СПОСОБ ОБНАРУЖЕНИЯ ТРИНИТРАТА ГЛИЦЕРИНА

Изобретение относится к аналитическим измерениям. Способ основывается на регистрации хемилюминесцентного излучения, возникающего в ходе взаимодействия химического хемилюминесцентного реагента - производного фталгидразида, добавляемого к пробе, с продуктами щелочного гидролиза ТНГ. Аналитическая процедура состоит из одной стадии. Технический результат - снижение предела обнаружения ТНГ и устранение многостадийности аналитической процедуры. 2 табл.

ТЕСТ-СИСТЕМА В ВИДЕ БИОЛОГИЧЕСКОГО ЧИПА, ОСНОВАННАЯ НА РЕАКЦИЯХ ВЗАИМОДЕЙСТВИЯ АНТИТЕЛА С АНТИГЕНОМ, И ЕЕ ПРИМЕНЕНИЕ

Изобретение относится к химико-фармацевтической промышленности, в частности к вирусологии, биотехнологии, иммунологии, и может быть использовано для определения наличия конкретных компонентов в различных биологических образцах. Сущность изобретения состоит в том, что для анализа биологических образцов используется тест-система в виде биологического чипа, состоящая из не менее одного биочипа, содержащего не менее одного реактора, внутри которого иммобилизованы молекулы-зонды, обладающие структуроспецифичностью или видоспецифичностью к лигандам, по определенному порядку в виде матрицы зондов и/или схемы расположения зондов. При этом указанные лиганды обладают специфичной активностью в реакции антиген/антитело или специфическим сродством к антигену и/или антителу и не вступают в реакцию с антителом-зондом/антигеном-зондом, при этом снижается вероятность перекрестных реакций. Изобретение также относится к способу анализа биологических образцов с использованием вышеупомянутой тест-системы. 2 ...

БИОЛЮМИНЕСЦЕНТНЫЙ СПОСОБ ОПРЕДЕЛЕНИЯ АНТИОКСИДАНТНОЙ АКТИВНОСТИ ВЕЩЕСТВА

Предложен способ определения антиоксидантной активности вещества, предусматривающий приготовление контрольных проб, содержащих буферный раствор и биолюминесцентный сенсор, определения исходной интенсивности биолюминесценции. Добавляют в часть контрольных проб исследуемое вещество с получением рабочих проб. Уравнивают объемы контрольных и рабочих проб. Определяют интенсивность биолюминесценции контрольных и рабочих проб после их инкубации для определения токсичности исследуемого вещества. Добавляют в контрольные и рабочие пробы оксидант и определяют интенсивность биолюминесценции контрольных и рабочих проб с оксидантом после их инкубации для определения антиоксидантной активности исследуемого вещества. Изобретение позволяет определять антиоксидантную активность вещества с одновременным определением его токсичности с сокращением времени определения. 7 з.п. ф-лы, 1 ил., 1 пр.

СПОСОБ ЭКСПРЕСС-ОПРЕДЕЛЕНИЯ ИСТОЧНИКА И ЗАГРЯЗНЕННОСТИ ВОДЫ

Изобретение относится к экологии, в частности к экспресс-определению фальсификации бутилированных питьевых вод из подземных источников (скважин) и загрязнения питьевой, бутилированной и природной воды. Для этого измеряют световые сигналы, полученные методом стимулирования химическими соединениями воды, и определяют коэффициенты отношения I, S и tgά для анализируемого образца и дистиллированной воды и рассчитывают коэффициенты отношения К(I), К(S) и К(tgά). При значениях К(I) 0,9-2,6; К(S), К(tgά) 0,4-2,5 и K(tg2ά) 0,8-2,5 устанавливают ее принадлежность к бутилированной питьевой воде из подземного источника. При значении параметров К(I) > 2,6; К(S), К(tgά) >2,5 и K(tg2ά) >2,5 устанавливают ее фальсификацию - принадлежность к бутилированной питьевой воде из системы централизованного водоснабжения из поверхностного источника. Изобретение позволяет сократить время анализа бутилированной питьевой воды и определить источник ее происхождения и загрязненность. 1 табл., 5 пр.

УСТРОЙСТВО ДЛЯ АНАЛИЗА ЖИДКИХ СРЕД ЛЮМИНЕСЦЕНТНЫМ МЕТОДОМ

Изобретение относится к исследованиям водных сред физическими методами, в частности методами биолюминесценции. Устройство включает светоизолированное кюветное отделение для контрольной и измеряемой проб, регистратор слабых сечений на основе фотоэлектронного умножителя, работающего в режиме счета анодных импульсов. Выход умножителя подключен к усилителю, компаратору, к другому входу которого подключен блок задания порогового уровня. Выход компаратора подключен к одному из входов схемы 2-И, к другому входу которой подключен генератор меандра. Схема 2-И подключена к счетному входу счетчика, а его выход - к параллельному порту, при этом параллельный порт связан с управляющим входом счетчика. Параллельный порт по шине данных и адреса связан с шиной данных и адреса микропроцессора. Кроме того, параллельный порт связан с блоком памяти, последовательным интерфейсом, через который осуществляется подключение к компьютеру. Технический результат состоит в линеаризации характеристики "выходной сигнал ...

СПОСОБ ХЕМИЛЮМИНЕСЦЕНТНОГО ОПРЕДЕЛЕНИЯ ω-ХЛОРАЦЕТОФЕНОНА

Изобретение относится к анализу органических соединений применительно к экологическому контролю в отношении ω-хлорацетофенона. Способ количественного хемилюминесцентного определения ω-хлорацетофенона в органических экстрактах включает обработку раствора пробы раствором гидроокиси калия, щелочным раствором люминола и раствором гемина в водно-спиртовой среде при температуре 293К и при их объемном соотношении, соответственно, 1:1:1:1, с последующим определением интенсивности хемилюминесцентного свечения пробы по сравнению с контролем и определением содержания ω-хлорацетофенона по градуировочному графику. Достигается повышение чувствительности и ускорение анализа. 3 ил., 1 табл.

МАТЕРИАЛЫ И МЕТОДЫ ДЛЯ ОБНАРУЖЕНИЯ ГЕНА АРИЛОКСИАЛКАНОАТДИОКСИГЕНАЗЫ (AAD-12) В РАСТЕНИЯХ

Изобретение относится к области биохимии, в частности к способу обнаружения присутствия гена aad-12 в трансгенном растении сои, содержащем событие pDAB4472-1606. Также раскрыт набор для использования в указанном способе обнаружения присутствия или отсутствия гена aad-12 в геноме растения сои. Изобретение позволяет обнаружить присутствие гена aad-12 в трансгенном растении сои, содержащем событие pDAB4472-1606. 2 н. и 1 з.п. ф-лы, 2 ил., 2 табл., 1 пр.

СПОСОБ КОЛИЧЕСТВЕННОГО ОПРЕДЕЛЕНИЯ ЦИАНИДОВ

Изобретение относится к аналитической химии и может быть использовано при количественном определении цианид-аниона в экстрактах, полученных из воды, грунта, проб воздуха, смывов с поверхностей различных объектов. Изобретение также может быть использовано при проведении мероприятий по мониторингу окружающей среды, мероприятий по защите от оружия массового поражения, для определения полноты дегазации и уничтожения веществ, выделяющих цианид-анионы, а также в криминалистике. Способ количественного определения цианидов в водной и водно-спиртовых пробах включает обработку пробы щелочными растворами люминола, гемина и перекисным соединением с последующим замером интенсивности хемилюминесценции, причем в качестве перекисного соединения используется пара-нитробензциангидрин, получаемый в результате обработки пробы пара-нитробензильденидом, обработку осуществляют при 293 К в течение одной минуты при объемном соотношении растворов пробы, люминола, гемина и пара-нитробензальдегида 1:2:1:1. Достигается ...

Устройство для хемилюминесцентного анализа

Изобретение относится к аналитическим сенсорным системам и может быть использовано для детектирования активных форм кислорода в биологических и иных пробах, а также при проведении хемилюминесцентного иммунологического анализа с повышенной чувствительностью. Устройство для хемилюминесцентного анализа содержания активных форм кислорода в биологических и иных пробах содержит насос для ввода с помощью трубок жидких реактивов из емкостей с хемилюминофором и исследуемыми пробами в микрофлюидный чип, выход которого связан трубкой с емкостью для слива, и фотоприемник, при этом микрофлюидный чип и фотоприемник помещены в светонепроницаемый корпус, причем микрофлюидный чип выполнен по меньшей мере двухканальным и содержит диэлектрическую подложку с нанесенной на нее метаповерхностью из обработанных лазерным излучением металлических наночастиц, обладающих локализованным плазмонным резонансом в спектральной полосе хемилюминесценции используемого хемилюминофора, а в светонепроницаемый корпус также включены ...

УСТРОЙСТВО ДЛЯ ЭКСПРЕССНОГО ОПРЕДЕЛЕНИЯ КОНЦЕНТРАЦИИ АКТИВНЫХ ФОРМ КИСЛОРОДА В ВОДНЫХ РАСТВОРАХ

... 1. Устройство для экспрессного определения концентрации активных форм кислорода в водных растворах, содержащее светонепроницаемую герметичную камеру с крышкой, привод с плунжером, выполненный с возможностью воздействия на дозатор для подачи раствора в кювету, под которой установлен ФЭУ, причем кювета, патрубки и ФЭУ установлены в корпусе, а привод соединен по электрической цепи с ФЭУ, АЦП, блоком управления с блоком питания и ПК, отличающееся тем, что содержит смеситель и проточный рН-метр, установленные в корпусе, и входные штуцеры, трехходовые краны и раму, установленную на крышке, причем приводов с плунжерами, дозаторов и трехходовых кранов, по меньшей мере, четыре и они закреплены на раме, а трехходовые краны соединены с соответствующими дозаторами, входными штуцерами и смесителем, причем каждый дозатор является соответственно дозатором раствора гидроксида натрия или калия, дозатором раствора люминола, дозатором исследуемого раствора и дозатором эталонного раствора, а проточный рН-метр ...

УСТРОЙСТВО АВТОМАТИЧЕСКОГО ХЕМИЛЮМИНОМЕТРА

Устройство автоматического хемилюминометра, содержащее корпус анализатора, колпак столика - платформы, столик - платформу, колпак анализатора, крышку анализатора, термопринтер, дисплей сенсорный, Н-портал, луночный микропланшет, каретку микропланшета, оптико-электронный модуль, модуль раскапывающий, нагревательный элемент микропланшета, вибромотор, отличающееся использованием луночного микропланшета с количеством проб до 96, автоматически перемещаемого по программе при помощи шаговых двигателей относительно неподвижных устройств внесения реагентов и фотометрического приемника, и использованием для дозирования дозирующего насоса.

СПОСОБ ПОЛУЧЕНИЯ D - 2 (6 - β -D- ГАЛАКТОПИРАНОЗИЛБЕНЗТИАЗОЛИЛ -2) - 4,5 -ДИГИДРОТИАЗОЛИЛ -4- КАРБОНОВОЙ КИСЛОТЫ

Изобретение касается углеводов, в частности способа получения D - 2 - (6- b - D - галактопиранозилбентиазолил -2 ) 4,5 - дигидротиазолил -4- карбоновой кислоты, используемой в качестве субстрата для определения ферментативной активности b -галактозы, и может найти применение в иммуноферментном анализе, в ДНК - зондах и в генетической инженерии. Цель - создание нового способа получения указанного вещества. Синтез ведут реакцией 2,3,4,6-тетра-0-ацетил- b -D-галактопиранозилфторида с 2-циан-6-триметилсилилоксибензтиазолом в среде неполярного органического растворителя (бензол) в присутствии эфирата трехфтористого бора с выделением и очисткой хроматографией промежуточного 6-(2-цианобензтиазолил)-2,3,4,6-тетра-0-ацетил- b -D-галактопиранозида с последующим его дезацетилированием и конденсацией с D-цистеином. Продукт дезацетилирования можно подвергнуть очистке методом хроматографии и кристаллизации. Новый способ позволяет получить из доступных реагентов с хорошим выходом (61%) целевой продукт ...

СПОСОБ ПРОГНОЗА ТЕЧЕНИЯ КИШЕЧНЫХ ИНФЕКЦИЙ У ДЕТЕЙ1-3 ЛЕТ

Изобретение относится к медицине, в частности к диагностике, и предназначено для прогнозирования течения острых кишечных инфекций у детей 1-3 лет. Проводят исследование крови. Определяют метаболическую активность лимфоцитов биолюминесцентным методом. При снижении активности в лимфоцитах НАД(Ф)-зависимых дегидрогеназ: Г6ФДГ до 0,47±0,10 мкЕ и НАДФМДГ до 1,42±0,33 мкЕ прогнозируют негладкое течение заболевания. При повышении уровня активности НАДФГДГ до 2,97±0,53 мкЕ прогнозируют гладкое течение заболевания. Способ позволяет с достаточной точностью на ранних этапах заболевания прогнозировать течение острых кишечных инфекций. 2 табл.

СПОСОБ ОПРЕДЕЛЕНИЯ МЕДИ

Изобретение относится к области аналитической химии элементов, а именно к методам определения меди, и может быть использовано при ее определении в технологических растворах, минеральных кислотах, природных и техногенных водах. В способе определения меди, включающем приготовление раствора меди (II), переведение ее в комплексное соединение сорбентом и измерение коэффициента диффузного отражения, в качестве сорбента используют силикагель, химически модифицированный меркаптопропильными группами, при этом обрабатывают сорбент с сорбированной медью 1·10-5-1·10-4 М раствором тиокетона Михлера в 40-60%-ном растворе этилового спирта в воде и измеряют коэффициент диффузного отражения поверхностного комплекса меди (I) при 540 нм. Интенсивность окраски и значения коэффициента диффузного отражения постоянны при использовании 1· 10-5-1·10-4 М растворов тиокетона Михлера в 40-60%-ном растворе этилового спирта в воде. Достигается снижение предела обнаружения меди и расширение диапазона ее определения.

БИОСЕНСОР ДЛЯ НЕПРЕРЫВНОГО КОНТРОЛЯ ТЯЖЕЛЫХ МЕТАЛЛОВ В ВОДЕ

Биосенсор для непрерывного контроля тяжелых металлов в воде, включающий чувствительный элемент, содержащий светящийся мицелий гриба, кюветное отделение, фотодатчик для фиксации изменения интенсивности свечения чувствительного элемента и регистрирующее устройство, отличающийся тем, что в качестве светящегося мицелия гриба использован мицелий гриба Neonothopanus nambi, кюветное отделение выполнено в виде защищенной от света проточной термостатируемой ячейки, имеющей укрепленную в ней верхнюю панель, чувствительный элемент выполнен в виде пластинки с закрепленным на ней светящимся мицелием гриба Neonothopanus nambi и расположен внутри проточной термостатируемой ячейки с возможностью размещения пластинки на поверхности контролируемой воды, при этом фотодатчик размещен на верхней панели.

ЛЮМИНЕСЦЕНТНЫЙ СПОСОБ ОПРЕДЕЛЕНИЯ ТЕРБИЯ

Изобретение относится к области аналитической химии - к способам люминесцентного определения тербия, и может быть использовано для определения следовых количеств тербия при анализе высококачественных лантанидов и в природных водах. В качестве комплексообразователя используется органический реагент (R) - дифениловый эфир сульфосалициловой кислоты (ДЭСК), и в раствор люминесцирующего комплексного соединения тербия с ДЭСК приливают поверхностно-активное вещество (ПАВ) - цетилпиридиний бромистый, в соотношениях Tb:K:ПАВ=1:2:13 и слабыми растворами аммиака и соляной кислоты создают рН 7,5±0,1. Достигается повышение точности, чувствительности и селективности анализа. 1 з.п. ф-лы.

СПОСОБ ДИАГНОСТИКИ СТЕПЕНИ ТЯЖЕСТИ ГЕМОРРАГИЧЕСКОЙ ЛИХОРАДКИ С ПОЧЕЧНЫМ СИНДРОМОМ ПО ПОКАЗАТЕЛЯМ ФУНКЦИОНАЛЬНОГО РЕЗЕРВА ФАГОЦИТАРНОГО ЗВЕНА СИСТЕМЫ ИММУНИТЕТА

Изобретение относится к медицине, а именно к патофизиологии, лабораторной диагностике, инфектологии и терапии, и может быть использовано для диагностики степени тяжести геморрагической лихорадки с почечным синдромом (ГЛПС). Проводят люминол-зависимую хемилюминесценцию гепаринизированной цельной крови с добавлением зимозана. Определяют интенсивность зимозан-индуцированной генерации активных форм кислорода фагоцитами. Определяют показатель резерва функциональной активности фагоцитов. При значении указанного показателя 2,8-3,3 усл. ед. диагностируют ГЛПС средней степени тяжести, 2,0-2,7 усл. ед. – ГЛПС тяжелой степени тяжести, 1,9 усл. ед. и менее - ГЛПС тяжелой степени с острой почечной недостаточностью. Способ обеспечивает упрощенную и точную диагностику степени тяжести ГЛПС за счет оценки функционального резерва фагоцитарного звена системы иммунитета. 6 пр.

УСТРОЙСТВО ДЛЯ ИЗМЕРЕНИЯ ИНТЕНСИВНОСТИ НАЧАЛЬНОЙ ФАЗЫ ИНДУЦИРОВАННОЙ ХЕМИЛЮМИНЕСЦЕНТНОЙ РЕАКЦИИ

Изобретение относится к хемилюминесцентному анализу. Сущность изобретения: в устройство введен пиковый детектор. Фильтр низких частот имеет полосу пропускание 0 - 5 Гц. Динамический диапазон детектора и индикатора не уже, чем динамический диапазон предусилителя. 2 з.п.ф-лы, 2 ил.

МЕТАЛЛОКОМПЛЕКСЫ ПОРФИРИН-КЕТОНОВ, ЧУВСТВИТЕЛЬНЫЙ ЭЛЕМЕНТ ДЛЯ ОПТИЧЕСКОГО ОПРЕДЕЛЕНИЯ КИСЛОРОДА В ЖИДКОЙ ИЛИ ГАЗОВОЙ СРЕДЕ И СПОСОБ ОПРЕДЕЛЕНИЯ КИСЛОРОДА

Использование: в аналитической химии, ветеринарии, медицине, биотехнологии и пищевой промышленности при оптическом определении кислорода. Сущность изобретения: платиновые и палладиевые комплексы новых замещенных порфирин-кетонов. Чувствительный элемент для оптического определения кислорода в жидкой или газовой среде в виде сформованного из полистирола изделия с распределенными в нем платиновыми или палладиевыми комплексами новых замещенных порфирин-кетонов в качестве фосфоресцирующего красителя. Чувствительный элемент выполнен в виде пленки толщиной 1-20 мк. Пленка может быть закреплена на твердой подложке или оптическом элементе. Сформованное изделие может содержать слой кислород-зависимого фермента. Способ определения кислорода посредством такого чувствительного элемента, находящегося в контакте с анализируемым образцом и связанного посредством оптического волокна с детектором фосфоресценции с оптимальной чувствительностью 700-850 нм. Фосфоресценцию чувствительного элемента возбуждают ...

