнее
18-08-2023 дата публикации

Harmonica-shaped tube type water-cooling plate and internal leakage helium detection device and helium detection method of harmonica-shaped tube type water-cooling plate

Номер: CN116609001A
Принадлежит:

The invention provides a harmonica-shaped tube type water cooling plate and an internal leakage helium detection device and helium detection method thereof, belongs to the technical field of heat management of new energy automobiles, and solves the problem that an existing helium detection device cannot rapidly and effectively detect internal leakage of the harmonica-shaped tube type water cooling plate. Comprising a clamping conveying mechanism, and a first assembling conveying mechanism, a second assembling conveying mechanism, an induction welding mechanism and an air separator are sequentially arranged on one side of the clamping conveying mechanism from front to back; a gas injection mechanism, a first assembly conveying mechanism, a second assembly conveying mechanism and an induction welding mechanism are sequentially arranged on the other side of the clamping conveying mechanism from front to back, a sorting conveyor is arranged on the rear side of the clamping conveying mechanism ...

Подробнее
29-08-2023 дата публикации

Large-scale full-connection channel simulation device, method and equipment and storage medium

Номер: CN116667946A
Принадлежит:

The invention discloses a large-scale full-connection channel simulation device and method, equipment and a storage medium. The large-scale full-communication channel simulation device comprises a basic channel simulation unit which comprises N radio frequency input ports, N radio frequency output ports, a sampling data output port, a calculation data output port, a calculation data input port A and a calculation data input port B, the analog-to-digital conversion module is used for completing digital-to-analog conversion between N transmitting antennas and N receiving antennas, up-down conversion and analog computation of N * N channels; and the expansion calculation unit comprises a sampling data input port, a sampling data output port, a calculation data input port and a calculation data output port, and is used for completing analog calculation of N * N channels. According to the invention, the problems of waste of radio frequency channel resources and difficulty in flexible expansion ...

Подробнее
09-04-2021 дата публикации

Key assembly, watchband of wearable device and electronic device

Номер: CN212934446U
Автор: ZHOU SHUN, 周顺

The utility model discloses a button assembly, a watchband of a wearable device and an electronic device, the button assembly comprises a housing, a trigger assembly and a button part, an accommodation space is defined in the housing, and the housing is provided with a through hole; the triggering assembly is arranged in the shell and is opposite to the through hole; the key part is embedded in the through hole in a sealed mode and comprises a pressing piece and an elastic piece, the elastic piece is annular, the pressing piece is embedded in the elastic piece in a sealed mode, and the key part is constructed to be that when the pressing piece is pressed, the elastic piece deforms elastically so that the pressing piece can move in the direction close to the triggering assembly along with the elastic piece. According to the key assembly provided by the embodiment of the utility model, the elastic piece is arranged, the pressing piece is embedded in the elastic piece in the sealing manner ...

Подробнее
21-07-2023 дата публикации

Artificial intelligence channel simulation and data expansion method

Номер: CN116470972A
Принадлежит:

The invention provides an artificial intelligence channel simulation and data expansion method. The method comprises the following steps: training a channel generation network according to actually measured real channel data by using a channel simulation algorithm, and generating a generation model through the channel generation network; and the channel generator imports the generation model generated by the channel simulation algorithm, generates channel data by using the generation model, and displays and verifies the channel data. According to the method, the channel data set can be greatly expanded according to a small amount of measurement data, and the requirement for data shortage under the background that the AI and the channel are combined is met. The AI method is used for simulating a measurement channel and expanding channel measurement data. The urgent demand of a new communication mode based on AI for mass data is improved, and V2V channel research, communication system design ...

Подробнее
23-06-2023 дата публикации

Pavement coating for photocatalytic degradation of automobile exhaust and preparation method thereof

Номер: CN116285580A
Принадлежит:

The invention discloses an automobile exhaust photocatalytic degradation coating and a preparation method thereof. The coating is prepared from the following components in parts by weight: 50 to 60 parts of resin emulsion, 20 to 33 parts of nano titanium dioxide solution and 10 to 20 parts of filler. According to the coating for photocatalytic degradation of the automobile exhaust, harmful substances such as carbon monoxide and nitrogen oxide in the automobile exhaust are respectively oxidized into carbon dioxide and nitrate which are harmless to a human body on the basis of the photocatalytic performance of the nano titanium dioxide and the nano Fe2O3, so that the aim of reducing exhaust pollution is fulfilled.

Подробнее
28-04-2022 дата публикации

BLOOD PRESSURE MEASUREMENT MODULE, WATCH STRAP FOR WEARABLE DEVICE, AND WEARABLE DEVICE

Номер: WO2022083215A1
Автор: ZHOU, Shun
Принадлежит:

Provided are a blood pressure measurement module (2), a watch strap (100) for a wearable device, and the wearable device having same. The blood pressure measurement module (2) comprises a housing (21), an emitting element (23), a light receiver (24), and a circuit board (22). The housing (21) is provided with a transparent region. The emitting element (23) and the light receiver (24) are both provided on the circuit board (22). The circuit board (22) is provided in an accommodating space. The emitting element (23) is used for emitting infrared light to a finger of a user by means of the transparent region. The light receiver (24) is electrically connected to the emitting element (23). The light receiver (24) is used for receiving, by means of the transparent region, the infrared light reflected by the finger of the user. The circuit board (22) is used for calculating a blood pressure value according to the reflected infrared light received by the light receiver (24).