СПОСОБ ОПРЕДЕЛЕНИЯ ЦИНКА (II)

Изобретение относится к области аналитической химии и может быть использовано для концентрирования и определения микроколичеств металлов в питьевой воде с использованием твердых сорбентов, содержащих органический материал. Техническим результатом изобретения является снижение предела обнаружения, расширение диапазона определяемых содержаний, повышение чувствительности способа, создание нового избирательного сорбента, пригодного к многократному использованию. Для определения цинка(II) варьируют рН среды для его избирательного извлечения на сорбенте, модифицированном 8-гидрокси-7-йод-5-сульфохинолином, иммобилизованным за счет нековалентного закрепления на поверхности силикагеля, предварительно обработанного полигексаметиленгуанидином. Детектируют интенсивность люминесценции поверхностных комплексов цинка(II) при длине волны 500 нм. Определяют содержание цинка(II) по градуировочному графику. Использованный сорбент подвергают регенерации, после которой он не теряет своей сорбционной емкости ...

БИОХЕМИЛЮМИНОМЕТР

Изобретение относится к лабораторной технике. Сущность заключается в том, что биохемилюминометр, включающий светозащищенный корпус со светонепроницаемой камерой, имеющий крышку и ротор с кюветодержателями, имеет на внешней поверхности корпуса выполненное сквозным отверстие гнезда измерительной камеры, закрытое светонепроницаемой шторкой, закрепленной с возможностью мгновенного перекрытия сквозного отверстия. Технический результат - повышение точности за счет получения возможности сохранения начальной информации о мгновенно начинающихся реакциях. 2 з.п.ф-лы, 1 ил.

СПОСОБ ОПРЕДЕЛЕНИЯ КОНЦЕНТРАЦИИ АТОМОВ И МОЛЕКУЛ В ГАЗАХ И УСТРОЙСТВО ДЛЯ ЕГО ОСУЩЕСТВЛЕНИЯ

Использование: спектральный анализ. Сущность изобретения заключается в том, что способ определения абсолютных концентраций люминесцентно-активных атомов и (или) молекул в газах включает размещение неорганического люминофора в измерительной ячейке, заполнение ячейки исследуемым газом и регистрацию возбуждаемой гетерогенной хемилюминесценции люминесцентного датчика. В измерительную ячейку, заполненную исследуемым газом, вводят и направляют на люминофор реперный пучок люминесцентно-активного газа того же сорта (известной эталонной плотности). О концентрации атомов и молекул в исследуемом объеме судят по приращению интенсивности гетерогенной хемилюминесценции в момент открытия реперного пучка. Устройство для определения концентрации люминесцентноактивных атомов и/или молекул в газах содержит измерительную камеру (ячейку), в которой закреплен держатель люминофора, натекатель с вентилем для подачи исследуемого газа в измерительную камеру и фоторегистрирующую аппаратуру. В устройство введен канал ...

СПОСОБ ДИФФЕРЕНЦИАЛЬНОЙ ДИАГНОСТИКИ ХРОНИЧЕСКИХ ОБСТРУКТИВНЫХ ЗАБОЛЕВАНИЙ ЛЕГКИХ

Способ дифференциальной диагностики хронических обструктивных заболеваний легких путем исследования функциональной активности фагоцитирующих клеток, выделенных из бронхиального дерева, отличающийся тем, что для проведения тестирования с помощью метода люминолзависимой хемилюминесценции не проводят разделение фагоцитирующих клеток бронхиального смыва на отдельные популяции, а используют все фагоцитирующие клетки и при значениях максимума свечения спонтанной хемилюминесценции в диапазоне от 2731 до 6200 усл. ед. диагностируют бронхиальную астму, от 6201 усл ед. и выше - хронический обструктивный бронхит, значения до 2730 усл. ед. соотвествуют норме.

БИОЛЮМИНЕСЦЕНТНЫЙ СПОСОБ ОПРЕДЕЛЕНИЯ АНТИОКСИДАНТНОЙ АКТИВНОСТИ ВЕЩЕСТВА

... 1. Биолюминесцентный способ определения антиоксидантной активности вещества, включающий приготовление рабочей и контрольной биолюминесцентных проб, причем для приготовления контрольной пробы используют буферный раствор с добавлением оксиданта, а для приготовления рабочей пробы - буферный раствор с добавлением оксиданта и растворителя с исследуемым веществом и регистрацию интенсивности биолюминесценции проб, по которой судят об антиоксидантной активности, отличающийся тем, что одновременно определяют токсичность исследуемого вещества, а биолюминесцентная проба дополнительно содержит суспензию светящихся живых организмов, причем в качестве оксиданта используют озонированное растительное масло.2. Способ по п.1, отличающийся тем, что при приготовлении рабочей пробы растворителем является буферный раствор.3. Способ по п.1, отличающийся тем, что при приготовлении рабочей пробы растворителем является масло, а при приготовлении контрольной пробы добавляют масло в количестве равном растворителю.4 ...

СПОСОБ И СОСТАВ ДЛЯ ОБНАРУЖЕНИЯ СЛЕДОВ КРОВИ

... 1. Состав для обнаружения следов крови человека или животного, содержащий соединение люминола, окислитель и щелочь, растворенные в предпочтительно водном растворителе, отличающийся тем, что: - соединение люминола присутствует в количестве, соответствующем концентрации от 1 до 20 ммоль/л в конечном составе, - в качестве окислителя использована перекись водорода, которая присутствует в концентрации от 25 до 100 ммоль/л в конечном составе, - в качестве щелочи использована сода NaOH, которая присутствует в концентрации от 25 ммоль/л до 500 ммоль/л в конечном составе. 2. Состав по п.1, отличающийся тем, что соединение люминола выбрано из группы, содержащей люминол, диэтилизолюминол и аминобутилэтилизолюминол. 3. Состав по п.1, отличающийся тем, что сода NaOH присутствует в концентрации от 25 до 150 ммоль/л или приблизительно 90 ммоль/л в конечном составе. 4. Состав по п.2, отличающийся тем, что сода NaOH присутствует в концентрации от 25 до 150 ммоль/л или приблизительно 90 ммоль/л в конечном ...

Способ прогнозирования тяжести течения язвенной болезни 12-перстной кишки

Изобретение относится к медицине, в частности к гастроэнтерологии. Цель изобретения - повышение точности способа. Для этого из венозной крови пациента выделяют лейкоцитарную массу, определяют в ней количество фагоцитов. Массу разводят так, чтобы в 1 см было 106 фагоцитов. Затем к 0,3 мл взвеси фагоцитов добавляют 0,02 мл насыщенного водного раствора люминола с рН 7,35 и непрерывно измеряют хемилюми- нисценцию (ХЛ), после чего рассчитывают показатель хемилюминисценции фагоцитов (ПХЛФ) как отношение ХЛ к количеству фагоцитов в исследуемом объеме При увеличении ПХЛФ Б 3,64 раза и более относительно нормы прогнозируют тяжелое течение язвенной болезни 12-перстной кишки, т е наличие обострений чаще 2 раз в год или нерубцевание язвы в течение более 90 дней Точность способа составляет 73%.2табл Ё ...

Устройство для проведения хемилюминесцентных реакций

УСТРОЙСТВО ДЛЯ ПРОВЕДЕНИЯХЕМИЛНЯ'ШНЕСЦЕНТНЫХ РЕАКЦИЙ, содержащее реакционную кювету и приспособление для введения реагентов в кювету, установленное над ней, отличающееся тем, что, с целью повышения точности анализа, приспособление для введения реагентов в кювету выполнено в виде коаксиально расположенных концентрических цилиндров, имеющих разную длину, торцы которых, образующих выпуклое дно, обтянуты упругой мембраной, выполненной с возможностью ее разрушения при прокалывании.Предложенное техническое решение относится к фотохимии, преимуществен- •но к узлам научной аппаратуры для проведения жидкофазных хемилюминес- центных реакций, и может быть использовано для количественного анализа. Известно устройство для проведения жидкофазных реакций, используемое в хемилюминесцентной установке, содержащее реакционньй сосуд с установленными над ним дозаторами для введения реагентов и приводную механическую мешалку для их смешивания. Смешивание реагентов в этом устройстве сопровождается триболюминес ...

Хемилюминесцентный газоанализатор

Изобретение относится к газоаналитическому приборостроению. Целью является повышение точности. Газоанализатор содержит реакционную камеру, один из входов которой соединен с генератором ойона, и фотоэлектрический приемник, выход которого подсоединен к электронному усилителю с переключением поддиапазонов измерения, в котором первое положение соответствует поддиапазону с минимальной измеряемой концентрацией, а последнее - поддиапазону с максимальной измеряемой концентрацией окиси азота. Генератор озона снабжен устройством управления выходом озона, содержащим коммутатор , например переключатель, у Koto- рого первое положение соответствует минимальной, а последнее - максимальной концентрации выхода озона. При этом указанный переключатель расположен на одной оси с переключателем поддиапазонов. 1 ил. i (О ...

Способ определения нитрофлуоресцеина в аминофлуоресцеине

Способ анализа инертных газов на содержание азота

Хемилюминесцентный газоанализатор окислов азота

Хемилюминесцентный газоанализатор окислов азота состоит из последовательно coeflMHetfribfx газопровода пробы, первого блока профподготовки, реакционной камеры , внутри пЬсдедНей установлен фотоэлектронный приШнйк/ электрический выход кото р о r6.ri ос лед о гатёл ь н о сое д и не ч с ре гу: ли р у ём ы уси л ите л ем. В га з оа и а л и з а то р .введены: перек лю чатёль а; также газопровод разбавления, равньГй по диаметру газопроводу ;Пробы, соединяющий, выходы первого и ё то рогб блоков пробоподготовки, /с устанб в:лён ны м на нем электромагнитным клапаном и дросселем.. О бмотка электро магнитного клапана через контакт переключателя соединена с источ ником питания; Т ил. : :.. . . V; ; v.; . .; ;- ...

Способ определения степени деструкции мембран клеток свекловичной ткани

Использование: пищевая промышленность , в частности сахарная для оценки проницаемости свекловичной ткани, а также в других отраслях, где требуется оценка эффективности обработки растительного сырья. Из подготовленной для анализа пробы выделяют образец ткани, помещают его в кварцевую кювету, которую устанавливают в светозащищенную термостатированную камеру хемилюминометра, где измеряют среднее за выбранный период измерения значение интенсивности сверхслабого свечения (ССС) образца, аналогично определяют интенсивность ССС эталонной, полностью денатурированной ткани, а также интенсивность ССС нативной ткэни, определяют коэффициент степени дестр/кцип мембран клеток растительной ткани по формуле f Ь -lo . 2 ил. С ...

Способ определения висмута

Устройство для измерения люминесценции

Сущности в устройстве для регистрации хемилюминесценции связь между многоячеистым планшетом с образцом и фотопри- емником реализуется с помощью волоконно-оптического жгута, в котором световоды перемотаны случайным образом и собраны в один общий торец, сопряженный с фсюкэтодом фотоумножителя. 3 ил.

Способ количественного определения п-бензохинона

Изобретение относится к аналитической химии, в частности к количественному определению п-бензохинона. Цель - повышение чувствительности определения п-бензохинона. Определения ведут путем обработки анализируемой пробы пероксидом водорода в щелочной среде и дополнительной обработкой 4-диэтиламинофталгидразидом в присутствии этилендиминтетраацетата и сульфата ванадия. Процесс ведут с последующим измерением интенсивности люминисценции раствора. Способ позволяет повысить чувствительность определения в 18000 раз. 1 табл.

Способ хемилюминесцентного определения содержания азота в почвенных и растительных пробах

Изобретение относится к аналитике и позволяет определить содержание азота в почвенных и растительных пробах. Целью изобретения является увеличение достоверности хемилюминесцентного определения содержания азота в почвенных и растительных пробах путем обеспечения одинаковой степени превращения в окись азота азотсодержащих соединений разной структуры. Реализуется цель тем, что продукты деструкции пробы после зоны вторичного нагрева дополнительно пропускают через зону каталитического окисления-восстановления с температурой 750-850°С, причем эта зона располагается непосредственно после печи сожжения и вторичного нагревателя. 1 ил., 2 табл.

Способ измерения концентрации дефектов в твердом теле

Способ определения пероксида водорода и устройство для его осуществления

Изобретение относится к области физико-химического анализа путем хе- милюминесценции растворов. Целью является обеспечение максимальной ин- тенсивности свечения в зоне реакции. Дозирующее устройство содержит пере- ливные сосуды, блоки капиллярного дозирования индикатора и исследуемого раствора, закрытую смесительно-реак- ционную камеру и измерительную схему. Смесительно-реакционная камера на, , выходе снабжена дополнительным блоком капиллярного дозирования сливаемого .потока. Отношение диаметра переливных сосудов к длине капилляров и к высоте гидростатического столба индикатора и исследуемого раствора равно 1:(2-4):(15-25) соответственно и отношение внутреннего диаметра капилляров к их длине равно 1:(100-200). 2 с.п. ф-лы, 1 ил., 3 табл. i СЛ ...

Способ определения кислорода в водных растворах, помещенных в емкости

VERFAHREN ZUR BESTIMMUNG VON SCHWEFELDIOXID DURCH OXIDATION UND MESSUNG DER DABEI AUFTRETENDEN CHEMILUMINESZENZ

TESTSATZ UND VERFAHREN ZUR BESTIMMUNG VON PESTIZIDEN

Verfahren zum gleichzeitigen Durchführen von mehreren Assays

CHEMIILUMINESZENZ VON MEHRFACHPROBEN AUF EINER KONTINUIERLICHEN MATRIX

VORRICHTUNG UND VERFAHREN ZUR DURCHFÜHRUNG ELEKTROCHEMILUMINESZENTER MESSUNGEN.

Wächter für Ammoniak in einem Dosiersystem

Ein Ammoniak-Dosiersystem weist einen Behälter, dessen Inneres Ammoniak-Luminophore beinhaltet, und eine Zuführvorrichtung zum Zuführen von Ammoniak aus dem Behälterinneren in ein Abgasnachbehandlungssystem auf, um es mit Motorabgas, welches zu einem SCR-Katalysator zum katalytischen Umwandeln von NOx in dem Motorabgas strömt, mitzureißen.

Mobiles Microarray-Messgerät mit automatischer Reagenzienzufuhr und Chemilumineszenz-Ausleseeinheit

CHEMOLUMINESZENTE 3-(SUBSTITUIERTE ADAMANT-2'-YLIDENE)1,2-DIOXETANE

Akridinium-Verbindungen als chemilumineszierende Bezeichnungen.

VERFAHREN UND REAGENS ZUR BESTIMMUNG EINES OXIDIERTEN PYRIDIN-COENZYMS

Einschrittverfahren und Polynukleotidverbindungen zur Hybridisierung mit Ziel-Polynukleotiden

ANTI-VARICELLA-ZOSTER-VIRUS-ANTIKÖRPER, IMMUNLOGISCHES MESSVERFAHREN UND IMMUNOLOGISCHE MESSVORRICHTUNG

Ein Ziel der vorliegenden Erfindung besteht darin, ein Mittel zum raschen Diagnostizieren einer Infektion mit VZV bereitzustellen. Die vorliegende Erfindung betrifft einen Antikörper gegen VZVgE oder ein Antikörperfragment davon und ein immunologisches Messverfahren und eine immunologische Messvorrichtung unter Verwendung des Antikörpers oder des Antikörperfragments davon usw.

Vorrichtung zur Durchführung biochemischer Analysen und Verfahren zu ihrer Herstellung

Chemilumineszenzverfahren zur Erzeugung von Daten der biochemischen Analyse und Vorrichtung dazu

TRAEGER ZUR VERWENDUNG IN BIOLUMINESZENZ-BESTIMMUNGSVERFAHREN VON ENZYMEN, SUBSTRATEN ODER ENZYM-HEMMUNGSKOERPERN.

VORRICHTUNG UND VERFAHREN ZUR DURCHFÜHRUNG ELEKTROCHEMILUMINESZENTER MESSUNGEN.

VERFAHREN ZUR QUANTITATIVEN BESTIMMUNG VON STICKSTOFFVERBINDUNGEN IN GASGEMISCHEN

Temperature controlled measuring chamber for e.g. photometric examination of white blood cells of human being to diagnose cancer, has tubes whose lower openings are sealingly placed at each other in direct proximity to vessel bottom

The chamber has a hermetically closed measuring vessel (1) i.e. test tube, installed in an electrically heated block (2). The electrically heated block is made of metal i.e. aluminum. The vessel includes a round hemispherical and/or conical bottom, suction tubes (4, 6) and connecting tubes (5) introduced from top for filling and emptying the vessel. A space between the block and the vessel is filled with a thermally conductive transparent liquid (3). Lower openings of inlet and outlet tubes are sealingly placed at each other in direct proximity to the vessel bottom in a deepest point.

ANORDNUNG ZUM HOCHEMPFINDLICHEN NACHWEIS VON STICKOXID IN GASGEMISCHEN

Sensorsystem zur Charakterisierung des Zustandes von in einem Kultivierungsgefäß enthaltenen Proben einer heterogenen Biomassestruktur

Sensorsystem zur Charakterisierung des Zustandes von in einem Kultivierungsgefäß enthaltenen Proben einer heterogenen Biomassestruktur, wobei an einem an einem Kultivierungsgefäß (1) fluiddicht befestigbaren Adapter (4) mindestens eine monochromatische Lichtquelle (3) und ein optischer Detektor (5), der zur ortsaufgelösten Erfassung von elektromagnetischer Strahlung, die von Oberflächen der Probe (2) reflektiert wird, ausgebildet ist,oderein optischer Detektor (5), der zur ortsaufgelösten Erfassung von elektromagnetischer Strahlung, die von Oberflächen einer jeweiligen Probe (2) reflektiert wird, ausgebildet ist, am Adapter (4) befestigbar ist und mehrere Lichtquellen (8) an der Außenwand des Kultivierungsgefäßes (1) um eine im Kultivierungsgefäß (1) angeordnete Probe (2) angeordnet sind undder Detektor (5) an eine elektronische Auswerteeinheit (6) angeschlossen ist, die zur orts- und zeitaufgelösten Erfassung und Auswertung von vom Detektor (5) erfassten von Oberflächen der Probe (2)reflektierten ...

VERFAHREN ZUM NACHWEIS VON SUBSTANZEN

Verfahren und Vorrichtung zur Bestimmung des chemischen Sauerstoffbedarfs mit thermischem Probenaufschluss

Verfahren zur Bestimmung des chemischen Sauerstoffbedarfs, CSB, einer Wasserprobe durch thermische Oxydation der Wasserprobe in einem geschlossenen Reaktionsgefäß in einem Trägergas mit vorbestimmtem Sauerstoffgehalt und anschließende Detektion des Sauerstoffgehaltes im Abgas des Reaktionsgefäßes und Berechnung des CSB-Wertes aus dem detektierten Sauerstoffgehalt, dadurch gekennzeichnet, dass der Gehalt an Sulfaten und/oder Nitraten in der Wasserprobe durch jeweils einen dedizierten Detektor erfasst und eine rechnerische Korrektur des aufgrund des Sauerstoffgehaltes berechneten CSB-Wertes mittels eines vorbestimmten Korrekturalgoritmus aufgrund des detektierten Sulfat- und/oder Nitratgehaltswertes ausgeführt wird.