Подробнее
11-08-2023 дата публикации

Treatment method for reconsolidation of soft soil under action of dynamic load

Номер: CN116575435A
Принадлежит:

The invention relates to a treatment method for reconsolidation of soft soil under the action of a dynamic load. The problems that a vibration frame structure of an existing vibration drainage soft soil consolidation method is large, a vibration supporting foundation is difficult to manufacture, construction is inconvenient, and the foundation is damaged after recovery are solved. The method comprises the following steps: mixing upper-layer soil with cement to form a cement-soil base layer with the strength of C5-C15; uniformly arranging water seepage pipes on the cement soil base layer; a vibration rod is arranged in each water seepage pipe; a pile-loading plate is placed on the cement soil base layer, and a vibrator is fixedly placed on the pile-loading plate; the vibrator fixed on the stacking plate vibrates to drive the vibration rod in the water seepage pipe to collect free water generated after vibration into the water seepage pipe, and the water suction pump is adopted to discharge ...

Подробнее
04-04-2023 дата публикации

Salt-fog-resistant single-component polyurethane hot melt adhesive and preparation method thereof

Номер: CN115895562A
Принадлежит:

The invention belongs to the technical field of polyurethane hot melt adhesives, and relates to a single-component salt-spray-resistant polyurethane hot melt adhesive and a preparation method thereof.The single-component salt-spray-resistant polyurethane hot melt adhesive is prepared from, by weight, 30-40 parts of polycarbonate diol, 10-20 parts of polyethylene glycol terephthalate, 10-20 parts of 1, 2, 4-trimethyl-1, 3-pentanediol, 10-20 parts of 1, 2, 4-trimethyl-1, 3 The coating is prepared from the following components in parts by weight: 3 to 8 parts of 1, 6-hexanediol, 8 to 15 parts of amorphous liquid saturated polyester, 15 to 20 parts of acrylic resin, 0.05 to 0.15 part of an antioxidant, 0.05 to 0.15 part of a flatting agent, 0.02 to 0.04 part of a water removal agent, 18 to 23 parts of diisocyanate, 0.3 to 0.6 part of a coupling agent and 0.03 to 0.06 part of a catalyst. The prepared hot melt adhesive has the functions of salt mist resistance, creep resistance, high-temperature ...

Подробнее
27-06-2019 дата публикации

PERIPHERAL ELECTRIC HEATING AEROSOL GENERATING SYSTEM CONTAINING TOBACCO PARTICLES

Номер: WO2019119731A1
Принадлежит:

Disclosed is a peripheral electric heating aerosol generating system containing tobacco particles, comprising an electric heating tobacco stem and a cartridge inserted in the electric heating tobacco stem. The cartridge comprises a metal sleeve, a filter section and a heating section. The top of the metal sleeve is provided with an opening, and the bottom of the metal sleeve is sealed by means of a metal base. The filter section and the heating section are vertically arranged in a cavity inside the metal sleeve. The bottom of the heating section is supported by the metal base, and the heating section is formed by the tobacco particles. The electric heating tobacco stem comprises a tobacco stem body. The upper portion of the tobacco stem body is provided with a containing cavity. An electric heating assembly is provided in the containing cavity of the tobacco stem body. The electric heating assembly comprises an annular heating piece and a bottom heating piece. The cartridge is inserted ...

Подробнее
14-04-2023 дата публикации

Micro-nano speckle eliminating device

Номер: CN115963647A
Принадлежит:

The invention discloses a micro-nano speckle eliminating device, and relates to the technical field of optics. Comprising upper-layer optical glass, an optical cavity, scattering particles, a vibration structure, a substrate structure, a driving device and lower-layer optical glass, wherein the vibration structure and the scattering particles are both located in the optical cavity, the driving device is used for loading a driving signal to the vibration structure, the upper-layer optical glass is plated with a high-transmittance film in a double-layer mode, the lower-layer optical glass is plated with a high-transmittance film in a double-layer mode, and the inner wall of the optical cavity is plated with a total-reflection film. And adding a solute and a solution into the optical chamber. According to the invention, a static scattering field in the optical cavity is changed into a dynamic scattering field, so that the spatial coherence of the laser is reduced, the time coherence of the ...

Подробнее
27-06-2019 дата публикации

SMOKE RELEASE GRANULE MATERIAL SUITABLE FOR HEATING NON-COMBUSTIBLE TOBACCO PRODUCTS AND PREPARATION METHOD THEREFOR

Номер: WO2019119732A1
Принадлежит:

Disclosed by the present invention are a smoke release granule material suitable for heating non-combustible tobacco products and a preparation method therefor; the raw materials of the smoke release granule material are composed as follows in mass percentage: tobacco ultra-fine powder 40-60%, other biomass powder 0-10%, tobacco dry distillate 5-10%, atomizing agent 20-40%, and binder 1-5%, the rest being the flavor and fragrance of tobacco. The smoke release granular material of the present invention has uniform particle size, and the amount of atomizing agent added may be arbitrarily adjusted according to needs, a large amount of smoke being released, which may satisfy consumers in a manner similar to smoking when heating non-combustible products. Adding a tobacco dry distillate may significantly improve the sensory quality of the smoke, and enable the smoke to have excellent uniformity, fragrance, concentration and strength. The cooperative use of other biomass powders may impart the ...