Verwendung derivatisierter Reagenzien in Chemilumineszenz- und Elektrochemilumineszenz-Nachweisverfahren

METHOD AND REAGENT FOR THE DETERMINATION OF AN OXIDIZED PYRIDINE COENZYME

TESTVERFAHREN ZUM NACHWEISS VON LIPOPROTEINEN

VERFAHREN ZUR ANALYSE VON AMINOSAEUREN.

OPTISCH UND FLUIDISCH VERBESSERTE IN-VITRO-DIAGNOSE-PRÜFKAMMER

VERFAHREN ZUR STEIGERUNG DER QUANTEN-AUSBEUTE BEI DER OXIDATION VON LUMINOL DURCH PEROXIDE IN GEGENWART VON PEROXIDASE

ZWEIRICHTUNGS-DURCHFLUSS-ZENTRIFUGALMIKROFLUID-VORRICHTUNGEN

LUMINESZENZ- ODER LUMINOMETRISCHER ASSAY

Energieübertragungsfarbstoffe mit verbesserter Fluoreszenz

Strahlungsmessgerät, insbesondere zur Messung der Lumineszenz

Ein Strahlungsmessgerät, insbesondere zur Messung der Lumineszenz, beinhaltet einen Detektor zur Erfassung der Strahlung von auf einer Aufnahmeplatte unter dem Detektor angeordneten Probenbehältern und Verschiebeeinrichtungen zur sukzessiven, automatischen gegenseitigen Zuordnung jeweils eines der Probenbehälter und der Eintrittsblende des Detektors, derart, dass in der Messposition der jeweilige Probenbehälter und die Eintrittsblende des Detektors nach außen lichtdicht zueinander liegen. In einer über den Probenbehälter (12, 13) angeordneten Führung (26A, 26B) befindet sich ein vertikal verschiebbares Dichtelement (50A, 50B), dessen unterer Rand in der Messposition ausschließlich eine der Austrittsöffnungen (12A, 13A) eines Probenbehälters (12, 13) zumindest nahezu vollständig überdeckt, und das einen Durchgangskanal (51A, 51B) zum Durchtritt der Strahlung in der Messposition von der Austrittsöffnung (12A, 13A) eines Probenbehälters (12, 13) zur Eintrittsblende (41) des Detektors (40) ...

Gerät unter Verwendung verschiedener optischer Messverfahren

SYSTEM ZUR DIAGNOSE VON REAGENZLÖSUNGSQUALITÄT UND ABGASKATALYSATORDEGENERATION

Method for marking liquids and compounds for use in said method

IMMUNOASSAY

DETECTION AND IMAGING IN BIOCHEMICAL ASSAYS USING PHOSPHOR SCREENS

MODIFIED PROTEINS

MONITORING OF CHEMICAL ADDITIVES

Detection of sulphur containing compounds

METHOD AND APPARATUS FOR CHEMILUMINESCENCE ANALYSIS

Improvements relating to information technology

LIGHT PHOTON DETECTING APPARATUS

DETECTING OR QUANTIFYING MULTIPLE ANALYTES

A method for the assay, detection etc. of each of a plurality of substances of interest in a sample comprises labelling each of the substances with one or more components each capable of taking part in a respective distinguishable chemiluminescent reaction. Luminescent reagents for use in the method are also disclosed.

Method of enhancing luciferase luminescence

A method for enhancing luminescence of a luciferase with fluorescence activity that contains an apoprotein in which a coelenteramide or analog thereof is coordinated comprising adding to a solution of the luciferase a coelenterazine that is a luminescent substrate of the luciferase or an analog thereof and a compound having the function of removing an -NH- proton of the pyrazine ring of the imidazopyrazine skeleton in the colenterazine or analog thereof. The compound having the proton removing function is imidazole and the luciferase is selected from apoaquorin, apoclytin, apoobelin, apomitrocomin, apomineopsin or apobevoin. Use of a compound such as imidazole in preparing a coelentrazine and kits are also claimed. The invention is alternatively claimed as method for enhancing luminescence of a BFP-aq that contains an apoaequorin with a coordinated coelenteramide comprising adding hcp-coelentrazine and imidazole to a solution of BFP-aq.

Method for enhancing activity of luciferase with fluorescence activity

Improvements in or relating to aqueous sample testing apparatus

A toxicity sensor for measuring the toxicity of aqueous samples, which samples include a predetermined concentration of a bacterium which normally exhibits bioluminescence, includes a detector cell comprising a translucent tube through which aqueous samples are fed, a light source, a source light detector positioned to receive light from the source which light has passed through the tube containing an aqueous sample the toxicity of which is to be measured, and a further light detector positioned and arranged to receive light from the sample generated by the bioluminescence of bacteria included therein.

Bioluminescence monitor

PHOTOMETRIC MEASUREMENT OF LIQUIDS

ELECTROGENERATED LUMINESCENCE IN SOLUTION

Method of testing an organic sample

Method, applications thereof and apparatus for analysis or measurement of a succession of samples by photometric measurement at the time of a reactin

A method for photometrically measuring a reaction process at a darkened measuring station which contains a sample having an unknown quantity of a substance which acts as a reaction partner with a reagent. The sample is provided with a first reagent which acts as a reaction partner with a reaction partner present in the sample. A first photometric measurement of the sample is taken at the darkened measuring station to measure the reaction process between the first reagent and the reaction partner in the sample, and this first measurement is used for computation. At least one additional reagent which differs from the first reagent and which constitutes a further reaction partner is added to the sample at the darkened measuring station after the first photometric measurement. A photometric measurement of the sample is conducted after the addition of each additional reagent and during the course of a reaction between reaction partners then present. The unknown quantity of the substance in the ...

Toxicity measurement

Toxicity measurement

A device for measuring toxicity in solids or liquids, eg soil or water samples, includes one or more modular inspection trays (14) having an array of cells (15), each with a transparent base, for holding bioluminescent bacteria and to receive pollutants separated from the samples. Soil samples are placed in the cells of a feed tray having an array of cells, each cell having a porous base and being complementary to an inspection cell. Air pressure is applied to the feed cells to force soil extracts into the cells (15) of the inspection tray (14). The level of bioluminescence is detected by inserting an inspection tray into a measuring zone (31) having an optoelectronic unit including an array (24) of light sensors (36) arranged in a configuration complementary to the inspection cells (15). Before measurement, the inspection trays (14) may be incubated in a zone (41) using a heater (43).

ELECTROCHEMILUMINESCENT IMMUNOASSAY

Detection apparatus liquid chromatography

A detection apparatus of a simple construction is formed from an electro-chemiluminescence cell (12) having connections for the supply and the discharge of a liquid to be examined, particularly a mobile phase coming from the separation column of a liquid chromatograph, a voltage source (11) and a detector (14) for electric current, which are connected to the electrodes (1, 2) of the cell (12). Preferably a radiation-sensitive element (13) is also provided.

Method for detection of vitamin D metabolites

METHOD FOR INDICATING AN ASSAY OF THE BACTERIO-LOGICAL CONTENT OF A SAMPLE FLUID

... 1315467 Investigating micro-organic matter AEROJET-GENERAL CORP 19 April 1971 [20 May 1970] 26551/71 Heading G1A In a method of determining the bacteriological content of a sample fluid a stream of the sample fluid is passed with a stream of a chemical reagent (luminol and hydrogen peroxide) into a sample cell and the resulting light (formed by chemi-luminescence) is measured photo-electrically and integrated. In an apparatus the sample fluid and the reagent from containers 11 and 13 respectively are drawn by a vacuum source 23 into a sample cell 10 and thence via valve 16 and liquid trap 20 into a waste unit 25. The cell 10 is within a light tight housing 26 and the light produced by chemiluminescence is sensed by a photo-multiplier 27 whose output is integrated by integration circuit 32 and fed to a readout device 34. The enhance sensitivity the integration and readout operations are effected before during and following fluid-flow through cell 10 by means of a motor 37 actuating cam switches ...

Nitrogen monoxide detector

Light imaging apparatus, system and method

The imaging apparatus comprises a light-tight enclosure in which are enclosed: a detector adapted to detect a light signal emitted from a sample, a reflecting device comprising first and second reflecting portions reflecting toward first and second portions of the detector a signal emitted from first and second portions of the sample, the second reflecting portion reflecting toward a third portion of the detector a signal emitted from a the third portion of the sample and previously reflected by the first reflecting portion, a fourth portion of the detector directly detecting a signal emitted from a fourth portion of the sample.

Устройство для измерения хемилюминесценции и биолюминесценции

Полезная модель относится к устройствам для количественного измерения интенсивности свечения, возникающего в ходе протекания химических реакций (хемилюминесценции) или генерируемого биологическими объектами в процессе их жизнедеятельности (биолюминесценции). В частности, полезная модель предназначена для измерения слабых свечении жидких сред, содержащих компоненты ферментных систем, тканевые гомогенаты или клеточные суспензии и может быть использована в лабораториях биологического, медицинского и санитарно-гигиенического профиля. Сущностью полезной модели является оценка интенсивности хемилюминесценции или биолюминесценции одновременно в двух (контрольной и опытной) пробах, содержащих идентичные компоненты для реакции генерации свечения, но отличающихся по наличию определяемого (действующего) компонента. Предлагаемое для этого техническое решение заключается в помещении контрольной и опытной проб в единое кюветное отделение, обеспечивающее идентичный режим их термостатирования и перемешивания, но содержащее две отдельные темновые камеры, каждая из которых сопряжена с отдельным регистратором (фотоэлектронным умножителем) со своей системой регистрации импульсов, сигнал с которой передается на единую схему сопряжения, позволяющую ввести данные в компьютер и провести расчет абсолютной и относительной разницы интенсивности свечения в сравниваемых пробах. Достигаемый технический результат заключается в повышении точности измерения, сокращении времени проведения исследования, а также создании возможности для кинетического анализа хемилюминесценции и биолюминесценции. ÐÎÑÑÈÉÑÊÀß ÔÅÄÅÐÀÖÈß (19) RU (51) ÌÏÊ 7 (11) 49 998 (13) U1 G 01 N 21/76 ÔÅÄÅÐÀËÜÍÀß ÑËÓÆÁÀ ÏÎ ÈÍÒÅËËÅÊÒÓÀËÜÍÎÉ ÑÎÁÑÒÂÅÍÍÎÑÒÈ, ÏÀÒÅÍÒÀÌ È ÒÎÂÀÐÍÛÌ ÇÍÀÊÀÌ (12) ÎÏÈÑÀÍÈÅ ÏÎËÅÇÍÎÉ ÌÎÄÅËÈ Ê ÏÀÒÅÍÒÓ(òèòóëüíûé ëèñò) (21), (22) Çà âêà: 2005114680/22, 13.05.2005 (24) Äàòà íà÷àëà äåéñòâè ïàòåíòà: 13.05.2005 (45) Îïóáëèêîâàíî: 10.12.2005 Áþë. ¹ 34 (73) Ïàòåíòîîáëàäàòåëü(ëè): Àâòîíîìíà íåêîììåð÷åñêà îðãàíèçàöè "Öåíòð ...

Sensor for fast detection of e-coli

A method of fabricating biochip sensor comprising providing a precursor; depositing the precursor on a substrate to form a coating; and rapid melting/quenching treatment of the coating with an energy source to form micro/nanotextured surface with enhanced reflectance for fast chemiluminescence response of E - Coli bacteria.

Silica Nanoparticles Incorporating Chemiluminescent And Absorbing Active Molecules

Nanoparticles incorporating absorbing materials, e.g., an absorber dye, which under appropriate conditions exhibit chemiluminescence. The nanoparticles can be mesoporous silica nanoparticles or core-shell silica nanoparticles. The nanoparticles can be used as sensors to detect an analyte.

PROCESS FOR PRODUCING SUPRAMOLECULAR FIBER

A method for preparing a linearly extended supramolecular fiber or a plurality of linearly aligned supramolecular fibers, which comprises the step of allowing supramolecular monomers to be self-assembled in a microfluidic channel. 1. A method for preparing a linear supramolecular fiber , which comprises allowing supramolecular monomers to be self-assembled in a microfluidic channel.2. A method for preparing a bundle of fibers comprising a plurality of linearly aligned supramolecular fibers , which comprises allowing supramolecular monomers to be self-assembled in a microfluidic channel.3. A method for preparing a gel fiber comprising a linear supramolecular fiber covered with hydrogel , which comprises covering a linear supramolecular fiber , which is obtainable by allowing supramolecular monomers to be self-assembled in a microfluidic channel , with hydrogel in the microfluidic channel.4. A method for preparing a gel fiber comprising a bundle of fibers comprising a plurality of linearly aligned supramolecular fibers covered with hydrogel , which comprises covering a bundle of fibers comprising a plurality of linearly aligned supramolecular fibers , which is obtainable by allowing supramolecular monomers to be self-assembled in a microfluidic channel , with hydrogel in the microfluidic channel.5. A linear supramolecular fiber obtainable by the method according to .6. A bundle of fibers comprising a plurality of linearly aligned supramolecular fibers obtainable by the method according to .7. A gel fiber comprising a linear supramolecular fiber covered with hydrogel or a gel fiber comprising a bundle of fibers comprising a plurality of linearly aligned supramolecular fibers covered with hydrogel claim 2 , which comprises the step of covering a bundle of fibers comprising a plurality of linearly aligned supramolecular fibers.8. A method for preparing a linear organic polymer claim 2 , which comprises the following:(a) preparing a linear supramolecular fiber or a bundle ...

Homogeneous Chemiluminescence Assay Methods with Increased Sensitivity

Methods are disclosed for determining an analyte in a medium suspected of containing the analyte. One method comprises treating a medium suspected of containing an analyte under conditions such that the analyte, if present, causes a photosensitizer and a chemiluminescent compound to come into close proximity. The photosensitizer generates singlet oxygen and activates the chemiluminescent compound when it is in close proximity. Non-specific signal generated by singlet oxygen not in proximity is reduced or suppressed using a singlet oxygen quencher (SOQ). The activated chemiluminescent compound subsequently produces light. The amount of light produced is related to the amount of analyte in the medium. Use of Noise Modulation Agents significantly improves signal-to-noise ratios and assay sensitivity. Compositions and kits are also disclosed. 111-. (canceled)12. A method for determining the presence of an analyte in a sample suspected of containing said analyte , the method comprising:a) forming a reaction mixture comprising the sample, a first substance that can produce a metastable species, and a second substance that can react with the metastable species to produce a detectable signal, by combining at least the sample and the first and second substances;b) treating the reaction mixture with energy or a reactive compound to cause the first substance to form a metastable species,wherein the analyte, if present, either i) brings the second substance into close proximity to the site of formation of the metastable species, or ii) blocks the second substance from coming into close proximity of the site of formation of the metastable species;c) adding a selective signal inhibiting agent that interferes with the reaction of any metastable species not in close proximity to the second substance; andd) determining whether the metastable species has reacted with the second substance by detecting a signal produced by the second substance as a result of activation of the second ...

3,5,3'-Triiodothyronine Sulfate As Thyromimetic Agent And Pharmaceutical Formulations Thereof

The invention regards the use of triiodothyronine sulfate, commonly named TS, as a medicament having thyromimetic activity for the treatment of pathologies due to organic deficiency of triiodothyronine (T), as such or in association with thyroxine (T), and pharmaceutical formulations for oral administration thereof. 115-. (canceled)16. A non radioactive immunoassay for TS quantitation comprising a non radioactive TS-conjugate.17. The immunoassay of wherein the non radioactive conjugate is TS-biotin.18. The immunoassay of wherein the immunoassay is a competitive ELISA.20. The immunoassay of comprising a DELFIA® assay.21. A kit comprising a container for a non radioactive immunoassay according to and a container for a solid oral dosage composition comprising TS as the active principle claim 16 , in a quantity ranging from 1 to 1000 μg and further comprising diluents claim 16 , glidants or lubricants and disintegrants.2227-. (canceled) This application is a continuation-in-part (CIP) of U.S. Ser. No. 10/532,447 filed Apr. 22, 2005, which is a U.S. national phase application of PCT/EP2003/12584 filed Nov. 11, 2003, which in turn claims priority from MI2002A002394 IT filed Nov. 13, 2002, the contents of each of which are incorporated herein by reference in their entireties.The present invention regards the use of 3,5,3′-triiodothyronine sulfate, usually named triiodothyronine sulfate or Tsulfate (TS), as an active principle, alone or in combination with thyroxine, in the treatment of pathologies due to organic deficiency of 3,5,3′-triiodothyronine. Accordingly, the same is usable for the preparation of thyromimetic pharmaceutical compositions.A number of iodothyronines are present in blood, which are directly produced by thyroid gland or are the result of peripheral metabolism of other iodothyronines. Among them, 3,5,3′-triiodothyronine (acronym T) is deemed to be the biological active form of thyroid hormone (TH), because it has shown high affinity for the specific ...

Optical detection system, a cartridge therefor and a reader therefor

A optical detection system for used as a bio sensor is disclosed, comprising a card or cartridge and a reader. The cartridge comprises at least a detection chamber and an optical detector, and the reader includes means to urge a fluid into the detection chamber to initiate the analysis. The optical coupling may be enhanced by including optical elements in the card; conversely the system may be simplified by reducing or eliminating the number of moving parts in the card. 1. A card for use in an optical detection system for detecting biomolecules ,the card comprising: a plastics encapsulant material forming both a substrate and a superstrate:a stacked arrangement of a sample volume and an optical detector,the sample volume being for containing, in use, an analyte;the card further comprising at least one reservoir for containing an analyte precursorand configured such that, in use, the analyte precursor can be urged towards the sample volume by an actuator external to the card wherein the sample volume and the at least one reservoir are embedded in the plastics encapsulant material.2. A card as claimed in claim 1 , wherein the stacked arrangement further comprises an optical filter between the sample volume and the optical detector.3. A card as claimed in claim 1 , wherein the stacked arrangement further comprises a light source claim 1 , and the sample volume is between the light source and the optical detector.4. A card as claimed in claim 3 , wherein the stacked arrangement further comprises an optical filter between the light source and the sample volume.51. A card as claimed claim 3 , wherein at least one of the light source is a light emitting diode and the optical detector is a photodiode.6. A card as claimed in claim 1 , wherein the stacked arrangement further comprises a cooling element.7. A card as claimed in claim 1 , wherein the stacked arrangement further comprises a heating element.8. A card as claimed in claim 1 , wherein the stacked arrangement further ...