Подробнее
18-08-2023 дата публикации

Enterprise car use management method and related equipment

Номер: CN116612561A
Принадлежит:

The embodiment of the invention provides an enterprise vehicle use management method and related equipment, and the method comprises the steps: obtaining a vehicle use application form which comprises a to-be-selected vehicle; acquiring basic information of an applicant based on an application terminal corresponding to the vehicle use application form; based on the vehicle use application form and the applicant basic information, generating a vehicle use approval form; and under the condition that the vehicle use approval sheet passes the approval, a vehicle Bluetooth key is sent to the application terminal, and the vehicle Bluetooth key is used for starting the to-be-selected vehicle. Based on the method provided by the invention, the whole online operation from vehicle application to examination and approval, from examination and approval to issuing of the vehicle Bluetooth key, and then the applicant uses the vehicle Bluetooth key to open the vehicle is completed, so that the vehicle ...

Подробнее
25-07-2023 дата публикации

Mutant of adeno-associated virus capsid protein and application thereof

Номер: CN116478252A
Принадлежит:

The invention discloses a mutant of adeno-associated virus capsid protein and application thereof, and compared with an amino acid sequence of wild type AAV capsid protein, the mutant has one or more amino acid substitutions at the 561th to 588th amino acids of Cap2. According to the adeno-associated virus variant obtained through the scheme, the AAV2 virus packaging capacity and the in-vivo tissue infection capacity can be remarkably improved, and the problems of AAV2 production flux and use dosage are fundamentally solved.

Подробнее
03-03-2016 дата публикации

METHOD FOR ESTABLISHING THREE-LINE ASSORTED BREEDING SYSTEM FOR ARGOPECTEN IRRADIANS IRRADIANS-ARGOPECTEN PURPURATUS HYBRID SCALLOPS AND APPLICATION THEREOF

Номер: WO2016029490A1
Принадлежит:

A method for establishing a three-line assorted breeding system for Argopecten irradians irradians-Argopecten purpuratus hybrid scallops and application thereof. The three lines comprise a sterile male line, a maintenance line, and a restorative line of the Argopecten irradians irradians-Argopecten purpuratus hybrid scallop, wherein Argopecten irradians irradians-Argopecten purpuratus hybrid scallops are a hybrid progeny of Argopecten irradians irradians ova and Argopecten purpuratus sperm. First establishing a large quantity of Argopecten irradians irradians and Argopecten purpuratus first generation hybrids, and finding therein sterile males for selective breeding of the sterile male line; then successively backcrossing using Argopecten purpuratus sperm, respectively selectively breeding a sterile male line-maintenance line combination in which all progeny are sterile males, and a sterile male line-restorative line combination in which all progeny are hermaphrodites; and finally hybridising ...

Подробнее
27-06-2023 дата публикации

POSS-based hydrophobic material and preparation method thereof

Номер: CN116333317A
Принадлежит:

The invention discloses a POSS (Polyhedral Oligomeric Silsesquioxane)-based hydrophobic material and a preparation method thereof. The structure of the POSS-based hydrophobic material is shown as follows: R is a whole even number in which the number of R contained in the POSS-based hydrophobic material is 2-8. The POSS-based composite material provided by the invention has excellent high temperature resistance through the Si-O-Si structure of the POSS-based composite material; after 1-hexene is grafted, excellent hydrophobic performance can be achieved; the 1-hexene is grafted, so that the solubility of the composite material in various organic solvents can be obviously improved; in addition, the POSS-based composite material can be prepared through a'thiol-olefin 'click reaction, and the preparation conditions are green and efficient.

Подробнее
11-07-2023 дата публикации

Generating capacity control method and device for photovoltaic power generation, equipment and medium

Номер: CN116417996A
Принадлежит:

The invention relates to a generating capacity control method and device for photovoltaic power generation, equipment and a medium, and is applied to the technical field of new energy power generation. Inputting the current photovoltaic power generation amount into a corresponding preset calculation model to obtain a first power generation amount of the photovoltaic power generation field within a first preset time; determining the power generation time of the current photovoltaic power plant based on the first power generation amount; and performing power supply switching based on the power generation time so as to ensure accurate control of the power generation amount. The method has the effects of accurately controlling the photovoltaic generating capacity and reducing the loss of the generating capacity.

Подробнее
29-08-2023 дата публикации

Optical telephone system of optical communication comprehensive test equipment and bidirectional communication method

Номер: CN116667922A
Принадлежит:

The invention discloses an optical telephone system of optical communication comprehensive test equipment and a two-way communication method, and belongs to the technical field of optical communication. The variable optical attenuation unit comprises an electrically tunable variable optical attenuator and a driving control circuit; a light source unit including a light source driver and a control circuit; the optical power measuring unit comprises a programmable transimpedance amplifier (TIA) and a control circuit; the bit error rate measuring unit comprises a bit error rate detector, a code pattern generator and a control circuit; and the control unit comprises an FPGA (Field Programmable Gate Array) frame and synchronous demodulation control circuit, a PCM (Pulse Code Modulation) codec, an interface unit and a display keyboard unit. The device can be applied to a handheld optical communication comprehensive tester to realize optical telephone and two-way communication functions, realizes ...

Подробнее
23-06-2023 дата публикации

Automatic exposure method based on adaptive weight of space dynamic target of FPGA (Field Programmable Gate Array)

Номер: CN116320767A
Принадлежит:

The invention relates to an image processing method, in particular to an automatic exposure method based on an adaptive weight of an FPGA spatial dynamic target, which is used for solving the problems that the target cannot be locked in a high-weight area all the time when facing the dynamic target in a traditional exposure method, and when the target is not in a set weight area, the target cannot be locked in the high-weight area all the time. And automatic exposure adjustment cannot realize a good exposure effect. The automatic exposure method based on the FPGA spatial dynamic target adaptive weight comprises the following steps: dividing a to-be-processed image into a plurality of sub-regions with the same size, and preprocessing and segmenting a target part and a background part; carrying out adaptive weight setting according to the specific gravity sequence of the target part in each sub-region, and calculating the average gray scale of the to-be-processed image; and then calculating ...

Подробнее
11-04-2023 дата публикации

Perforated and ventilated granular heating cigarette and preparation method thereof

Номер: CN115944113A
Принадлежит:

The particle type heating cigarette comprises a particle section, a blocking section, a punching section and a filtering section which are connected in sequence, one or two rows of miniature through holes are evenly distributed in the circumferential direction of the punching section, and the ventilation rate of the side wall of the cigarette ranges from 5% to 60%. According to the particle type heating cigarette, smoke cooling and smoke release can be well balanced only by controlling the cigarette punching ventilation rate, and the particle type heating cigarette has the obvious cost advantage and process implementation convenience.

Подробнее
23-06-2023 дата публикации

Immobilized atomizing agent material and heating cigarette core material based on immobilized atomizing agent material

Номер: CN116268526A
Принадлежит:

The invention discloses an atomizing agent immobilization material and a heating cigarette core material based on the atomizing agent immobilization material, an atomizing agent is cured in a porous material through a spray drying method, the porous material has a hydrophobic function through further surface treatment, and the curing amount of the atomizing agent can be controlled by adjusting the pore size of the porous material and spray drying process parameters. The immobilized atomizing agent material is added into a cigarette core material, so that the moisture absorption capacity of the cigarette core material is reduced while the smoke release amount of the cigarette core material is increased, and the quality and the quality stability of a heated cigarette are improved.

Подробнее
25-07-2023 дата публикации

Adeno-associated virus variant as well as preparation method and application thereof

Номер: CN116478253A
Принадлежит:

The invention discloses an adeno-associated virus variant as well as a preparation method and application thereof. The adeno-associated virus variant contains one or more amino acid substitutions relative to a wild type AAV2 capsid protein as shown in SEQ ID NO.1. According to the adeno-associated virus variant prepared through the scheme, the AAV2 virus packaging capacity and the in-vivo tissue infection capacity can be remarkably improved, and the problems of AAV2 production flux and use dosage are fundamentally solved.

Подробнее
05-05-2023 дата публикации

Capsid protein MutD capable of improving AAV packaging capacity and application of capsid protein MutD

Номер: CN116063404A
Принадлежит:

The invention discloses a capsid protein MutD capable of improving AAV packaging capability and application of the capsid protein MutD. The research of the inventor finds that the adeno-associated virus variant prepared by substituting a wild type AAV2 capsid protein sequence with five amino acids N563, A566, E578, G587 and H588 can significantly improve the AAV2 virus packaging ability, and fundamentally solves the problems of production flux and production cost of AAV2.

Подробнее
04-08-2023 дата публикации

Solar blind ultraviolet photoelectric detector based on all-fiber structure and preparation method and application thereof

Номер: CN116544288A
Принадлежит:

The invention provides a solar blind ultraviolet photoelectric detector based on an all-fiber structure and a preparation method and application thereof. The detector comprises an optical waveguide structure, the optical waveguide structure is selected from an ultraviolet optical fiber, and the ultraviolet optical fiber comprises a fiber core and a wrapping layer wrapping the outer side of the fiber core; the optical waveguide structure is provided with a polishing area, the polishing area is subjected to side edge polishing to obtain a polishing surface, the polishing area comprises a cladding, and the polishing area transmits optical wave signals through the cladding. The photoelectric detector disclosed by the invention adopts a structure integrated by the optical waveguide structure with the polished side edge and the composite film containing the beta-Ga2O3 nanosheet, so that not only can a solar-blind ultraviolet light signal be detected, but also the solar-blind ultraviolet light ...

Подробнее
23-05-2023 дата публикации

Paralichthys olivaceus intestinal epithelial cell line as well as construction method and application thereof

Номер: CN116144582A
Принадлежит:

The invention discloses a paralichthys olivaceus intestinal epithelial cell line as well as a construction method and application thereof, and relates to the field of marine organism cell culture. The construction method comprises the following steps: (1) taking intestinal tracts of paralichthys olivaceus, removing fat and peritoneum on the intestinal tracts to obtain intestinal wall tissues, and putting the intestinal wall tissues into a culture container filled with a complete culture solution for adherent culture; and (2) digesting the cells obtained by adherent culture in the step (1), and subculturing for 50 generations to obtain the intestinal epithelial cell line of the paralichthys olivaceus. The paralichthys olivaceus intestinal epithelial cell line can be successfully constructed by utilizing the construction method disclosed by the invention, and the cell line has the main characteristics that the cell line can be continuously subcultured for 50 generations or more, the growth ...

Подробнее
30-05-2023 дата публикации

Panel laminating device for liquid crystal display screen production

Номер: CN116184705A
Автор: ZHOU SHUN
Принадлежит:

The invention provides a panel laminating device for liquid crystal display screen production, and belongs to the technical field of liquid crystal display screen production, the panel laminating device comprises a base, a driving assembly, two sets of containing plates, a roll coating assembly and a pushing assembly, the two sets of containing plates are hinged to one side of the base and are oppositely distributed, and the roll coating assembly is arranged on the other side of the base; the two containing plates are installed on the base and used for supporting a liquid crystal panel and a touch screen respectively, the driving assembly is installed on one side of the base and used for driving the two containing plates to rotate relatively, the roll coating assembly is arranged on one sides of the two containing plates, the pushing assembly is arranged on one side of the roll coating assembly, and when the two containing plates rotate relatively, the roll coating assembly is driven by ...