LUMINESCENT NANOSTRUCTURED MATERIALS FOR USE IN ELECTROGENERATED CHEMILUMINESCENCE

A nanostructured particulate material, which includes a redox active luminescent organic and/or ionic compound, is provided herein. The nanostructured particulate material may be used for determining the presence of an analyte of interest in a sample by detecting the emitted electromagnetic radiation generated by exposing a reagent mixture, which includes the nanostructured material and the target analyte, to chemical or electrochemical energy. 1. Nanostructured particulates formed from a redox active , ionic luminescent compound; wherein the nanostructured particulates have a least one dimension which is no larger than about 250 nm.2. The nanostructured particulates of claim 1 , wherein the redox active claim 1 , ionic luminescent compound comprises a heteroaromatic polydendate metal complex.3. The nanostructured particulates of claim 2 , wherein the heteroaromatic polydendate metal complex comprises at least one long chain alkyl substituted bipyridyl ligand.4. The nanostructured particulates of claim 2 , wherein the heteroaromatic polydendate metal complex comprises a long chain alkyl substituted Ru(bpy) complex.5. The nanostructured particulates of claim 2 , wherein the heteroaromatic polydendate metal complex comprises a ruthenium claim 2 , osmium claim 2 , rhenium claim 2 , cerium claim 2 , europium claim 2 , terbium claim 2 , and/or ytterbium ion.6. The nanostructured particulates of claim 2 , wherein the heteroaromatic polydendate metal complex is a luminescent claim 2 , heteroaromatic polydendate ruthenium complex.7. The nanostructured particulates of claim 1 , wherein the nanostructured particulates comprise luminescent nanobelts formed from a luminescent polydendate metal complex claim 1 , which includes at least one long chain alkyl substituted bipyridine ligand.8. The nanostructured particulates of claim 7 , wherein the luminescent nanobelts are formed from a luminescent claim 7 , heteroaromatic polydendate ruthenium complex.9. The nanostructured ...

CHEMILUMINESCENT SYSTEM

A chemiluminescent system includes a substrate comprising a solid chemiluminescent oxalate and a solution comprising an oxygen-providing compound. The chemiluminescent system provides improved light-output characteristics. 1. A chemiluminescent system , comprising:a substrate including a solid reduced hydrolysis oxalate;at least one applicator, wherein each of the at least one applicator contains an oxidizer solution including an oxygen-providing compound and a solvent;wherein at least one of the substrate and the oxidizer solution includes at least one fluorescer compound; andwherein when the oxidizer solution is applied on the substrate using the applicator, a glow-in-the dark marking is provided.2. The chemiluminescent system of claim 1 , wherein the solid reduced hydrolysis oxalate is bis{3 claim 1 ,4 claim 1 ,6-trichloro-2-[(3-methylbutoxy)carbonyl]phenyl} oxalate (CIPO).3. The chemiluminescent system of or claim 1 , wherein solid reduced hydrolysis oxalate is embedded in the substrate.4. The chemiluminescent system of claim 3 , wherein the substrate is a paper and the solid reduced hydrolysis oxalate is mixed in with a pulp during a paper making process.5. The chemiluminescent system of or claim 3 , wherein the solid reduced hydrolysis oxalate is applied on the substrate as a layer.65. The chemiluminescent system of any of - claims 1 , wherein the oxygen-providing compound is hydrogen peroxide.76. The chemiluminescent system of any of - claims 1 , wherein the oxidizer solution further includes a stabilizer for the oxygen-providing compound.87. The chemiluminescent system of any of - claims 1 , wherein the stabilizer is tertiarybutyl alcohol.98. The chemiluminescent system of any of - claims 1 , wherein the solvent is triethyl citrate.109. The chemiluminescent system of any of - claims 1 , wherein the oxidizer solution includes a second solvent claims 1 , which functions as a solvent for the solid reduced hydrolysis oxalate.1110. The chemiluminescent system of ...

LUMINESCENCE METHOD OF DETECTING AN ANALYTE IN A LIQUID SAMPLE AND ANALYSIS SYSTEM

The present disclosure relates to a luminescence method of detecting an analyte in a liquid sample comprising marking the analyte with a marker capable of effecting luminescence upon application of excitation energy, wherein reference data descriptive of the luminescence decay is stored in an electronic memory; applying the excitation energy for causing the luminescence; time-resolved measuring of the luminescence over a period of time for acquisition of a measurement signal; reading the reference data from the electronic memory; comparing the measurement signal with the luminescence decay described by the reference data; generating an output signal indicative of the presence of the analyte in the liquid sample using the measurement signal; in case of a mismatch of the measurement signal and the luminescence decay described by the reference data, generating an error signal. 1. A luminescence method of detecting an analyte in a liquid sample , the method comprisinga) marking the analyte with a marker capable of effecting luminescence upon application of excitation energy, wherein reference data being descriptive of the luminescence decay of the luminescence to be effected by the marker is stored in an electronic memory,b) applying the excitation energy for causing the luminescence,c) time-resolved measuring of the luminescence over a period of time for acquisition of a measurement signal,d) reading the reference data from the electronic memory,e) comparing the measurement signal with the luminescence decay described by the reference data,f) generating an output signal being indicative of the presence of the analyte in the liquid sample using the measurement signal,g) in case of a mismatch of the measurement signal and the luminescence decay described by the reference data, generating an error signal.2. The luminescence method of claim 1 , the reference data being descriptive of a linear law relating the maximum amplitude of the luminescence to a luminescence level ...

SPLIT SENSOR AND HOUSING ASSEMBLY FOR FLEXIBLE WALL

Disclosed is a sensor and housing assembly for a single-use bioreactor system, including a device for operatively associating a sensor with a flexible wall, the device comprising an internal housing portion that is removable and variably positionable on an internal surface of the flexible wall, the internal housing portion comprising a chemical detector sensor, which may be an optical chemical detector sensor. 1100. A sensor and housing assembly for a single-use bioreactor system , comprising a device for operatively associating a sensor with a flexible wall , the device comprising:{'b': 130', '112', '130, 'claim-text': [{'b': '132', 'an internal portion of a chemical detector sensor sealably embedded in a detector sensor housing , and'}, {'b': 136', '138', '130', '130', '112, 'at least one portion of an internal magnetic material , positioned within the internal housing portion for variably positioning and removing the internal housing portion on the internal surface of the flexible wall ; and'}], 'an internal housing portion removable and variably positionable on an internal surface of the flexible wall , the internal housing portion comprising{'b': 140', '110', '114', '140, 'claim-text': [{'b': '142', 'an external portion of an activator sensor sealably embedded in an activator sensor housing ; and'}, {'b': 146', '148', '140', '132', '142', '130', '112', '146', '148', '136', '138', '130, 'at least one portion of an external magnetic material , positioned within the external housing portion or adjacent thereto for holding the detector sensor proximate and aligned to activator sensor , and for variably positioning the internal housing portion on the internal surface of the flexible wall by magnetic interaction between the at least one portion of the external magnetic material , and the at least one portion of the internal magnetic material , within the internal housing portion .'}], 'an external housing portion positioned on an external surface of a support ...

MODULAR ASSAY PLATES, READER SYSTEMS AND METHODS FOR TEST MEASUREMENTS

Luminescence test measurements are conducted using an assay module having integrated electrodes with a reader apparatus adapted to receive assay modules, induce luminescence, preferably electrode induced luminescence, in the wells or assay regions of the assay modules and measure the induced luminescence. 1. A method for carrying out an electrode induced luminescence assay comprising:(a) introducing one or more samples into one or more wells of a multi-well plate comprising: (i) one or more multi-well assay modules, each having an array of wells with integrated electrodes; and (ii) a plate frame defining one or more apertures for receiving and holding said multi-well assay modules; and(b) applying an electrical potential to said electrodes and measuring luminescence produced in said wells.2. A method for carrying out an electrode induced luminescence assay comprising:(a) introducing one or more samples into one or more wells of one or more assay modules having arrays of wells with integrated electrodes;(b) inserting said assay modules into a plate frame that defines one or more apertures for receiving and holding said multi-well assay modules; and(c) applying an electrical potential to said electrodes and measuring luminescence produced in said wells.3. The method of claim 1 , wherein said one or more samples are introduced into a plurality of said assay modules and said step of applying electrical potential and measuring luminescence is conducted sequentially on each of said assay modules. This application is a continuation application of U.S. patent application Ser. No. 13/159,991 filed on Jun. 14, 2011 which is a divisional application of U.S. patent application Ser. No. 10/980,198 filed Nov. 3, 2004, now U.S. Pat. No. 7,981,362, which claims priority to U.S. Provisional Application No. 60/517,606 filed Nov. 4, 2003, the entire content of which is incorporated herein by reference.This application relates to plates, plate components, kits, apparatuses and methods ...

USE OF SIGNAL ENHANCING COMPOUNDS IN ELECTROCHEMILUMINESCENCE DETECTION

The application provides methods for the detection of an analyte in a sample by electrochemiluminescence using certain reagent compositions. Reagent compositions, reagent kits for measuring electrochemiluminescence (ECL) and electrochemiluminescence detection methods using the reagent compositions are disclosed. In particular, the application relates to the use of novel combinations of compounds, which can be used in said measurements to provide improved ECL assay performance. 2. The method according to claim 1 , wherein the measurement of the analyte in the sample using ECL is performed in an aqueous solution.3. The method according to claim 1 , wherein the at least one carbonic acid amide comprises acetamide claim 1 , 2-fluoroacetamide claim 1 , 2-chloroacteamide claim 1 , propanamide claim 1 , 2-chloropropanamide claim 1 , 3-chloropropanamide claim 1 , butanamide claim 1 , 2-chlorobutanamide or a mixture thereof.4. The method according to claim 1 , wherein the reagent composition comprises the at least one carbonic acid amide in a concentration of 0.01 M to 0.25 M.5. The method according to claim 1 , wherein the reagent composition further comprises a preservative.6. The method according to claim 5 , wherein the reagent composition comprises 0.1% to 5% of the preservative.7. The method according to claim 5 , wherein the preservative comprises boric acid claim 5 , borate or a mixture thereof.8. The method according to claim 1 , wherein the at least one ECL coreactant comprises a compound selected from the group consisting of tertiary amines claim 1 , oxalate and persulfate.9. The method according to claim 1 , further comprising as a step (e) determining the electrochemiluminescence (ECL) signal thereby measuring the analyte.11. The reagent composition according to claim 10 , further comprising a preservative selected from the group consisting of boric acid claim 10 , borate and mixtures thereof.12. A reagent mixture for determining ECL comprising the reagent ...

LUMINESCENCE BASED SENSOR

A sensor comprising a substrate () having a first surface () and a second surface () is described. The first surface has at least one sensor site () provided thereon. The substrate is configured such that on excitation of a sample provided at the sensor site, luminescence originating from the sensor site propagates into the substrate, the second surface of the substrate being configured to selectively transmit the luminescence propagating within the substrates at angles greater than the critical angle out of the substrate where it may be detected by a detector () provided below the substrate. 1. A sensor comprisinga detector;a substrate arranged above the detector, the substrate having a first surface and a second surface parallel to the first surface and having a ring optical element formed therein, the first surface having at least one sensor site provided thereon, the substrate configured such that on excitation of a sample provided at the sensor site, luminescence originating from the sensor site propagates into the substrate, the ring optical element formed in the second surface of the substrate configured to selectively transmit the luminescence propagating within the substrate at angles greater than the critical angle out of the substrate;a reflective optical element co-operatively arranged with the substrate to provide for redirection of the transmitted light towards the detector—where the transmitted light is detected.2. The sensor of comprising a conical mirror and focusing lens co-operable with the ring optical element to operably refocus light originating from the substrate toward the detector.3. The sensor of wherein the second surface is configured to effect a transmission of the luminescence propagating within the substrates at angles greater than the critical angle out of the substrate through a refraction process.4. The sensor of wherein the ring optical element is provided as a ring lens providing a redirection of the luminescence propagating ...

WIDE RANGE LUMINESCENT IMMUNOASSAYS

The present invention relates to a method for quantitating an analyte having a wide range concentration in a single assay without having to dilute the sample and repeating the assay. The key feature of the invention is having two cycles of events including sample binding to probe, binding reactions, and detection. After the first cycle of binding and detecting, the probe is dipped into the same sample vessel to bind additional analyte in the sample vessel at a condition that is more favorable to binding than the condition in the first cycle. 1. A method of detecting an analyte in a wide concentration range in a liquid sample , comprising the steps in the order of:(a) obtaining a probe having a first antibody immobilized on the tip of the probe, wherein the diameter of the tip surface is ≦5 mm;(b) dipping the probe tip into a sample vessel containing a sample solution having an analyte for 10 seconds to 2 minutes and flowing the sample solution laterally in the sample vessel at 0-500 rpm, to bind the analyte to the first antibody on the probe tip;(c) dipping the probe tip into a reagent vessel containing a reagent solution comprising a reagent of a second antibody conjugated with a first member of a binding pair to bind the reagent to the analyte;(d) dipping the probe tip into a first washing vessel containing a first wash solution to wash the probe tip;(e) dipping the probe tip into an amplification vessel containing an amplification solution comprising a second member of the binding pair conjugated with one or more luminescent labels, to form an immunocomplex of the analyte, the first antibody, the second antibody, and the first and the second members of the binding pair on the probe tip;(f) dipping the probe tip into a second washing vessel containing a second wash solution to wash the probe tip;(g) obtaining a first result by measuring the luminescent signal of the immunocomplex formed on the probe tip;(h) dipping the probe tip into the same sample vessel for 1- ...

LUMINOMETER AND METHODS OF OPERATION

The present invention is directed to a luminometer and methods which provides simple and effective measurement of a plurality of wells in a plurality of strips in an automatic fashion. The luminometer may be used in CLIA (Chemi Luminescent Immuno Assays). The luminometer allows for CLIA micro strip reading, and reads break-apart wells, with a plurality of wells per strip, and calculates results instantly and automatically. The luminometer has an automatic carrier positioning system which selectively positions the plurality of wells in the plurality of strips at a measuring position, wherein the drive system associated with the positioning system drives the carrier along a single axis of movement. An optical track system automatically provides Y axis movement of the carrier. The luminometer may have a calibration system for maintaining proper operation of the system in measurements therewith. 1. A luminometer comprising ,a photon measuring detection system,a calibration system including a reference light source, and a light detector positioned to measure the light emitted from the reference light source, whereby a reference light signal is produced by the detection system which is thereafter comparable to the light subsequently detected from the same reference light source so as to allow generation of a calibration factor for any detected errors between a current measurement of the reference light source and the reference light signal.2. The luminometer of claim 1 , further comprising a diffuser claim 1 , with the reference light source positioned to emit light into the diffuser claim 1 , and the light detector measures the light emitted from the diffuser.3. The luminometer of claim 1 , wherein the reference light is controlled by an isolated circuit that emits a predetermined light along a predetermined axis claim 1 , which can then be detected via the detection system.4. The luminometer of claim 1 , wherein the reference light source emits light at a predetermined ...

MEASUREMENT DEVICE AND MEASUREMENT METHOD

A measurement device that includes a plurality of lines for conveying a reaction container containing a sample and measures a predetermined material included in the sample while conveying the reaction container by the plurality of lines, wherein the plurality of lines include: a first reaction line for conveying a reaction container at a first convey speed; a second reaction line for conveying a reaction container at a second convey speed; and a measurement line for measuring a predetermined material included in a sample reacted with a reagent within the reaction container in the first reaction line and a sample reacted with a reagent within the reaction container in the second reaction line, the measurement line conveying the reaction containers at a third convey speed that is higher than the first convey speed and the second convey speed. 1. A measurement device that comprises a plurality of lines for conveying a reaction container containing a sample and measures a predetermined material included in the sample while conveying the reaction container by the plurality of lines ,wherein the plurality of lines include:a reaction line for reacting the sample with a reagent within the reaction container, the reaction line conveying the reaction container at a predetermined convey speed; anda measurement line for measuring the predetermined material included in the sample reacted with the reagent within the reaction container in the reaction line, the measurement line conveying the reaction container conveyed from the reaction line at a predetermined convey speed that is higher than the convey speed.2. The measurement device according to claim 1 ,wherein the reaction line comprises:a first reaction line for conveying the reaction container at a first convey speed; anda second reaction line for conveying the reaction container at a second convey speed, andwherein the measurement line isa measurement line for measuring the predetermined material included in the sample ...

METHODS AND KITS FOR DETECTING HEMOGLOBIN IN TEST SAMPLES

The present invention relates to methods of detecting hemoglobin in a test sample. These methods can be used to diagnose a subject suffering from a genetic disorder relating to hemoglobin metabolism, to determine the eligibility of a subject to be a blood donor, to determine the age of a stored blood sample or to identify a hemolyzed plasma sample. The present invention also relates to kits for use in the above described methods. 143.-. (canceled)44: A kit for detecting hemoglobin in a test sample , the kit comprising:a. at least one basic solution;b. at least one indicator solution, wherein the indicator solution comprises at least one acridinium compound; andc. instructions for detecting hemoglobin in a test sample.45: The kit of claim 44 , wherein the basic solution is a solution having a pH of at least about 10.48: The kit of claim 44 , wherein the indicator solution further comprises at least one surfactant.4950-. (canceled)51: A kit for diagnosing a subject suffering from a genetic disorder relating to hemoglobin metabolism claim 44 , the kit comprising:a. at least one basic solution;b. at least one indicator solution, wherein the indicator solution comprises at least one acridinium compound; andc. instructions for diagnosing a subject suffering from a genetic disorder relating to hemoglobin metabolism.52: The kit of claim 51 , wherein the basic solution is a solution having a pH of at least about 10.55: The kit of claim 51 , wherein the indicator solution further comprises at least one surfactant.56: A kit for determining the eligibility of a subject to be a blood donor claim 51 , the kit comprising:a. at least one basic solution;b. at least one indicator solution, wherein the indicator solution comprises at least one acridinium compound; andc. instructions for determining the eligibility of a subject to be a blood donor.57: The kit of claim 56 , wherein the basic solution is a solution having a pH of at least about 10.60: The kit of claim 56 , wherein the ...

NEW ULTRA-SENSITIVE CHEMILUMINESCENT SUBSTRATES FOR ENZYMES AND THEIR CONJUGATES

New chemiluminescent compounds, stable in aqueous buffers, for use in biological assaying include acridane-based compounds and 1,2-dioxetanes. Among the new acridane-based compounds are water-soluble acridanes, enhancer coupled acridanes, bis and tris-acridanes as well as acridane-1,2-dioxetanes. Among the new 1,2-dioxetanes are electron deficient group-containing dioxetanes and tethered bis-1,2-dioxetanes. The 1,2-dioxetanes are useful as substrates for various enzymes. The acridanes can be admixed with an oxidizing agent. an aqueous buffer and, optionally, a stabilizer to form a substrate or reagent formulation useful for assaying, inter alia, HRP. This application is a continuation application of co-pending U.S. patent application Ser. No. 12/861,492 filed Aug. 23, 2010 which, in turn, is a divisional application of U.S. patent application Ser. No. 11/578,601, filed Oct. 16, 2006 which was the National Stage Entry of International Application No. PCT/US05/12680, filed Apr. 14, 2005, which claims the benefit of U.S. Provisional Application No. 60/562,886, filed Apr. 14, 2004, the entire disclosures of which, including all drawings, are hereby incorporated by reference.1. Field of the InventionThis invention relates to a new series of chemiluminescent compounds and their use in the detection of different enzymes such as horseradish peroxidase, alkaline phosphatase, β-galactosidase, β-glucosidase, β-glucuronidase, esterase, sulfatase and the like. The present invention also relates to the synthesis of the new chemiluminescent organic compounds and their use in the detection of different enzymes or their conjugates in aqueous buffers. The present invention further relates to the use of these new chemiluminescent organic compounds for the detection and quantifying of various biological molecules through chemiluminescence as well as detecting DNA or RNA fragments in DNA or RNA sequencing applications and methods of use therefore.2. Description of Related ArtsEnzyme ...