Подробнее
23-06-2023 дата публикации

Mixed nicotine salt for heating cigarettes and preparation method thereof

Номер: CN116268541A
Принадлежит:

The invention discloses a mixed nicotine salt for heating cigarettes and a preparation method of the mixed nicotine salt. The mixed nicotine salt is prepared by reacting citric acid, malic acid, tartaric acid and nicotine. The mixed nicotine salt is high in thermal stability, the maximum release temperature of nicotine can be increased to 210-220 DEG C from 159 DEG C in a free state, and the mixed nicotine salt is well matched with heated cigarettes; the mixed nicotine salt disclosed by the invention is applied to a formula of a heated cigarette smoke release material, can remarkably improve the strength and puff-by-puff consistency, has better comfort and satisfaction, is harmonious in fragrance, and does not have obvious irritation or offensive odor.

Подробнее
09-06-2023 дата публикации

Synthesis method of L-nicotine

Номер: CN116239567A
Принадлежит:

The invention discloses a method for synthesizing L-nicotine, which belongs to the technical field of organic synthesis, and comprises the following steps: preparing a Grignard reagent by using 3-bromopyridine and isopropyl magnesium chloride as initial raw materials, coupling with 3, 4-dihydro-2H-pyrrole, efficiently obtaining a chiral intermediate under catalytic induction of a chiral catalyst, and purifying to obtain the L-nicotine. And finally, directly reacting with methyl iodide without separation to generate the L-nicotine compound. The invention provides a simple method for synthesizing L-nicotine, which is simple in reaction process, low in cost and suitable for industrial production.

Подробнее
09-05-2023 дата публикации

Prefabricated shear wall plate and cast-in-place part connecting structure and construction technology

Номер: CN116084592A
Принадлежит:

The invention discloses a prefabricated shear wallboard and cast-in-place part connecting structure and a construction technology, and belongs to the technical field of prefabricated shear wallboard construction, the prefabricated shear wallboard and cast-in-place part connecting structure comprises two adjacent prefabricated shear wallboards, the adjacent side end faces of the two prefabricated shear wallboards extend to be provided with paired connecting steel bars, and the ends of the connecting steel bars are connected through M-shaped bent connecting parts; vertical cast-in-place part vertical steel bars penetrate through and are fixed to the bent positions of the connecting part of the two prefabricated shear wall plates correspondingly, and the bent positions of the two sides of the connecting part of the two prefabricated shear wall plates correspond to each other vertically. The four cast-in-place part vertical steel bars are clamped and positioned through the M-shaped bent connecting ...

Подробнее
22-08-2023 дата публикации

Machine-made sand production method

Номер: CN116621483A
Принадлежит:

The invention relates to a machine-made sand production method which comprises the following steps: crushing waste concrete, and screening out particles with set particle sizes; conveying the screened particles into a winnowing machine so as to remove fine powder; and stirring the particles without the fine powder with water by using a stirrer to form the machine-made sand. The problems that the quality of existing machine-made sand products is difficult to guarantee and the influence of the production process on the natural environment is large are solved, the machine-made sand is manufactured through the waste concrete, waste utilization can be achieved, the product quality can be guaranteed, and therefore zero emission of waste water, waste residues and waste gas is achieved.

Подробнее
23-06-2023 дата публикации

Optical lens

Номер: CN116300007A
Автор: CHEN WEIJIAN, ZHOU SHUN
Принадлежит:

The invention provides an optical lens, which comprises six lenses in sequence from an object side to an imaging surface along an optical axis: a first lens with negative focal power, a second lens with negative focal power, a third lens with negative focal power, a fourth lens with negative focal power, a fifth lens with negative focal power and a sixth lens with negative focal power, the object side surface and the image side surface of the second lens are convex surfaces; a diaphragm; the object side surface and the image side surface of the third lens are convex surfaces; the object side surface and the image side surface of the fourth lens are concave surfaces; the fifth lens has positive focal power, and the object side surface and the image side surface of the fifth lens are convex surfaces; and the object side surface of the sixth lens is a convex surface, and the image side surface of the sixth lens is a concave surface. According to the optical lens provided by the invention, ...

Подробнее
21-07-2023 дата публикации

Composition for preparing conductive hydrogel, conductive hydrogel and preparation method of conductive hydrogel

Номер: CN116462926A
Принадлежит:

The invention provides a composition for preparing conductive hydrogel, the conductive hydrogel and a preparation method of the conductive hydrogel, and belongs to the field of hydrogel material preparation. The composition for preparing the conductive hydrogel is prepared from the following components in percentage by weight: 10.53%-12.53% of a water-based high-molecular polymer, 0.37%-0.57% of strong acid and strong alkali salt, 18.22%-20.22% of a water-retaining agent, 10.53%-12.53% of a gelatinizing agent and 0.03%-0.05% of a modifier, and by virtue of the composition, the problem that the conductive hydrogel is difficult to have excellent performances such as good conductivity and high capacitive property at the same time can be solved.

Подробнее
11-07-2023 дата публикации

Video data zero-copy implementation method and system based on NVIDIA jetson platform

Номер: CN116416326A
Автор: ZHOU SHUN
Принадлежит:

The invention relates to the technical field of edge computing video processing, in particular to a video data zero-copy implementation method and system based on an NVIDIA jetson platform, and the method comprises the following steps: initializing the memory types of an input buffer area and an output buffer area of a decoder into a V4L2MEMORYMMAP mode; directly writing original video data into an input buffer area of the decoder by adopting a memory mapping mode; the video data zero-copy implementation method and system based on the NVIDIA jetson platform have the advantages that different memory modes and optimization schemes are used, the platform and software and hardware mechanisms are combined, and data are transmitted in a zero-copy mode in the whole video data processing process. The method has the advantages that aiming at the working characteristics of each stage of image processing, a set of complete optimization scheme for realizing zero copy of the memory is provided, real ...

Подробнее
25-04-2023 дата публикации

Quantitative detection method for residues of valnemulin, tiamulin and metabolites thereof in aquatic products

Номер: CN116008457A
Принадлежит:

The invention discloses a method for determining residual quantity of valnemulin, tiamulin and metabolites thereof in an aquatic product by isotope dilution high performance liquid chromatography-tandem mass spectrometry, which comprises the following steps: A, weighing muscle tissues of the water product, adding acetonitrile containing 1% acetic acid, anhydrous magnesium sulfate and sodium chloride for extraction and purification; b, adding a sodium hydroxide solution for hydrolysis; c, ethyl acetate containing 1% acetic acid is added for back extraction; d, detecting the residual quantity of valnemulin, tiamulin and metabolite 8-alpha-hydroxymulin thereof in the aquatic product by adopting an isotope dilution high performance liquid chromatography-tandem mass spectrum in a time-period switching ion mode; e, quantifying by adopting a matrix standard curve method: quantifying the valnemulin and the tiamulin by adopting an internal standard method, wherein the valnemulin-D6 and the tiamulin ...

Подробнее
16-05-2023 дата публикации

Dual-polarized horn common-caliber planar array antenna

Номер: CN116130981A
Принадлежит:

The invention relates to the field of satellite communication, in particular to a dual-polarized horn common-caliber planar array antenna, which is a 12 * 12 matrix formed by 144 dual-polarized antenna arrays and comprises a network radiation layer, a receiving layer and a transmitting layer, the receiving layer and the transmitting layer are polarized and orthogonal through a dual-polarized open waveguide array radiation structure, and the receiving layer and the transmitting layer are connected with the dual-polarized open waveguide array radiation structure. The dual-polarized open waveguide array radiation structure is a three-layer stepped transition square pyramid waveguide horn orthogonal coupler, and a cross-shaped grid bar is arranged on the aperture of each square waveguide horn. In the invention, under the condition of the same area, the gain of the waveguide horn panel array antenna is more than 3 dB higher than that of the two kinds of antennas, and under the condition of the ...

Подробнее
17-08-2021 дата публикации

Double-shaft concrete stirring device

Номер: CN113263626A
Принадлежит:

The invention relates to the technical field of concrete production equipment, in particular to a double-shaft concrete stirring device which comprises a supporting seat, a stirring barrel, two rotating shafts and a driving mechanism, wherein the rotating shafts are arranged in an axially parallel mode. The device further comprises at least one stirring mechanism, wherein the stirring mechanism comprises two connecting sleeves, at least one stirring assembly and a connecting assembly; the connecting sleeves and the rotating shaft are concentrically arranged, each stirring assembly comprises two stirring blades, the two stirring blades are rotatably connected, and the ends, away from each other, of the two stirring blades are rotatably connected with the connecting sleeves correspondingly. According to the designed double-shaft concrete stirring device, it is convenient for the stirring blades and the rotating shaft to rotate synchronously, the inclination angles of the stirring blades are ...

Подробнее
29-08-2023 дата публикации

Photovoltaic equipment and photovoltaic equipment control system

Номер: CN116667443A
Принадлежит:

The embodiment of the invention provides photovoltaic equipment and a control system. The photovoltaic equipment comprises a power generation device, a monitoring assembly, a blower device and a processor, the power generation device at least comprises a photovoltaic power generation assembly and an energy storage assembly. The blower device is used for blowing air to the power generation device. The monitoring assembly is used for acquiring first monitoring data and second monitoring data; the power generation device, the monitoring assembly and the blower device are in communication connection with the processor, and the processor is used for determining power generation characteristics of the photovoltaic equipment, determining power utilization characteristics of power utilization equipment connected to the photovoltaic equipment, determining a power supply strategy of the photovoltaic equipment, determining a control instruction and controlling the working state of at least one of ...

Подробнее
23-06-2023 дата публикации

Composite pavement cooling coating and preparation method thereof

Номер: CN116285579A
Принадлежит:

The invention discloses a composite pavement cooling coating and a preparation method thereof.The composite pavement cooling coating comprises a heat insulation layer based on hollow glass beads and a heat reflection cooling surface coating, and the heat reflection cooling surface coating is formed on the surface of the heat insulation layer based on the hollow glass beads. The composite pavement temperature-regulating coating provided by the invention can be used as a cement concrete pavement as well as an asphalt concrete pavement, and plays a role in reducing the temperature of the pavement.

Подробнее
22-08-2023 дата публикации

Rapid channel parameter configuration method based on wireless channel simulation equipment

Номер: CN116633512A
Принадлежит:

The invention relates to a rapid channel parameter configuration method based on wireless channel simulation equipment, which belongs to the technical field of electric digital data processing and comprises the following steps of: determining a link, and determining a connection port and multiple paths according to a link relationship of tested equipment; physical quantities of time delay, power, Doppler and phase are determined; determining a time delay control mode; determining engineering quantity conversion of the time delay according to a control mode of the time delay; determining engineering quantity conversion of power, phase and Doppler; and framing the link relationship and the converted various types of channel parameter engineering quantities according to a frame protocol, and issuing the framed data to hardware. According to the scheme of the invention, the channel parameters can be quickly controlled.