Uranium Analysis Using Luminescence Enhancing Oxidant and Oxidant Composition

According to the present invention, there is provided a method of determining a concentration of uranium including: a) a primary measuring step of measuring luminescence intensity or luminescence attenuation of uranium (VI) of an oxidant added sample obtained by adding an oxidant composition to a detection target sample; b) a secondary measuring step of adding different volumes of standard solution containing uranium (VI) having a predetermined concentration to a plurality of oxidant added samples, respectively, and then measuring luminescence intensity or luminescence attenuation of uranium (VI) contained in each standard solution added sample; and c) a calculating step of calculating a concentration of uranium (VI) contained in the detection target sample by a standard addition method based on the primary and secondary measurements. With the method for determining a concentration of uranium according to the present invention, the concentration of uranium may be further rapidly and accurately analyzed. 1. A method of determining a concentration of uranium comprising:a) a primary measuring step of measuring luminescence intensity or luminescence attenuation of uranium (VI) of an oxidant added sample obtained by adding an oxidant composition to a detection target sample;b) a secondary measuring step of adding different volumes of standard solution containing uranium (VI) having a predetermined concentration to a plurality of oxidant added samples, respectively, and then measuring luminescence intensity or luminescence attenuation of uranium (VI) contained in each standard solution added sample; andc) a calculating step of calculating a concentration of uranium (VI) contained in the detection target sample by a standard addition method based on the primary and secondary measurements.2. The method of claim 1 , wherein step a) includes adding the oxidant composition to the detection target sample claim 1 , leaving the oxidant added sample at room temperature to 80° C. ...

QUANTITATIVE DETERMINATION METHOD FOR TARGET PARTICLES, PHOTOMETRIC ANALYSIS DEVICE, AND COMPUTER PROGRAM FOR PHOTOMETRIC ANALYSIS

The method of the present invention includes: preparing a sample solution containing the target particles and luminescent probes to be bound to the target particles, and binding these in the sample solution; moving a position of a light detection region of the optical system in the sample solution using a confocal microscope or a multiphoton microscope, and detecting light signal emitted from the luminescent probe in the light detection region while moving the position of the light detection region, and individually detecting the target particles directly or indirectly; and counting the number of the detected target particles, and calculating the concentration of the target particles in the sample solution from the number of the counted target particles on the basis of a calibration curve that approximates the correlation between the concentration or quantity of the target particles in the sample solution and the number of the target particles. 1. A method for quantifying target particles which are dispersed and moving at random in a sample solution , the method comprising:(a) preparing a sample solution containing the target particles and luminescent probes to be bound to the target particles, and binding the target particles and the luminescent probes in the sample solution;(b) moving a position of a light detection region of the optical system in the sample solution with use of an optical system of a confocal microscope or a multiphoton microscope, and detecting a light signal emitted from the luminescent probe in the light detection region while moving the position of the light detection region of the optical system in the sample solution, and individually detecting the target particle directly or indirectly; and(c) counting the number of the target particles detected in the (b) and calculating the concentration of the target particles in the sample solution from the number of the counted target particles on the basis of a calibration curve that approximates the ...

POLYPEPTIDE WITH FUNCTION OF TARGETING RECOGNITION OF IMMUNE CELLS AND APPLICATION THEREOF

The present disclosure relates to a polypeptide recognizing immune cells, the polypeptide includes the following amino acid sequences: (a) an amino acid sequence containing C-terminal fragment sequence EQPDPGAVAAAAILRAILE of human Triokinase/FMN cyclase and its homologous sequence; or (b) an amino acid sequence that is substantially identical to the amino acid sequence described in (a), the substantially identical means 70% or more sequence identity to the amino acid sequence described in (a). The present invention also relates to a nucleic acid sequence encoding the polypeptide; a polypeptide probe used for targeting recognition of immune cells and containing the polypeptide described above and a reporter; a kit containing the probe described above; and, related applications of the polypeptide or probe described above. 115.-. (canceled)16. A polypeptide for targeting recognition of immune cells , comprising:(a) an amino acid sequence containing a C-terminal fragment sequence EQPDPGAVAAAAILRAILE (SEQ ID NO.:1) of human Triokinase/FMN cyclase; or(b) an amino acid sequence that is substantially identical to the amino acid sequence described in (a), wherein the substantially identical means that an amino acid sequence has more than 80% sequence identity to the amino acid sequence described in (a),wherein the amino acid sequences of (a) and (b) comprise 80 or less amino acid residues.17. The polypeptide according to claim 16 , wherein the amino acid sequences of (a) and (b) comprise 60 or less amino acid residues.18. The polypeptide according to claim 17 , wherein the amino acid sequences of (a) and (b) comprise 45 or less amino acid residues.19. The polypeptide according to claim 16 , wherein the amino acid sequence of (a) is EQPDPGAVAAAAILRAILE (SEQ ID NO.:1) claim 16 , LEQPDPGAVAAAAILRAILE (SEQ ID NO.:2) claim 16 , EQPDPGAVAAAAILRAILEVLQS (SEQ ID NO.:3) claim 16 , KNMEAGAGRASYISSARLEQPDPGAVAAAAILRAIL (SEQ ID NO.:4) claim 16 , or ...

CHEMILUMINESCENCE MEASUREMENT APPARATUS

Disclosed is a chemiluminescence measurement apparatus that includes: a support member configured to support a cartridge for measuring a test substance contained in a specimen by chemiluminescence measurement; a motor configured to rotate the support member so as to rotate the cartridge such that a process required for the chemiluminescence measurement proceeds in the cartridge; and a light receiver configured to receive light generated by chemiluminescence in the cartridge that is supported by the support member rotated by the motor. The cartridge supported by the support member and a light receiving surface of the light receiver are disposed inside a dark space surrounded by a light-shielding portion, and the motor is disposed outside the dark space. 1. A chemiluminescence measurement apparatus comprising:a support member configured to support a cartridge for measuring a test substance contained in a specimen by chemiluminescence measurement;a motor configured to rotate the support member so as to rotate the cartridge such that a process required for the chemiluminescence measurement proceeds in the cartridge; anda light receiver configured to receive light generated by chemiluminescence in the cartridge that is supported by the support member rotated by the motor, whereinthe cartridge supported by the support member and a light receiving surface of the light receiver are disposed inside a dark space surrounded by a light-shielding portion, and the motor is disposed outside the dark space.2. The chemiluminescence measurement apparatus of claim 1 , wherein:the cartridge comprises a liquid storage portion including a seal,the chemiluminescence measurement apparatus comprises a pressing portion configured to press the seal, andthe support member is positioned so as to oppose the pressing portion across the cartridge.3. The chemiluminescence measurement apparatus of claim 1 , comprising:a rotation shaft fixed to the support member, whereinthe motor operates to rotate ...

DETECTION APPARATUS AND DETECTION METHOD

Disclosed is a detection apparatus that transfers magnetic particles through a plurality of chambers in a cartridge which includes the plurality of chambers and a channel connecting between the plurality of chambers, and that causes the magnetic particles to carry a complex of a test substance and a labelling substance, to detect the test substance on the basis of the labelling substance in the complex. The detection apparatus includes: a rotation mechanism configured to rotate the cartridge about a rotation shaft; a magnet configured to collect the magnetic particles in the chambers; a movement mechanism configured to move the magnet in a direction different from a circumferential direction of a circle in which the rotation shaft is centered; a detector configured to detect the test substance; and a controller programmed to control the rotation mechanism and the movement mechanism so as to transfer the magnetic particles from one of the chambers to another one of the chambers. 1. A detection apparatus that transfers magnetic particles through a plurality of chambers in a cartridge which comprises the plurality of chambers and a channel connecting between the plurality of chambers , and that causes the magnetic particles to carry a complex of a test substance and a labelling substance , to detect the test substance on the basis of the labelling substance in the complex , the detection apparatus comprising:a rotation mechanism configured to rotate the cartridge about a rotation shaft;a magnet configured to collect the magnetic particles in the chambers;a movement mechanism configured to move the magnet in a direction different from a circumferential direction of a circle in which the rotation shaft is centered;a detector configured to detect the test substance; anda controller programmed to control the rotation mechanism and the movement mechanism so as to transfer the magnetic particles from one of the chambers to another one of the chambers.2. The detection ...

ANALYSIS DEVICE, ANALYSIS KIT, AND ANALYSIS SYSTEM

A device including a well array including wells in which a target substance is detected based on a biochemical reaction thereof. Each of the wells has an aspect ratio of 1 or more as calculated by Formula (1) such that the biochemical reaction of the target substance is detected, 1. A device , comprising:a well array including a plurality of wells in which a target substance is detected based on a biochemical reaction thereof, {'br': None, 'Aspect ratio=Depth of each well/Diameter of largest circle among circles included in a region enclosed by a rim of each well\u2003\u2003Formula (1).'}, 'wherein each of the wells has an aspect ratio of 1 or more as calculated by Formula (1) such that the biochemical reaction of the target substance is detected,'}2. The device according to claim 1 , wherein each of the wells has a volume of 100 fL to 5 claim 1 ,000 fL.3. A kit claim 1 , comprising:{'claim-ref': {'@idref': 'CLM-00001', 'claim 1'}, 'the device of ;'}a detection reagent for causing the biochemical reaction of the target substance; anda sealing liquid for sealing the wells.4. A kit claim 1 , comprising:{'claim-ref': {'@idref': 'CLM-00002', 'claim 2'}, 'the device of ;'}a detection reagent for causing the biochemical reaction of the target substance; anda sealing liquid for sealing the wells.5. The kit according to claim 3 , wherein the sealing liquid comprises an oil.6. The kit according to claim 4 , wherein the sealing liquid comprises an oil.7. A system claim 4 , comprising:{'claim-ref': {'@idref': 'CLM-00003', 'claim 3'}, 'the kit of ;'}a detector configured to detect the biochemical reaction; andan analysis unit configured to analyze a value measured by the detector.8. The system according to claim 7 , wherein the biochemical reaction is an isothermal reaction.9. The system according to claim 7 , wherein each of the wells has a depth that is larger than a depth of field of the detector and 100 times or less the depth of field.10. The system according to claim 7 , ...

NON-ENZYMATIC GLOW ASSAYS

The present disclosure relates to improved light-based assays, especially ligand binding assays, in which light is emitted from moieties stimulated by stimulating moieties. There is provided a method of generating and detecting a light signal comprising (a) providing a fluid sample comprising an analyte of interest; (b) contacting said sample with a first reagent comprising a molecular recognition element that binds to said analyte; (c) contacting said sample with a second reagent that (i) binds to said analyte in the presence of said first reagent; or (ii) binds to said first reagent; wherein said second reagent contains a light-generating reporter or chemiexcitation emitter; (d) removing unbound first and second reagents; (e) introducing into said sample a source of singlet oxygen or a chemiexcitation stimulator; and (f) measuring the production of light from said reporter. 1. A method of generating and detecting a light signal comprising (a) providing a fluid sample comprising an analyte of interest; (b) contacting said sample with a first reagent comprising a molecular recognition element that binds to said analyte; (c) said sample with a second reagent that:(i) binds to said analyte in the presence of said first reagent; or(ii) binds to said first reagent;wherein said second reagent contains a light-generating reporter or chemiexcitation emitter; removing unbound first and second reagents; (e) introducing into said sample a source of singlet oxygen or a chemiexcitation stimulator; and (f) measuring the production of light from said reporter.2. The method of claim 1 , wherein said light generating reporter is Hananya's SOCL probe claim 1 , and Perkin Elmer AlphaLisa and AlphaScreen particles containing thioxene claim 1 , anthracene claim 1 , and rubrene in the former case claim 1 , and thioxene and a europium chelate in the latter.3. The method of claim 1 , wherein the singlet oxygen is produced by a singlet oxygen producing protein claim 1 , such as Particular ...

EFFICIENT OPTICAL ANALYSIS OF POLYMERS USING ARRAYS OF NANOSTRUCTURES

The invention is directed to methods and apparatus for detecting sequences of optical signals from parallel reactions on an array of nanostructures, such as nanopores, nanowells, or nanoparticles. In accordance with the invention, an array of nanostructures is provided, each nanostructure comprising a reaction site and each capable of confining a reaction that generates a sequence of optical signals, and the nanostructures of the array being arranged in clusters each comprising a number of nanostructures. Each different cluster is disposed within a different resolution limited area and the number of nanostructures in each cluster is either greater than one or a random variable with an average value greater than zero. Optical signals from reactions in the nanostructures are detected by an optical system operatively associated with the array. 1. A device for analyzing polymers each having optical labels attached to a sequence of monomers , the device comprising:a nanopore array separating a first chamber and a second chamber, wherein nanopores of the nanopore array each connect the first chamber and the second chamber and are arranged in clusters such that each different cluster of nanopores is disposed within a different resolution limited area; anda polymer translocating system for moving polymers in the first chamber to the second chamber through the nanopores of the nanopore array;wherein said clusters are arranged in a rectilinear array or in a hexagonal array.2. The device of wherein each of said clusters comprises a plurality of nanopores or each of said clusters comprises a number of nanopores which is a random variable with an average value greater than zero.3. The device of wherein said polymers are polynucleotides and wherein said detection system determines numbers of functional nanopores within each of said resolution limited areas from said collected optical signals and varies an electrical field across said nanopore array to maximize a rate of sequence ...

Apparatus and method for antibody detection

An antigen chip is described, the latter comprising a plane substrate surface; and antigen spots, which are applied in a predetermined pattern on the substrate surface and which contain a first fluorescence dye. Further, an apparatus and a method for detecting antibodies in a sample are provided. Even further, the application relates to kit for use in a method for detecting antibodies in a sample.

FLUORESCENT MEASUREMENT OF FILMING AMINES

An embodiment provides a method for measuring amines in a solution, including: preparing an indicator-metal complex, wherein the indicator-metal complex comprises an indicator and a metal; introducing the indicator-metal complex to a solution, wherein the solution contains an amount of amine, wherein the amine activates the indicator-metal complex causing a change in fluorescence intensity of the indicator-metal complex; and measuring the amount of amine in the solution by measuring the change in fluorescence intensity of the indicator-metal complex. Other aspects are described and claimed. 1. A method for measuring amines in a solution , comprising:preparing an indicator-metal complex, wherein the indicator-metal complex comprises an indicator and a metal;introducing the indicator-metal complex to a solution, wherein the solution contains an amount of amine, wherein the amine activates the indicator-metal complex causing a change in fluorescence intensity of the indicator-metal complex; andmeasuring the amount of amine in the solution by measuring the change in fluorescence intensity of the indicator-metal complex.2. The method of claim 1 , wherein the indicator comprises a calcein blue derivative.3. The method of claim 1 , wherein the metal is selected from the group consisting of: copper (II) claim 1 , cobalt (II) claim 1 , nickel (II) claim 1 , and iron (II).4. The method of claim 1 , wherein the solution comprises a fluid for a steam cycle system.5. The method of claim 1 , wherein the amine comprises a filming agent for a reduction of degradation of a steam cycle system.6. The method of claim 1 , wherein the amine is selected from the group consisting of: diethylenetriamine claim 1 , Cetamine claim 1 , Helamin claim 1 , Steamate claim 1 , and DPL-674.7. The method of claim 1 , wherein the solution further comprises at least one of: a borate buffer and a carbonate buffer.8. The method of claim 1 , wherein the indicator-metal complex is weakly fluorescent and ...

OPTOFLUIDIC DIAGNOSTICS SYSTEM

An optofluidic diagnostic system and methods for rapid analyte detections. The system comprises an optofluidic sensor array, a test plate and an optical detection cartridge. The sensor array supports one or more distinct sensor units, each having a reactor section designed to temporarily enter a series of different kinds of wells in the test plate. One kind of well is a sample reservoir that holds reagent solution to be transferred into the reactor section. Another kind of well is a drainage chamber that removes reagent solution from the reactor section. A third kind of well is a colorant reservoir that holds a colorant reagent transferable into a reactor section. Finally, the sensor unit is transferred to the optical detection cartridge where it is placed into an isolation booth during the optical detection process so that its flat observation face is stationed in a viewing window opposite an optical detector lens. 1. A multi-well test plate for an optofluidic diagnostic system configured to interact with at least one sensor unit moved sequentially into and out of registry therewith , said test plate comprising:a plurality of wells, each said well having a well depth defined by an upper mouth and a lower base, each said well in said plate having a generally equal well depth,at least three wells being arranged in a sequence cluster, at least one well in said sequence cluster comprising a sample reservoir containing a liquid analyte reagent, at least one well in said sequence cluster comprising a drainage chamber configured to drain liquid reagents from a sensor unit, and at least one well in said sequence cluster comprising a colorant reservoir containing a liquid color development reagent.2. The test plate of claim 1 , wherein said sequence cluster includes a plurality of said sample reservoirs and a corresponding plurality of said drainage chambers claim 1 , said plurality of sample reservoirs disposed in alternating fashion with said plurality of drainage ...

CHEMILUMINESCENCE DETECTOR

The present invention provides a chemiluminescence detector, which comprises an image capture device sensitive to chemiluminescence located within a container. The container has an array of apertures located in a field of view of the image capture device, and each aperture is defined by a through-bore in a wall of the container. The exterior of the container is engagable with a plurality of sample holders, each sample holder being in alignment with a respective aperture when engaged with the exterior of the container. The passage of light into the container through each aperture is restrictable by a closure device, passage of light into the container through the apertures is thereby controllable. 1. A chemiluminescence detector , comprising:an image capture device sensitive to chemiluminescence located within a container, the container having an array of apertures located in a field of view of the image capture device, each aperture being defined by a through-bore in a wall of the container, the exterior of the container being engagable with a plurality of sample holders, each sample holder being in alignment with a respective aperture when engaged with the exterior of the container, wherein passage of light into the container through each aperture is restrictable by a closure device, passage of light into the container through the apertures thereby being controllable.2. The detector according to claim 1 , wherein a plurality of walls define the container claim 1 , at least a part of the plurality of walls being separable from the container.3. The detector according to claim 2 , wherein each separable part of the plurality of walls has a perimeter surface abutable to a complementary perimeter surface of the plurality of walls claim 2 , said perimeter surfaces forming a complementary pair of perimeter surfaces claim 2 , each respective complimentary pair of perimeter surfaces being configured to suppress light ingress to the interior of the container.4. The detector ...