Подробнее
05-05-2023 дата публикации

Capsid protein mutant MutC capable of improving packaging capacity of AAV virus and application of capsid protein mutant MutC

Номер: CN116063405A
Принадлежит:

The invention discloses a capsid protein mutant MutC capable of improving AAV virus packaging capability and application of the capsid protein mutant MutC. According to the present invention, the research results show that the capsid protein mutant MutC obtained by replacing the 561-588 site amino acids of the wild type AAV2 virus capsid protein with the QAEIATTNPVATEQWGCTNNQANMNGVDTATANIDEEWP can effectively improve the AAV virus packaging ability, and can fundamentally solve the problems of AAV2 production flux and production cost; ...

Подробнее
30-06-2023 дата публикации

Fabricated steel structure house and construction process thereof

Номер: CN116356940A
Принадлежит:

The invention relates to an assembly type steel structure house and a construction technology thereof, and belongs to the technical field of building structures, the assembly type steel structure house comprises a plurality of door-shaped frames, each door-shaped frame comprises stand columns and a cross beam, each door-shaped frame comprises two stand columns and a cross beam installed between the two stand columns, and the stand columns and the cross beams are all of an I-shaped steel structure; the lower ends of the stand columns are fixedly provided with installation plates, the installation plates are installed on the ground through a plurality of foundation bolts, the ends of the cross beams are installed on the side faces of the top ends of the stand columns through first bolt connecting pieces, and the cross beams of the adjacent door-shaped frames are connected through folded plates. The method is very convenient and fast, and the cost is lower. According to the construction process ...

Подробнее
13-07-2016 дата публикации

Sensitivity of electron cigarette and relaxation degree testing arrangement

Номер: CN0205384051U
Принадлежит:

... 本实用新型公开了种电子烟灵敏度和轻松度测试装置,其中电子烟灵敏度和轻松度测试装置设置有可调速的蠕动泵(1)、烟雾探测器(2)以及压力计(3);蠕动泵(1)用于模拟电子烟抽吸动作,烟雾探测器(2)用于探测抽吸管路中的烟雾量,压力计(3)用于检测电子烟抽吸气压。本装置安装简便,测试方法简单,可直接用试验数据表征电子烟的灵敏度和轻松度性能,测试结果准确且公正;而且该测试装置及方法对于所有的电子烟具有适用性和重复性,因此可用于电子烟灵敏度和轻松度的批量测试,并可以用于测试电子烟产品的加工均性。 ...

Подробнее
23-05-2023 дата публикации

Speckle suppression device and method for efficient laser beam combination

Номер: CN116149072A
Принадлежит:

The invention discloses a speckle suppression device and method for efficient laser beam combination, and relates to the technical field of optics, and the speckle suppression device comprises an even number of laser sources, collimating lenses corresponding to the laser sources in number, reflectors with 1/2 laser sources in number, polarization beam combination prisms with 1/2 laser sources in number, a telescopic system, a beam expanding lens and an optical screen. According to the speckle suppression device, an even number of laser devices are introduced to emit laser, the optical path difference of the incident laser is changed by controlling the distance between the different laser devices, so that the spatial coherence of the laser is broken, laser beams in different polarization states are overlaid in pairs in the space by combining the polarization diversity, and the speckle suppression effect is achieved. And finally, all laser spots are superposed by using the beam expanding ...

Подробнее
11-08-2023 дата публикации

Multi-aperture image synthesis method for recognition

Номер: CN116579926A
Принадлежит:

The invention relates to the technical field of image super-resolution reconstruction, in particular to a multi-aperture image synthesis method for recognition, which comprises the following steps of: firstly, obtaining a group of sub-aperture image sequences, then filtering the images, splicing and fusing a plurality of preprocessed sub-aperture images to generate a full-aperture synthesis image, and finally obtaining the full-aperture synthesis image. And then image segmentation is carried out, and finally target identification in the image is carried out. According to the invention, not only can the feature information of the image be reserved, but also the high-frequency noise of the image can be further effectively suppressed while the noise of various frequency bands in the image is eliminated; according to the method, a plurality of steps are combined to obtain a final super-resolution image, so that the detail information of the image is clearer; according to the method, the closely ...

Подробнее
28-04-2023 дата публикации

Pulse dust collector for medicinal material processing

Номер: CN116020209A
Принадлежит:

The invention relates to the field of medicinal material processing, in particular to a pulse dust collector for medicinal material processing, which comprises a shell and a dust collection device mounted in the shell, the dust removal device comprises a supporting plate fixedly connected into the shell, a plurality of supporting cages connected to the supporting plate in an inserted mode and dust removal bags arranged on the supporting cages in a sleeving mode, each supporting cage comprises a plurality of supporting telescopic rods connected end to end, and each supporting telescopic rod comprises a plurality of cylinder bodies sequentially arranged in a sleeving mode; a first connecting assembly used for fixing the relative position between every two adjacent barrels is arranged between every two adjacent barrels, and each barrel comprises a first mounting ring, a second mounting ring and a plurality of connecting rods detachably connected between the first mounting ring and the second ...

Подробнее
02-05-2023 дата публикации

Evaluation method for ash wrapping characteristics of cigarettes

Номер: CN116046689A
Принадлежит:

The invention discloses a method for evaluating cigarette ash packing characteristics, which comprises the following steps of: acquiring appearance index data of cigarettes in a static combustion or smoking mode by adopting a machine vision measurement technology, including grey, cracking rate and ash shrinkage rate, and then calculating cigarette ash packing values according to the acquired index data so as to evaluate the cigarette ash packing characteristics. The method is easy to operate, the more scientific and effective cigarette ash wrapping value can be obtained, and the ash wrapping characteristic of the cigarette can be evaluated more objectively and accurately.

Подробнее
14-04-2023 дата публикации

Methanol industrial fuel

Номер: CN115960640A
Принадлежит:

The invention discloses a methanol industrial fuel which comprises the following raw materials in parts by weight: 80-90 parts of industrial waste oil, 0.1-0.3 part of an additive and 10-15 parts of methanol, the additive is composed of undecane, dodecane, hexadecane and decaalkane; the preparation method comprises the following steps: 1) dehydrating industrial waste oil and removing impurities; (2) adding an additive into the dehydrated and impurity-removed industrial waste oil, and filtering to obtain filtrate which is raw oil; and 3) mixing the raw oil with methanol to obtain the methanol industrial fuel. The fuel disclosed by the invention can replace heavy oil and natural gas, the cost of the fuel is low, and the emission of the fuel meets the requirements of the Emission Standard of Air Pollutants for Industrial Furnace (GB 9078-1996) and the Integrated Emission Standard of Air Pollutants (GB16297-1996).

Подробнее
25-04-2023 дата публикации

Narrow-band-gap perovskite photovoltaic cell and preparation method and application thereof

Номер: CN116017992A
Принадлежит:

The invention relates to a narrow-band-gap perovskite photovoltaic cell and a preparation method and application thereof. The narrow-band-gap perovskite photovoltaic cell sequentially comprises a substrate, a hole transport layer, a perovskite light absorption layer, an electron transport layer and an electrode layer from bottom to top, and the hole transport layer, the perovskite light absorption layer and the electron transport layer are used as a whole and contain asparaginic acid halide salt. According to the invention, the asparaginic acid halide salt is used for modification, the inverted-structure narrow-band-gap perovskite solar cell with the photoelectric conversion efficiency of 22.26% is prepared, and meanwhile, the full-perovskite laminated cell with the photoelectric conversion efficiency of 26.4% is also prepared on the basis of the inverted-structure narrow-band-gap perovskite solar cell. According to the method, a solar cell device can be prepared under a low-temperature ...

Подробнее
07-04-2023 дата публикации

Microneedle, preparation method of microneedle, microneedle patch and preparation method of microneedle patch

Номер: CN115920222A
Принадлежит:

The invention provides a microneedle, a preparation method of the microneedle, a microneedle patch and a preparation method of the microneedle patch, and belongs to the technical field of microneedles. The microneedle is provided with a tip and a root, the microneedle comprises an outer layer and an inner core, the outer layer extends from the tip to the root, the outer layer is a quick release layer, and a cavity is formed in the quick release layer; the inner core is arranged in the cavity and comprises a slow release layer. Under the same dissolution environment, the dissolution rate of the quick release layer is greater than that of the slow release layer. The quick-release layer of the microneedle can be quickly dissolved and released to realize quick and efficient playing of the drug effect, and the slow-release layer can be slowly dissolved and released to realize long-time playing of the drug effect, so that the use frequency of the microneedle is reduced, and a good treatment effect ...

Подробнее
02-05-2023 дата публикации

Laser speckle suppression device and method

Номер: CN116047783A
Принадлежит:

The invention discloses a laser speckle suppression device and method, and belongs to the technical field of optics, the laser speckle suppression device is composed of a laser light source, a collimating lens, a semi-transparent and semi-reflecting mirror, a beam splitting film layer array and a detector, and the laser light source outputs coherent laser; after the collimating lens collimates the laser beam, the laser beam is vertically emitted into the beam splitting film layer array through the semi-transparent and semi-reflecting mirror; the light splitting film layer array divides an incident light beam into a plurality of incoherent sub light beams with the same light intensity. The device is a static speckle suppression device, does not need a power supply and drive, and is compact in structure, small in size, low in energy consumption and long in service life; the device is simple in structure and good in speckle suppression effect, laser beams can be divided into N beams of incoherent ...

Подробнее
02-05-2023 дата публикации

New energy high-power charging circuit

Номер: CN116039384A
Автор: YE CHU'AN, GUO JIYAN, ZHOU SHUN
Принадлежит:

The invention discloses a new energy high-power charging circuit, and relates to the field of charging, and the new energy high-power charging circuit comprises a power supply module which is used for outputting two DC voltages, a supply battery charging module with a larger voltage, a supply charging control module with a smaller voltage, and a low-volt power supply module. Compared with the prior art, the system has the beneficial effects that the anti-danger charging module is arranged, charging is prevented from being carried out when a person exists in the new energy automobile, voice prompt is carried out, and the situation that the life safety of the person in the automobile is threatened when a charging fault occurs is avoided; the high-temperature-resistant charging module is arranged, so that the situation that the service life of a battery is affected due to the fact that the battery is charged in the high-temperature state when the automobile is parked outdoors and irradiated ...

Подробнее
11-07-2023 дата публикации

Embedded joint of steel structure building and construction method

Номер: CN116411636A
Принадлежит:

The invention discloses an embedded joint of a steel structure building and a construction method.The embedded joint of the steel structure building comprises a vertical beam and a cross beam matched with the vertical beam, a connecting beam is fixed to one side of the vertical beam and can be connected with the cross beam, a sleeve is arranged at the end of the cross beam, and the sleeve is embedded in the periphery of the cross beam and can move relative to the cross beam; a fixing plate is arranged at one end of the sleeve and can be fixed to the side face of the vertical beam. According to the invention, the potential safety hazard caused by the falling of the bolt at the joint of the steel structure building node in the prior art is solved.

Подробнее