METHODS OF MEASURING EXOSOMES USING INTRINSIC FLUORESCENCE

Described herein are novel rapid and reliable methods of detection of extracellular vesicles and quantifying extracellular vesicle concentrations and absolute number from various sources, including raw cell harvest. The methods described herein comprise detection of intrinsic fluorescence of extracellular vesicles in biological samples. Extracellular vesicles analyzed by the methods of this application have a stereotypical elution profile distinct from known contaminants. The methods described herein are a significant improvement over the state of the art and fulfills an unmet need in the field of extracellular vesicle manufacturing and quality control. 1. A method of detecting extracellular vesicles , comprising:obtaining a sample comprising extracellular vesicles; anddetermining an intrinsic fluorescence emission signal from said sample, wherein said intrinsic fluorescence emission signal is indicative of the presence of said extracellular vesicles within said sample.2. The method of claim 1 , wherein said intrinsic fluorescence emission signal is generated using an excitation wavelength ranging from 450 nm to 650 nm and an emission wavelength that is longer than the excitation wavelength and ranging from 470 nm to 670 nm.3. The method of claim 2 , wherein said intrinsic fluorescence emission signal is determined at an emission wavelength range of 500-600 nm.4. The method of claim 3 , wherein said intrinsic fluorescence emission signal is determined at an emission wavelength range of 550-590 nm.5. The method of claim 3 , wherein said intrinsic fluorescence emission signal is determined at an emission wavelength of 573 nm.6. The method of claim 2 , wherein said intrinsic fluorescence emission signal is determined at an excitation wavelength range of 500-600 nm.7. The method of claim 6 , wherein said intrinsic fluorescence emission signal is determined at an excitation wavelength range of 530-570 nm.8. The method of claim 7 , wherein said intrinsic fluorescence ...

CHEMILUMINESCENT NANOPARTICLES AND USES THEREOF

Gold nanoparticles having luminol covalently linked thereto and optionally functionalized with an oligonucleotide and bacterial or viral detection assays. In one aspect, the detection system for detecting an analyte in a sample comprises a light-shielding container having a fiberoptic cable for transmitting light generated within the light-shielding container to a photodetector; a plurality of functionalized nanoparticles deposited in solid form on or within a support, such that the support is located within the light-shielding container; wherein the functionalized nanoparticles comprise nanoparticles covalently attached to one or more chemiluminescent moieties; and a reagent system which causes the chemiluminescent moieties to produce light in the presence of the reagent system and the analyte in the sample. 1. A kit for detecting an analyte in a sample comprising:a light-shielding container having a fiberoptic cable for transmitting light generated within said light-shielding container to a photodetector;a plurality of functionalized nanoparticles deposited in solid form on or within a support, said support located within said light-shielding container;wherein said functionalized nanoparticles comprise nanoparticles covalently attached with one or more chemiluminescent moieties; anda reagent system which causes said chemiluminescent moieties to produce light in the presence of said reagent system and said analyte in said sample.2. The kit of wherein said functionalized nanoparticle comprises a gold nanoparticle having a diameter between about 2 and 50 nm.3. The kit of wherein said functionalized nanoparticle comprises a gold nanoparticle having a diameter between about 5 and 15 nm.4. The kit of wherein said nanoparticle is functionalized with luminol.5. The kit of wherein said luminol is attached to said nanoparticle via a linker having between 8 and 20 carbons.6. The kit of wherein said support is a multiwell plate having a plurality of wells claim 1 , wherein ...

HETEROGENEOUS LUMINESCENT OXYGEN CHANNELING IMMUNOASSAYS

A chemiluminescent detection system, kits and microfluidics devices containing same, and methods of use thereof, are disclosed. 1. A kit containing a chemiluminescent detection system , the kit comprising:(a) a composition comprising a singlet oxygen-activatable chemiluminescent compound capable of directly or indirectly binding to the target analyte;(b) a sensitizer capable of directly or indirectly binding to a target analyte and capable of generating singlet oxygen in its excited state; and(c) a composition comprising a singlet oxygen quencher capable of specifically binding to unbound sensitizer.2. The kit of claim 1 , wherein one of:(i) the composition of (a) has target analyte or an analog thereof bound thereto, and wherein (b) is capable of directly or indirectly binding to the target analyte or analog thereof bound to (a) or target analyte present in a sample; and(ii) (b) has target analyte or an analog thereof bound thereto, and wherein the composition of (a) is capable of directly or indirectly binding to the target analyte or analog thereof bound to (b) or target analyte present in a sample.34.-. (canceled)5. The kit of claim 1 , wherein the sensitizer or composition containing same is capable of indirectly binding to the target analyte and has streptavidin associated therewith claim 1 , and wherein biotin is associated with a first analyte-specific binding partner claim 1 , whereby the binding of streptavidin and biotin and the binding of the first analyte-specific binding partner to the target analyte results in the indirect association of the sensitizer to the target analyte.6. The kit of claim 5 , wherein the composition comprising the singlet oxygen quencher further comprises biotin associated therewith claim 5 , whereby the biotin associates with streptavidin present on unbound sensitizer.7. The kit of claim 1 , wherein the composition comprising the singlet oxygen-activatable chemiluminescent compound has a second analyte-specific binding partner ...

SIDE ILLUMINATED MULTI POINT MULTI PARAMETER OPTICAL FIBER SENSOR

A side illuminated multi point multi parameter optical fiber sensor that requires no sensitive coating is provided. This sensor comprises an optical fiber having at least one removed cladding section as the sensitive region, at least one probing light source that side illuminates the fiber, a power supply, a detector, a signal processor and a display. The sensitive optical fiber is optically affected by the presence of a measurand medium that can fluoresce, phosphoresce, absorb and/or scatter the probing light. This probing light is guided by the fiber core towards a detector which measures the light intensity and this light intensity is correlated with a measurand. 1. A waveguide electromagnetic coupler comprising:a waveguide having a first and second termini, the waveguide having at least one point with no cladding between the first and second termini, andat least one electromagnetic source producing an electromagnetic wave, the source being in direct optical communication with the waveguide at the at least one point with no cladding;wherein said waveguide is configured to guide a fraction of said electromagnetic wave when said electromagnetic wave is directly incident upon said waveguide at the at least one point with no cladding; andwherein intensity of said fraction of the electromagnetic wave is determined by a detector that is placed at either termini of the waveguide.2. The waveguide electromagnetic coupler of claim 1 , wherein said waveguide comprises a cylindrical bare core optical fiber.3. The waveguide electromagnetic coupler of claim 1 , wherein said waveguide is a tapered waveguide having a region of smaller diameter and a region of larger diameter.4. The waveguide electromagnetic coupler of claim 3 , wherein said fraction of the electromagnetic wave propagates from the region of smaller diameter towards the region of larger diameter.5. The waveguide electromagnetic coupler of claim 1 , wherein said detector is placed at the terminus of the waveguide ...

ASSAY PLATES, READER SYSTEMS AND METHODS FOR LUMINESCENCE TEST MEASUREMENTS

Luminescence test measurements are conducted using an assay module having integrated electrodes with a reader apparatus adopted to receive assay modules, induce luminescence, preferably electrode induced luminescence, in the wells or assay regions of the assay modules and measure the induced luminescence. 145.-. (canceled)46. A reader comprising:a. a light tight enclosure;b. a photodetector within the light tight enclosure;c. optics, wherein the photodetector is connected to the light tight enclosure and/or the optics;d. a multi-well assay plate configured to be transported into and out of the light tight enclosure;e. at least one of a plate alignment mechanism, a plate stacker and a plate transport mechanism configured to move the multi-well assay plate within the light tight enclosure; andf. a bar code reader configured to read a bar code on a surface of the multi-well assay plate.47. The reader or claim 46 , further comprising a cover.48. The reader of claim 47 , wherein the cover is a plastic molded material selected from the group consisting of a polyurethane claim 47 , a structural foam claim 47 , Acrylonitrile butadiene styrene (ABS) claim 47 , polystyrene claim 47 , polypropylene claim 47 , and polycarbonate.49. The reader of claim 48 , wherein the cover further comprises one or more of a metal and a carbon based material.50. The reader of claim 47 , wherein the cover comprises an intake vent that is separate from an exhaust vent.51. The reader of claim 47 , wherein the cover comprises an aperture and a door covering the aperture.52. The reader of claim 51 , wherein the door is configured to open and close by sliding along a tortuous tongue and groove configuration at a junction between the door and the aperture.53. The reader of claim 47 , wherein the light tight enclosure is configured to provide at least a degree of external light rejection so that a change in ambient light level from 500 lux to 0 lux does not increase the apparent coefficient of ...

POLY(METHYL METHACRYLATE)-SUPPORTED POLYDIACETYLENE FILMS AS COLORIMETRIC AND/OR FLUORESCENT DETECTORS

Colorimetric and/or fluorescent detectors, which include a polydiacetylene (PDA) film deposited on a polymethylmetacrylate (PMMA) substrate. There are also colorimetric and/or fluorescent detectors which have a solid organic matrix comprising one or more PDAs deposited on the PMMA substrate, wherein the PDA includes polymerized units of one or more diacetylene monomers, and wherein the matrix further comprises at least one recognition element of an analyte. There are also methods for detecting analytes using this detector, uses thereof and a methods for its preparation. 1. A colorimetric and/or fluorescent detector , which comprises a polydiacetylene (PDA) film deposited on a polymethylmetacrylate (PMMA) substrate.2. The colorimetric and/or fluorescent detector of claim 1 , which is a solid organic matrix comprising one or more polydiacetylenes (PDA) deposited on said polymethylmetacrylate (PMMA) substrate claim 1 , wherein said PDA comprises polymerized units of one or more diacetylene monomers.3. The colorimetric and/or fluorescent detector of claim 2 , wherein said PDA comprises at least 40 molar percent of polymerized units of a diacetylene monomer having a hydrophilic head group claim 2 , further wherein said head group comprises up to 5 atoms.4. The colorimetric and/or fluorescent detector of claim 3 , wherein said hydrophilic head group is selected from the group consisting of a carboxylic acid group claim 3 , a carboxy group claim 3 , an amino group claim 3 , a polyethylene oxide group claim 3 , a polypropylene oxide group claim 3 , a hydroxy group claim 3 , a sulfonic acid group claim 3 , an amide group claim 3 , a substituted amide group claim 3 , and an ammonium salt group.5. The colorimetric and/or fluorescent detector of claim 3 , wherein said hydrophilic head group is a carboxylic acid group.6. The colorimetric and/or fluorescent detector of claim 3 , wherein said hydrophilic head group is an amine group.7. The colorimetric and/or fluorescent detector ...

LIGHT AVOIDANCE STRUCTURE FOR DETECTING OPTICAL SIGNAL

A light avoidance structure () for detecting an optical signal, comprising: a base (), a rotating body () pivotally connected to the base (), and a cover plate () arranged facing toward the rotating body (). The rotating body () is provided with a first light shielding member (); the rotating body () is provided with at least one cup hole (); the cup hole () is provided with a detection port (); the cover plate () is provided with a second light shielding member (); the second light shielding member () and the first light shielding member () match each other so as to form an annular structure used for shielding light, and a gap () is provided at the connection of the second light shielding member () and the first light shielding member (); the detection port () is located at the outer side of the first light shielding member () and the second light shielding member (); and the cover plate () is provided with at least one hole (). The light avoidance structure () for chemiluminescence measurement may effectively solve the problem of light leakage in a dark room by means of the annular structure used for shielding light provided between the cover plate () and the rotating body (), and is a simple structure and reduces the influence on a device. 1. A light-avoiding structure for optical signal detection , comprising:a base provided with an accommodating slot;a rotating body pivotally connected to the base, the rotating body being received in the accommodating slot, the rotating body being provided with a first light shielding member, the rotating body being provided with at least one cup hole, the cup hole being provided with a detection port serving as a signal input port of a photosensitive device; anda cover plate arranged toward the rotating body, the cover plate covering an opening of the accommodating slot, the cover plate being provided with a second light shielding member, the second light shielding member and the first light shielding member matching each ...

Portable Device for Detecting Explosive Substances Comprising a Device for Generating and Measuring the Emission of an Indicator

A portable appliance for detecting explosive materials has an apparatus for generating and measuring emission of an indicator. The indicator has a carrier and a plurality of indicator substances that can be impinged upon by analytes, said indicator substances being applied onto the carrier as a thin layer and being positionable in an indicator area by means of a holding apparatus. The indicator substances are arranged in different regions of the carrier such that the indicator substances in the indicator area represent a pattern of indicator substances depending on the location. The apparatus has a plurality of radiation sources for emitting quasi-monochromatic excitation radiation. The radiation sources are arranged at various locations in a radiation area such that the radiation area represents a pattern of radiation sources depending on the location. The apparatus has an excitation beam path with at least one first imaging system for imaging excitation radiation into the indicator area such that emission of the indicator substances is producible at the locations at which the excitation radiation is imaged on the indicator area. An emission beam path has at least one second imaging system for imaging the indicator area into a reception area such that a pattern of emissions is producible in the reception area depending on the location. A plurality of receivers receive emissions from the reception area and for converting the received emissions into electrical signals. 1. (canceled)2. A portable appliance for detecting explosive materials , comprising:an apparatus for generating and measuring emission of an indicator, whereinthe indicator has a carrier and a plurality of indicator substances that can be impinged upon by analytes,the indicator substances are applied onto the carrier as a thin layer and are positionable in an indicator area by a holding apparatus,the indicator substances are arranged in different regions of the carrier such that the indicator ...

SIDE ILLUMINATED MULTI POINT MULTI PARAMETER OPTICAL FIBER SENSOR

A side illuminated multi point multi parameter optical fiber sensor that requires no sensitive coating is provided. This sensor comprises an optical fiber having at least one removed cladding section as the sensitive region, at least one probing light source that side illuminates the fiber, a power supply, a detector, a signal processor and a display. The sensitive optical fiber is optically affected by the presence of a measurand medium that can fluoresce, phosphoresce, absorb and/or scatter the probing light. This probing light is guided by the fiber core towards a detector which measures the light intensity and this light intensity is correlated with a measurand. 1a) a sensitive optical fiber having first and second termini, and having a core having at least one exposed, cladding free, core region along the fiber between the first and second termini;b) a detector optically coupled to said first terminus of said sensitive optical fiber;c) a signal processor in data communication with said detector, the signal processor so configured as to determine the degree of a measurand of an analyte sample operatively optically coupled with the at least one exposed core region upon a stimulation of the analyte sample by a probing light when said sample has a property of chemiluminescence, phosphorescence, fluorescence, or scatters, refracts, reflects or absorbs light; the determination resulting from a correlation of light intensity over a predetermined range of wavelengths, the probing light not substantially traveling axially along the fiber to reach the substance.. A colorimeter comprising: This application claims the benefit of nonprovisional U.S. application Ser. No. 13/892,274 filed on May 11, 2013 that in turn claims the benefit of U.S. Ser. No. 12/697,233, filed on Jan. 30, 2010, now U.S. Pat. No. 8,463,083, which in turn claims the benefit of U.S. Provisional Application No. 61/148,564, filed Jan. 30, 2009.This invention relates generally, to spectroscopic based ...

METHOD FOR FILLING A MICROFLUIDIC DEVICE USING A DISPENSING SYSTEM AND CORRESPONDING TEST SYSTEM

The invention relates to a method of filling nozzles () of a dispensing system () of a test system () comprising a dispensing system () and a microfluidic device () comprising at least the following steps: (a) transporting the solution from the container () via the nozzle () of the dispensing system () to the sample application opening () of the microfluidic device () by means of a micro-pump (), (b) further transporting the solution into the measuring region of the microfluidic passage () of the microfluidic device (), (c) measuring a light signal in the measuring region of the microfluidic device () by means of at least one photosensitive sensor () with a plurality of photodetectors (), and (d) deactivating the micro-pump () when the light signal and/or a change in the light signal is detected. 2266661210111111133. Method according to claim 1 , wherein the dispensing system () comprises at least two containers () containing solutions claim 1 , the first container () containing a first solution claim 1 , in particular a chemiluminescent solution claim 1 , and the second container () containing another solution claim 1 , preferably an enzyme solution claim 1 , and the containers () are connected via a fluid line () to at least one micro-pump () claim 1 , after which at least two nozzles () are disposed claim 1 , and a first nozzle () is used to dispense the first solution claim 1 , in particular the chemiluminescent solution claim 1 , and the second nozzle () is used to dispense the other solution claim 1 , preferably an enzyme solution claim 1 , into the sample application opening () of the microfluidic device () claim 1 , comprising at least the following steps:{'b': 6', '11', '2', '13', '3', '10, 'transporting the first solution, in particular the chemiluminescent solution, and the other solution, in particular the enzyme solution, from the respective container () via the respective nozzle () of the dispensing system () to the sample application opening () of the ...

GRAPHENE-MODIFIED ELECTRODES

The specification provides an assay electrode including a composite containing a matrix and a multiplicity of graphene particles dispersed therein. 14.-. (canceled)5. An apparatus for conducting an electrochemiluminescence assay comprising: i) a matrix; and', 'ii) one or more graphene particles dispersed therein; and, '(a) an electrode comprising'}(b) binding reagents immobilized on said electrode to form one or more binding domains capable of binding a component of a binding assay.6. The apparatus of wherein said apparatus further comprises a plurality of distinct binding domains supported on said electrode claim 5 , each domain containing a reagent capable of binding a component of a binding electrochemiluminescence assay claim 5 , wherein at least two of said binding domains differ in their specificity for analytes of interest.7. The apparatus of claim 6 , wherein said binding domains are immobilized on said electrode.8. The apparatus of wherein said one or more graphene particles comprise a graphene formulation including Vor-inks X102 claim 5 , S701 claim 5 , S201 claim 5 , R1010 claim 5 , or combinations thereof.9. A multi-well plate comprising a plurality of wells claim 5 , wherein two or more of said plurality of wells each comprise a working electrode surface and a counter electrode surface claim 5 , wherein said working electrode surface and/or said counter electrode surface comprise screen printed graphene.10. The multi-well plate of wherein said screen printed graphene comprises a graphene formulation including Vor-inks X102 claim 9 , S701 claim 9 , S201 claim 9 , R1010 claim 9 , or combinations thereof.11. A multi-well plate having a plurality of wells claim 9 , wherein two or more of said plurality of wells each comprise a working electrode surface formed by applying one or more layers of graphene onto a conductive layer comprising silver.12. The multi-well plate of wherein said graphene comprises a graphene formulation including Vor-inks X102 claim 11 ...

APPLICATIONS OF BIOMARKER IN TERMS OF DETERMINING ANTIPHOSPHOLIPID SYNDROME AND REAGENT KIT OF BIOMARKER

Applications of antibodies to MYO5A protein as a biomarker in terms of determining antiphospholipid syndrome. Antibodies to the MYO5A protein include at least one of IgG, IgM or IgA. It can be used to identify primary and secondary antiphospholipid syndrome. At the same time, a reagent kit is provided, which is made of MYO5A protein, to determine whether there is antiphospholipid syndrome by detecting the presence of antibodies to MYO5A protein. The present disclosure, applications of antibodies to MYO5A protein as a biomarker in terms of determining antiphospholipid syndrome, provides a new biomarker to identify antiphospholipid syndrome and a new application direction which is of great significance for the identification of antiphospholipid syndrome. 1. Applications of antibodies to MYO5A protein as a biomarker in terms of determining antiphospholipid syndrome.2. Applications of antibodies to MYO5A protein as a biomarker in terms of determining antiphospholipid syndrome according to claim 1 , wherein antibodies to the MYO5A protein include at least one of IgG claim 1 , IgM or IgA.3. Applications of antibodies to MYO5A protein as a biomarker in terms of determining antiphospholipid syndrome according to claim 2 , are used to identify primary antiphospholipid syndrome.4. Applications of antibodies to MYO5A protein as a biomarker in terms of determining antiphospholipid syndrome according to claim 2 , are used to identify secondary antiphospholipid syndrome.5. Applications of antibodies to MYO5A protein as a biomarker in terms of determining antiphospholipid syndrome according to claim 2 , are used to identify primary antiphospholipid syndrome and secondary antiphospholipid syndrome simultaneously.7. A biomarker claim 1 , characterized in that it is an antibody produced by the MYO5A protein according to claim 1 , determines whether there is antiphospholipid syndrome by detecting the presence of antibodies to MYO5A protein.8. A reagent kit claim 1 , characterized in ...

Method for detecting a target particle

This method for detecting a target particle has: (a) a step for preparing a sample solution containing target particles and one type or two or more types of a luminescent probe that binds to the target particles, and allowing two or more molecules of the luminescent probe to bind per one molecule of the target particles in the sample solution, and (b) a step for calculating the number of molecules of target particles bound to the luminescent probe present in the sample solution prepared in step (a) by a scanning molecule counting method by using as an indicator thereof the strength of light signals of the individually detected particles, and the luminescent probe is one type or two or more types of a luminescent probe to which the same type of luminescent substance is bound.

Nanothermometer, Methods and Uses Therefor

A nanothermometer is disclosed. In various embodiments, a nanothermometer comprises a nanoparticle such as a gold nanoparticle, a fluorophore, and a linker, such as a peptide linker, extending between the nanoparticle and the fluorophore, whereby the fluorophore is self-quenched. The linker can comprise one or more cysteines. An unheated thermometer shows little or no fluorescence. Upon heating, fluorophore-linker conjugates are released from the nanoparticle, thereby unquenching the fluorescence. An increase in fluorescence results. In some embodiments, the increase in fluorescence can be irreversible. Methods of measuring temperature of a sample such as a biological sample, and methods of synthesizing a nanothermometer, are also disclosed. A molecular thermometer is also disclosed. 1. A nanothermometer comprising:a nanoparticle;a self-quenching fluorophore; anda linker extending between the nanoparticle and the fluorophore.2. A nanothermometer in accordance with claim 1 , wherein the nanoparticle is a gold nanoparticle.3. A nanothermometer in accordance with claim 1 , wherein the fluorophore is selected from the group consisting of a fluorescein claim 1 , tetramethylrhodamine claim 1 , Rhodamine Red™-X claim 1 , Rhodamine Green™ claim 1 , ROX™ claim 1 , ATTO™ 488 claim 1 , ATTO™ 532 claim 1 , ATTO™ 550 claim 1 , ATTO™ 565 claim 1 , ATTO™ 590 claim 1 , ATTO™ 633 claim 1 , ATTO™ 647N claim 1 , ATTO™ Rho101 claim 1 , Alexa Fluor® 488 claim 1 , Alexa Fluor® 532 claim 1 , Alexa Fluor® 546 claim 1 , a coumarin claim 1 , Cascade Blue® claim 1 , a BODIPY® claim 1 , Texas Red® claim 1 , TEX™ 615 claim 1 , Hexachlorofluorescein claim 1 , IRDye® 800CW claim 1 , a MAX™ NHS ester claim 1 , TYE™ 563 claim 1 , Alexa Fluor® 594 claim 1 , Alexa Fluor® 647 claim 1 , Alexa Fluor® 660 claim 1 , TYE™ 665 claim 1 , TYE™ 705 claim 1 , Alexa Fluor® 750 claim 1 , Lucifer Yellow claim 1 , indocyanine Cy3™ claim 1 , indocyanine Cy5™ claim 1 , and indocyanine Cy5.5™.4. A nanothermometer in ...

DETECTION MODULE

We describe a detection module useful with an apparatus and/or system for conducting luminescence assays, and a kit, a system, an apparatus, and a method incorporating the detection module. 1. A detection module configured for placement and functional engagement with an apparatus for conducting luminescence assays , said detection module being a replaceable unit including a detection module housing , and wherein the following components are disposed within said housing:(a) a light detector; and(b) an alignment system for adjusting one or more components of the detection module after the detection module is attached to the apparatus.2. The detection module according to claim 1 , wherein the alignment system is configured to adjust positions of the one or more components within the housing of the detection module.3. The detection module according to claim 1 , wherein the alignment system is configured to adjust a position of a camera and/or a lens of the light detector.4. The detection module according to claim 1 , wherein the alignment system is configured to adjust a position of at least one of said one or more components in each of X claim 1 , Y and Z directions.5. The detection module according to claim 4 , wherein the alignment system comprises set screws for aligning an optical system in the X and Y directions and a drive screw to focus the optical system in the Z direction.6. The detection module according to claim 5 , wherein the set screws and the drive screw are accessible from respective openings in the housing of the detection module.7. The detection module according to claim 6 , wherein the opening for the drive screw is located on a first side of the housing and the openings for the set screws are located on a second side of the housing.8. The detection module according to claim 1 , wherein the alignment system is motorized to perform the adjusting automatically.9. The detection module according to claim 1 , wherein the alignment system is configured to ...

METHODS AND APPLICATIONS OF ON-CHIP DRIED OR LYOPHILIZED CHEMILUMINESCENCE SUBSTRATE REAGENTS

A sensing device includes a sample loading chamber configured to receive a sample, a detection antibody drying or lyophilization chamber configured to receive a first portion of the sample, one or more substrate drying or lyophilization chambers configured to receive a second portion of the sample, and one or more reaction chambers connected to the detection antibody drying or lyophilization chamber and the one or more substrate drying or lyophilization chambers. The detection antibody drying or lyophilization chamber and one or more substrate drying or lyophilization chambers are placed in parallel between the sample loading chamber and the one or more reaction chambers 1. A sensing device comprising:a sample loading chamber configured to receive a sample;a detection antibody drying or lyophilization chamber configured to receive a first portion of the sample;one or more substrate drying or lyophilization chambers configured to receive a second portion of the sample; andone or more reaction chambers connected to the detection antibody drying or lyophilization chamber and the one or more substrate drying or lyophilization chambers,wherein the detection antibody drying or lyophilization chamber and one or more substrate drying or lyophilization chambers are placed in parallel between the sample loading chamber and the one or more reaction chambers.2. The sensing device of claim 1 , further comprising a delay channel between the one or more substrate drying or lyophilization chambers and the one or more reaction chambers.3. The sensing device of claim 1 , further comprising a hydrophobic passive valve between the sample loading chamber and the one or more substrate drying or lyophilization chambers claim 1 ,wherein the hydrophobic passive valve is configured to prevent the second portion of the sample from flowing into the one or more substrate drying or lyophilization chambers before the first portion of the sample fills the detection antibody drying or ...

LUMINESCENCE DETECTING APPARATUSES AND METHODS

A luminescence detecting apparatus and method for analyzing luminescent samples is disclosed. Luminescent samples are placed in a plurality of sample wells in a tray, and the tray is placed in a visible-light impervious chamber containing a charge coupled device camera. The samples may be injected in the wells, and the samples may be injected with buffers and reagents, by an injector. In the chamber, light from the luminescent samples pass through a collimator, a Fresnel field lens, a filter, and a camera lens, whereupon a focused image is created by the optics on the charge-coupled device (CCD) camera. The use of a Fresnel field lens, in combination with a collimator and filter, reduces crosstalk between samples below the level attainable by the prior art. Preferred embodiments of the luminescence detecting apparatus and method disclosed include central processing control of all operations, multiple wavelength filter wheel, and robot handling of samples and reagents. Preferred embodiments of processing software integrated with the invention include elements for mechanical alignment, outlier shaving, edge detection and masking, manipulation of multiple integration times to expand the dynamic range, crosstalk correction, dark subtraction interpolation and drift correction, multi-component analysis applications specifically tailored for luminescence, and uniformity correction. 113-. (canceled)14. A luminescence detecting apparatus , comprising:a sample chamber configured to receive a plurality of sampling areas containing respective luminescent samples;a photosensitive detector; a substrate comprising a two-dimensional array of openings and positioned during use between the plurality of sampling areas and the photosensitive detector, the plurality of sampling areas aligned during use to the array of openings, the array of openings configured to simultaneously pass emissions from at least some of the sample areas to the photosensitive detector and to block some of the ...

ANALYSIS CHIP AND SAMPLE ANALYSIS APPARATUS

Provided are an analysis chip and a sample analysis device by which it is possible to perform analysis rapidly and accurately on a plurality of items simultaneously using a small amount of liquid for measurement. An analysis chip () is provided with: a substrate () formed in a substantially disc shape; an insertion hole () formed in the center of the substrate (), a liquid to be measured being inserted into the insertion hole (); and micro-flow paths () into which the liquid to be measured can be guided from the insertion hole () by capillary action, each of the micro-flow paths () having therein a plurality of types of antigens () that are fixed in place with gaps therebetween, the antigens () selectively reacting to components in the liquid to be measured. 1. An analysis chip comprising: a substrate formed into a substantially disc shape;an injection port formed at the center of the substrate and through which target liquid as a measurement target is injected; anda flow path that allows introduction of the target liquid into the flow path through the injection port by means of capillary action, wherein multiple types of reactants capable of selectively reacting with a component in the target liquid are fixed to the flow path.2. The analysis chip according to claim 1 , wherein the flow path of the analysis chip includes a plurality of flow paths arranged in a radial pattern to extend to an outer edge of the substrate claim 1 , and the multiple types of reactants capable of selectively reacting with a component in the target liquid are fixed to each of the flow paths to be arranged at given intervals.3. The analysis chip according to claim 1 , wherein the analysis chip is formed in such a manner that the flow path surrounds the injection port.4. The analysis chip according to claim 1 , wherein the reactants are fixed in the form of spots to the flow path.5. The analysis chip according to claim 1 , wherein the reactants fixed to the flow path each have a shape like a ...

Adsorption Mechanism, Cleaning Device, Chemiluminescence Detector and Cleaning Method

The present disclosure relates to a magnetic microbeads adsorption mechanism, which is configured to adsorb a magnetic microbeads in a reaction cup and is provided with a cup inlet station and a cup outlet station; the magnetic microbeads adsorption mechanism includes a pedestal, a turntable and multiple magnetic adsorption components; the turntable is rotatably mounted on the pedestal; the turntable can drive the reaction cup to rotate around a central axis of the turntable; the multiple magnetic adsorption components are arranged on a mounting circumference of the pedestal at intervals; the mounting circumference and rotation track of the reaction cup are concentrically arranged; and during a process when the reaction cup rotates from the cup inlet station to the cup outlet station, the adsorption height of the magnetic microbeads relative to cup bottom of the reaction cup can be changed. 1. A magnetic microbeads adsorption mechanism , which is configured to adsorb a magnetic microbeads in a reaction cup in a rotation movement and is provided with a cup inlet station and a cup outlet station ,the magnetic microbeads adsorption mechanism comprising a pedestal and a plurality of magnetic adsorption components, wherein the plurality of magnetic adsorption components are arranged at intervals on a same mounting circumference of the pedestal; the mounting circumference and a rotation track of the reaction cup are concentrically arranged; andduring a process when the reaction cup rotates from the cup inlet station to the cup outlet station passing through the plurality of magnetic adsorption components, an adsorption height of the magnetic microbeads is able to be changed.2. The magnetic microbeads adsorption mechanism as claimed in claim 1 , wherein for a single reaction cup in the rotation movement claim 1 , the adsorption height of the magnetic microbeads is increased first and then is decreased.3. The magnetic microbeads adsorption mechanism as claimed in claim 1 , ...

Methods and devices for photometric analysis

The present disclosure provides methods and devices for characterizing light-generating analytes.

MANAGING VARIATION IN SPECTROSCOPIC INTENSITY MEASUREMENTS THROUGH THE USE OF A REFERENCE COMPONENT

The present invention generally pertains to methods and kits for managing the variation in spectroscopic intensity measurements through the use of a reference component. The reference component may comprise a reference spectroscopic substance and may be contained together with a sample of interest in a sample to be tested, wherein the sample of interest may comprise a sample spectroscopic substance. Each sample to be tested may be uniquely identified and, hence, “barcoded” by combinations of different colors and concentrations of spectroscopic substances, contained therein. 1. A method for managing variation in spectroscopic intensity measurements comprising:a) a reference component comprising a spectroscopic substance (“reference spectroscopic substance”), andb) a sample comprising a sample of interest and one or more spectroscopic substances (“sample spectroscopic substances”);wherein the reference component and the sample together comprise a sample to be tested, wherein the reference spectroscopic substance and the one or more sample spectroscopic substances are substantially distinct within the sample to be tested, and wherein, the sample to be tested is analyzed for spectroscopic intensity measurements of each spectroscopic substance.2. A method according to claim 1 , wherein the sample to be tested is uniquely identified by combinations of different colors and concentrations of spectroscopic substances contained therein.3. A method according to claim 1 , wherein the reference spectroscopic substance and the one or more sample spectroscopic substances comprises one or more light-scattering molecule claim 1 , chemiluminescent molecule claim 1 , selectively absorbent molecule claim 1 , or fluorescent molecule.4. A method according to claim 1 , wherein the sample of interest comprises: a single-phase flow claim 1 , the composition of which may vary with time; a cell or collection of cells; a microorganism or collection microorganisms; a protein; a peptide; a ...

Method for characterizing and/or determining samples

This invention relates to a method for characterizing and/or determining a samples, particularly in the aid of lanthanide(III) ions and ligands including an aromatic structure and 2-5 chelating heteroatoms. The invention relates also to an array for characterizing and/or determining a samples utilizing the properties of lanthanide(III) chelates. 1. A method for characterizing and/or determining a sample , the method comprising a ligand comprising an aromatic structure and 2-5 chelating heteroatoms, and', 'optionally a lanthanide(III) ion,, 'a) providing a matrix comprising'} said sample and', 'optionally a lanthanide(III) ion;', 'in proviso that either said matrix or at least one of said solutions comprise said lanthanide(III) ion;, 'b) introducing one or more solutions to said matrix wherein at least one of said solutions comprises'}c) allowing said one or more solutions to dissolve said matrix;d) detecting at a predetermined time point a signal derived from said lanthanide(III) ion in solution; and i) at least one signal derived from said lanthanide(III) ion in the presence of said dissolved matrix and one or more said solutions in the absence of said sample; and/or', 'ii) at least one signal derived from said lanthanide(III) ion in the presence of said dissolved matrix and one or more said solutions with corresponding sample; and/or', 'iii) at least one signal derived from said lanthanide(III) ion in the presence of said dissolved matrix and one or more said solutions with known sample., 'e) characterizing and/or determining said sample by comparing said signal with'}4. The method according to wherein the ligand is selected from fluorosalicylic acid claim 3 , salicylic acid claim 3 , and 4 claim 3 ,5-dihydrobenzene-1 claim 3 ,3-disulfonic acid.6. The method according to wherein the ligand is selected from picolinic acid claim 5 , dipicolinic acid claim 5 , nicotinic acid and nicotinamide.7. The method according to wherein the ligand is selected from the group ...

ON-CHIP LOCALIZATION MICROSCOPY

An analysis substrate comprises: a localization layer to be provided with a sample comprising a nucleotide provided with a fluorescent dye; and a sensor layer comprising an array of sensor pixels, the localization layer being on-chip relative to the sensor layer, one or more of the array of sensor pixels to receive a propagation of fluorescence from the fluorescent dye.

SAMPLE ANALYSIS DEVICE

To provide a sample analysis device for speedily and accurately analyzing a plurality of items for a fluid to be measured, a biochemical analysis device comprises: a measurement unit that captures images of and obtains image information about each reaction between a target fluid and a plurality of types of antigen; a storage unit that stores antigen position information for the plurality of types of antigen fixed in a microchannel; and a determination unit that determines a plurality of items for a specimen, based on the antigen position information and the image information. The storage unit stores arrangement state determination information for determining the arrangement state of analysis chips. The determination unit determines the arrangement state of the analysis chips during imaging, based on the arrangement state determination information and the image information, and analyses the specimen based on the antigen position information and the image information. 1. A sample analysis device comprising: a chip holder that allows installation of an analysis chip on the chip holder , the analysis chip comprising a substrate , an injection port formed at the substrate and through which target liquid as a measurement target is injected , and a flow path connected to the injection port , a plurality of reactants capable of selectively reacting with a component in the target liquid being fixed to the flow path;a chip holder rotation mechanism that rotates the chip holder;a pipetting mechanism that injects the target liquid into the injection port of the analysis chip;a measurement device that acquires image information by capturing an image of reactions between the target liquid and the plurality of reactants;a storage unit that stores reactant position information about the plurality of reactants fixed to the flow path; anda determination unit that makes a determination of a plurality of items about the target liquid based on the reactant position information and the ...

METHOD FOR MONITORING POST-TRANSLATIONAL MODIFICATION OF PROTEIN

According to a method for monitoring post-translational modifications of protein is provided, a first microbead by binding a protein antibody to a base bead is provided. A second microbead by binding a target protein having a first post-translational modification or a second post-translational modification, which are inversely proportional to each other, to the protein antibody of the first microbead, is provided. A third microbead by binding the second microbead to a first post-translational modification antibody is provided. A fourth microbead by binding the second microbead to a second post-translational modification antibody is provided. Impedances of the third and fourth microbeads are measured. A ratio of a first difference, between the impedances of the third microbead and a reference impedance, to a second difference, between the impedances of the fourth microbead and the reference impedance, is obtained. 1. A method for monitoring post-translational modifications of protein , the method comprising:combining a first post-translational modification of target proteins with a first post-translational modification antibody capable of being selectively combined with the first post-translational modification to prepare a first post-translational modification medium;combining a second post-translational modification of target proteins with a second post-translational modification antibody capable of being selectively combined with the second post-translational modification to prepare a second post-translational modification medium, the second post-translational modification being inversely proportional to the first post-translational modification;obtaining a first measured value of the first post-translational modification medium for a physical characteristic or a chemical characteristic, which varies depending on degree of the first post-translational modification and the second post-translational modification;obtaining a second measured value of the second post- ...

Measuring Chamber, Working Method of Measuring Chamber, Chemiluminescence Measurement Method of Measuring Chamber and Chemiluminescence Detector

The present disclosure relates to a measuring chamber, a working method of the measuring chamber, a chemiluminescence measurement method of the measuring chamber and a chemiluminescence detector. The measuring chamber includes a dark chamber, a first substrate nozzle, a photomultiplier detection component, a waste liquor adsorption needle component, a reaction cup turntable and a plurality of reaction cup processing stations; the reaction cup turntable is provided in the measuring chamber rotationally; and the plurality of reaction cup processing stations are sealed in a mutually light-isolated manner. When the instrument works, reaction cups in the reaction cup turntable are moved in the dark chamber; and after the reaction cups are moved to corresponding processing stations for processing the reaction cups, the plurality of different processing stations for processing, the reaction cups may simultaneously process the reaction cups moved to the corresponding reaction cup processing stations. 1. A measuring chamber for processing multiple reaction cup processing stations in parallel , comprising a dark chamber , a first substrate nozzle , a photomultiplier detection component , a waste liquor adsorption needle component , a reaction cup turntable and a plurality of reaction cup processing stations , the reaction cup turntable being provided in the measuring chamber rotationally , wherein the plurality of reaction cup processing stations are sealed in a mutually light-isolated manner ,2. The measuring chamber as claimed in claim 1 , further comprising a bottom plate claim 1 , an inner shell claim 1 , an outer shell and an upper cover claim 1 , wherein the bottom plate claim 1 , the outer shell and the upper cover are enclosed into a holding space; the reaction cup turntable and the inner shell are provided in the holding space; the reaction cup turntable is provided between the inner shell and the outer shell along a radial direction of the reaction cup turntable; ...

CHEMILUMINESCENCE DETECTION EQUIPMENT AND ITS OPERATION METHOD

A highly integrated, fully automatic chemiluminescence detection equipment and its operation method are disclosed. The chemiluminescence detection equipment comprises a control module, a first electrical machine, a reagent wheel disc tank, a sampling module, a washing module, a second electrical machine and a detection module. Compared with the traditional large-scale chemiluminescence detection equipment, the chemiluminescence detection equipment of the present invention has the advantage of high integration, and greatly reduces the overall volume and weight of the chemiluminescence detection equipment. 1. A chemiluminescence detection equipment , comprising:a control module;a first electrical machine connected to said control module;a reagent wheel disc tank connected to said first electrical machine;a sampling module connected to said control module, wherein said sampling module includes a sampling pin;a washing module connected to said sampling module and said control module to clean said sampling pin;a second electrical machine connected to said control module; anda detection module including:a detection rotatable module connected to said second electrical machine;a heating device connected to said control module and said detection rotatable module;a light detection device connected to said control module and said detection rotatable module; anda light tight cover to cover said detection rotatable module;wherein said light-tight cover is provided with at least one light-tight hole, wherein each light-tight hole is opened and closed by an electromagnetic valve, and said electromagnetic valve is connected with said control module.2. The equipment of claim 1 , wherein said reagent wheel disc tank includes:a cooling device arranged on a bottom of said reagent wheel disc tank;a plurality of sample storage slots arranged on an outer ring of said reagent wheel disc tank;a substrate storage slot arranged on said outer ring of said reagent wheel disc tank; anda ...

SAMPLE ANALYSIS DEVICE, SAMPLE ANALYSIS SYSTEM, AND METHOD OF MEASURING LUMINESCENCE OF A SAMPLE

A sample analysis device includes: a motor to rotate a sample analysis substrate with a sample introduced thereon around a rotation axis of the sample analysis substrate; a drive circuit to drive the motor; a photodetector to measure a number of photons associated with a luminescence from the sample being transmitted through a window of a measurement chamber of the sample analysis substrate; and a control circuit to calculate a measurement value of the luminescence of the sample by using a number of photons measured by the photodetector while the motor rotates the sample analysis substrate. 1. A sample analysis device which , by rotating a sample analysis substrate including a measurement chamber and a shading portion , the measurement chamber having a window , allows a sample that is introduced onto the sample analysis substrate to be transferred to the measurement chamber , allows the sample to undergo luminescence in the measurement chamber , and measures the luminescence;the sample analysis device comprising:a motor to rotate the sample analysis substrate with the sample introduced thereon around a rotation axis of the sample analysis substrate;a drive circuit to drive the motor;a photodetector to measure a number of photons associated with the luminescence from the sample being transmitted through the window of the measurement chamber; anda control circuit to calculate a measurement value of the luminescence of the sample by using a number of photons measured, by the photodetector, while the motor rotates the sample analysis substrate.2. The sample analysis device of claim 1 , wherein claim 1 ,the photodetector outputs at least one first measurement value and at least one second measurement value while the sample analysis substrate rotates; andthe control circuit calculates a measurement value of the luminescence of the sample by correcting the at least one first measurement value with the at least one second measurement value.3. The sample analysis device of ...

CHEMICALLY SWITCHABLE ULTRAVIOLET PHOTOLUMINESCENCE

The present disclosure pertains to the use of intense, narrow-linewidth surface, chemically-switchable ultraviolet photoluminescence from radiative recombination of the two-dimensional electron liquid with photo-excited holes in complex oxide heterostructures, such as LaAlO/SrTiO(LAO/STO). Such photoluminescence from the interface between the upper and lower layers can be suppressed and restored reversibly under oxidizing and reducing conditions, respectively, as induced by chemisorption and reversal of chemisorption on the exposed surface of the heterostructure's upper member. Making use of this chemically-switchable ultraviolet photoluminescence, the present disclosure provides, inter alia, systems for detection of a chemical species, methods for determining the absence or presence of a chemical species in a sample, optoelectronic devices, and methods for producing optoelectronic devices. 1. A system for detection of a chemical species comprising: wherein chemisorption of said chemical species at the exposed surface of the upper member produces ultraviolet photoluminescence at the interface between the upper and lower members, and', 'wherein said upper member has a thickness of up to about 30 unit cells; and,, 'a complex oxide heterostructure comprising an upper member having an exposed surface, a lower member, and an interface between the upper and lower members,'}a sensor for determining the absence or presence of ultraviolet photoluminescence at the interface.2. The system according to claim 1 , wherein said chemical species is characterized as donating up to one-half electron per unit cell of said upper member when chemisorbed onto the exposed surface of said upper member.3. The system according to claim 1 , wherein said chemical species is characterized as filling an oxygen vacancy on the exposed surface of said upper member.4. The system according to claim 1 , wherein said chemical species is a molecule containing an alkali or transition metal and at least ...

MEASURING DEVICE

A measuring apparatus for determining at least one measurand of a measuring medium includes a first measuring device including a first measuring sensor structured to contact the measuring medium and configured to detect measured values of the at least one measurand, the first measuring device embodied to determine a first measured value that is dependent on the at least one measurand of the measuring medium, a sampling device structured to remove a sample from the measuring medium, a second measuring device including a second measuring sensor and embodied to determine a second measured value that is dependent on the least one measurand of the sample, and an electronic control apparatus configured to receive and process the first and second measured value and to perform a verification, calibration and/or adjustment of the first measuring device using the second measured value. 1. A measuring apparatus for determining at least one measurand of a measuring medium comprising:a first measuring device including a first measuring sensor structured to contact a the measuring medium and configured to detect measured values of at least one measurand of the measuring medium, the first measuring device embodied to determine, by means of the first measuring sensor, a first measured value that is dependent on the at least one measurand of the measuring medium;a sampling device structured to take a sample from the measuring medium;a second measuring device including a second measuring sensor and embodied to determine, by means of the second measuring sensor, a second measured value that is dependent on the least one measurand of the sample taken from the measuring media; andan electronic control apparatus configured to receive and process the first and second measured values and to perform a verification, calibration and/or adjustment of the first measuring device using the second measured value.2. The measuring apparatus according to claim 1 , wherein the measuring medium is ...

SIGNAL PROCESSING DEVICE AND SIGNAL PROCESSING METHOD

Provided is a signal processing apparatus including a first measurement unit which acquires a first time-series signal with a first time resolution; a second measurement unit which acquires a second time-series signal with a second time resolution higher than the first time resolution; and a determination unit which determines a measurement abnormality based on the second time-series signal. The normal measurement is performed based on the first time-series signal while the measurement abnormality determination is performed based on the acquired second time-series signal. 1. A signal processing apparatus , comprising:a first measurement unit which acquires a first time-series signal with a first time resolution;a second measurement unit which acquires a second time-series signal with a second time resolution higher than the first time resolution; anda determination unit which determines a measurement abnormality of the automatic analysis apparatus based on the second time-series signal.2. The signal processing apparatus according to claim 1 , wherein the determination unit determines a measurement abnormality of the automatic analysis apparatus based on a feature amount associated with a peak position of the second time-series signal.3. The signal processing apparatus according to claim 2 , wherein the determination unit determines a measurement abnormality of the automatic analysis apparatus based on feature amounts in the vicinities of a starting point and an end point of a peak portion including a peak position of the second time-series signal.4. The signal processing apparatus according to claim 1 , wherein the determination unit determines a measurement abnormality of the automatic analysis apparatus based on a feature amount of a rising portion of the second time-series signal.5. The signal processing apparatus according to claim 1 , wherein the determination unit determines a measurement abnormality of the automatic analysis apparatus based on at least one of ...

METHODS AND APPARATUS FOR MEASURING LUMINESCENCE AND ABSORBANCE

An automated chemistry analyzer includes a first fiber optic bundle that is used to guide a signal. The automated chemistry analyzer also includes a photomultiplier detector tube (PMT) that receives the guided signal from the first fiber optic bundle and produces an output PMT signal. The output PMT signal is used by the automated chemistry analyzer to derive chemi-luminescence and absorbance. 1. An automated chemistry analyzer , comprising:a first fiber optic bundle used to guide radiation;a single photomultiplier detector tube (PMT) that receives the guided radiation from the first fiber optic bundle and produces a single output PMT signal;a second fiber optic bundle; switched to an “on” setting during at least a portion of time when absorbance readings are taken; and', 'switched to an “off” setting when chemi-luminescence readings are taken;, 'a lamp positioned to illuminate at least one fiber of the second fiber optic bundle, the lampa scan head associated with the first fiber optic bundle and having a shutter mechanism shaped to reduce crosstalk; anda microprocessor that receives the single output PMT signal and applies algorithms to derive both chemi-luminescence and absorbance from the signal output PMT signal.2. The automated chemistry analyzer of claim 1 , wherein the scan head uses the first fiber optic bundle to guide radiation.3. The automated chemistry analyzer of claim 2 , wherein the scan head is fixed.4. The automated chemistry analyzer of claim 2 , wherein the scan head is movable.5. The automated chemistry analyzer of claim 2 , further comprising:a reaction plate; andone or more racks removably attached to the reaction plate, each rack having holes or grooves shaped to hold a respective sample container to be examined by the scan head.6. The automated chemistry analyzer of claim 5 , wherein the scan head is positioned over each sample container to take at least one of the chemi-luminescence reading or the absorbance reading.7. The automated ...

Luminescence Reference Standards

The present teachings provide for systems, and components thereof, for detecting and/or analyzing light. These systems can include, among others, optical reference standards utilizing luminophores, such as nanocrystals, for calibrating, validating, and/or monitoring light-detection systems, before, during, and/or after sample analysis. 15-. (canceled)6. A system for biological reactions , comprising:a frame configured to support a sample support configured to support one or more biological samples; a light-producing element layer; and', 'a second layer comprising at least one of a spectral filter layer, an intensify filter layer, a subtractive element layer, or a protective coating layer positioned adjacent the light-producing element;, 'a reference standard disposed to provide optical access to the one or more biological samples, the reference standard includes a plurality of layers, comprisinga light source configured to illuminate (1) the one or more biological samples and (2) the light-producing element through the second layer;a detector configured to receive light from the one or more biological samples and to receive light that is emitted, reflected, or scattered from the light-producing element;an optical system configured to direct light from the biological samples and the light-producing element to the detector.7. The system of claim 6 , further comprising a support layer configured to provide structural support for the reference standard.8. The system of claim 7 , wherein the light-producing element comprises a layer positioned on the support layer.9. The system of claim 7 , further comprising a mask disposed above the light-producing element layer claim 7 , wherein the light-producing element layer and the mask are separated by the second layer.10. The system of claim 6 , further comprising a light-blocking element defining a calibration mark on the light-producing element layer.11. The system of claim 10 , wherein the light-blocking element forms a mask ...

UNIVERSAL MULTIDETECTION SYSTEM FOR MICROPLATES

An apparatus for optically analyzing a sample may include an imaging subsystem that images the sample, one or more analyzing subsystems that analyze the sample, a temperature control subsystem that controls a temperature of the atmosphere within the apparatus, a gas control subsystem that controls a composition of the atmosphere within the apparatus, and a control module that controls the various subsystems of the apparatus. 1. A device for analyzing one or more samples , the device comprising:a receptacle support configured to support a microplate comprising a microplate well configured to hold a sample;an imaging subsystem configured to image the sample on a cell level;a non-imaging analyzing subsystem configured to analyze the sample on a well level, the non-imaging analyzing subsystem configured to provide at least one of a first measurement modality to measure an absorbance of the sample, a second measurement modality to measure fluorescence of the sample, and a third measurement modality to measure chemiluminescence of the sample.2. The device of claim 1 , further comprising:a positioning subsystem, the positioning subsystem being common to both the imaging subsystem and the non-imaging analyzing subsystem, and the positioning subsystem configured to position the receptacle support for the non-imaging analyzing subsystem to analyze the sample and the imaging subsystem to image the sample.3. The device of claim 2 , further comprising:an incubated chamber configured to incubate the sample.4. The device of claim 3 , further comprising:a housing that forms an exterior of the device and that encloses the non-imaging analyzing subsystem, the imaging subsystem, and the positioning subsystem.5. The device of claim 4 , wherein the non-imaging analyzing subsystem is configured to provide the first measurement modality claim 4 , the second measurement modality claim 4 , and the third measurement modality.6. The device of claim 5 , further comprising:a temperature control ...

HIGH SENSITIVITY BIOSENSOR USING PIXEL ANALYSIS OF CMOS IMAGE SENSOR

Provided are a method of analyzing a target substance to be measured, the method including: dividing a surface of a measuring unit of a CMOS image sensor into a plurality of pixels, directly fixing a bioreceptor onto the surface of the measuring unit of the CMOS image sensor, and measuring chemiluminescent signals depending on concentrations of the target substance to be measured, and a CMOS image sensor applied to the same. 1. A method of measuring a concentration of a target substance to be measured by using a CMOS image sensor , the method comprising:dividing a surface of a measuring unit of the CMOS image sensor into a plurality of pixels,fixing a bioreceptor onto the surface of the measuring unit of the CMOS image sensor, andanalyzing a chemiluminescent signal at each pixel.2. The method of claim 1 , wherein the analyzing is performed by selecting a cut-off value of the chemiluminescent signal claim 1 , and measuring the number of pixels indicating signals having the cut-off value or more.3. The method of claim 1 , wherein the analyzing is performed by selecting a cut-off value of the chemiluminescent signal claim 1 , and measuring the number of pixels indicating signals in which a difference in signal intensity between before and after performing a chemiluminescent reaction has the cut-off value or more.4. The method of claim 1 , wherein the pixel has a size of 0.01 to 100 μm.5. The method of claim 1 , wherein the target substance to be measured is at least one kind selected from the group consisting of enzymes claim 1 , proteins claim 1 , DNAs claim 1 , RNAs claim 1 , microorganisms claim 1 , animal and plant cells and organs.6. The method of claim 1 , wherein the bioreceptor is at least one kind selected from the group consisting of antibodies claim 1 , DNAs claim 1 , enzymes claim 1 , aptamers claim 1 , peptide nucleic acids (PNAs) claim 1 , and ligands.7. A CMOS image sensor comprising a measuring unit having a bioreceptor fixed onto a surface divided into ...

BIOLOGICAL ASSAY SAMPLE ANALYZER

A sample analyzer has an illuminator for illuminating an assay sample to cause luminescence, and a support for a sample vessel containing the assay sample. The support is adapted to position the assay sample proximate the illuminator. A detector is positioned along an optical axis extending from the illuminator, through the positioned assay sample, to the detector, so as to detect the luminescence from the assay sample. A reflector is removably disposed between the illuminator and the assay sample so as to reflect a portion of the luminescence back through the positioned assay sample toward the detector. 1. A sample analyzer , comprising:an illuminator;a support positioned to support a sample vessel containing an assay sample proximate the illuminator, such that the illuminator causes luminescence of the assay sample;a detector positioned along an optical axis extending from the illuminator, through the assay sample, to the detector, so as to detect the luminescence of the assay sample; anda reflector removably disposed between the illuminator and the assay sample, to reflect a portion of the luminescence back through the assay sample toward the detector.2. The sample analyzer of claim 1 , wherein the detector is positioned from about 2 mm to about 15 mm from the assay sample.3. The sample analyzer of claim 1 , wherein the detector is positioned from about 2 mm to about 7 mm from the assay sample.4. The sample analyzer of claim 1 , wherein the detector comprises a photomultiplier tube claim 1 , or a high sensitivity silicon avalanche photodiode detector.5. The sample analyzer of claim 1 , wherein the reflector is a flat mirror.6. The sample analyzer of claim 1 , wherein the reflector is a parabolic conic reflector.7. The sample analyzer of claim 1 , wherein the reflector is disposed on a shuttle claim 1 , the shuttle moveable to align the reflector with and perpendicular to the optical axis and adjacent the assay sample during a measuring mode of analysis claim 1 , ...

CALIBRATION OF FLUIDIC DEVICES

The present invention provides methods of calibrating a fluidic device useful for detecting an analyte of interest in a bodily fluid. The invention also provides methods for assessing the reliability of an assay for an analyte in a bodily fluid with the use of a fluidic device. Another aspect of the invention is a method for performing a trend analysis on the concentration of an analyte in a subject using a fluidic device. 1. A method of improving the accuracy of calibrating a fluidic system , comprising:a) providing a system for detecting an analyte in a bodily fluid from a subject comprising a fluidic device for providing said bodily fluid, said fluidic device having a calibration assembly and a reader assembly for detecting the presence of said analyte;b) measuring one or more parameters of a calibration curve associated with said fluidic device;c) comparing said one or more parameters with predetermined parameters associate with said fluidic device;d) adjusting a signal output by the ratio of said one or more parameters and said predetermined parameters.2. The method of wherein said predetermined parameters are parameters determined at the time the fluidic device is manufactured.3. The method of wherein said predetermined parameters are replaced with said measured one or more parameters to be used in a calibration curve to scale a signal to determine said analyte concentration.4. A method of improving the calibration of a fluidic system claim 2 , comprising:a) measuring a first signal in an original sample comprising a known quantity of an analyte:b) measuring a second signal after spiking said original sample with a known quantity of said analyte;c) plotting the difference between said first and second signals against a target value, wherein said target value is a signal expected for said known quantity of said analyte; andd) arriving at a best fit of parameters by minimizing the sum of the square of the differences between said target value and calculated ...

Unified detection system for fluorometry, luminometry and spectrometry

The devices and systems disclosed herein provide multiple optical capabilities in a single device or system. Methods for using these devices and systems are provided. These devices and systems are configurable for operation in each of a spectroscopy mode, a fluorescence mode, and a luminescence mode, and are capable of performing spectroscopic, fluorescence, and luminescence observations, measurements, and analyses when operated in the corresponding spectroscopy mode, fluorescence mode, or luminescence mode. These devices and systems include mirror dispersion elements having multiple faces including an optical dispersion element on one face (e.g., a diffraction grating or a prism) and a reflective element on another face (e.g., a mirror). These multiple capabilities eliminate the need to move or load a sample in multiple devices when subjecting a sample to multiple analyses, and thus provide greater accuracy, precision, and speed while reducing complexity and cost of sample analysis.

FRESHNESS MEASUREMENT SYSTEM

According to one embodiment, a freshness measurement system capable of quantitatively evaluating the freshness of a perishable food by a simpler method than a related art is provided. A freshness measurement system according to an embodiment includes an irradiation unit, a measurement unit, and a processing unit. The irradiation unit irradiates a phosphor that changes the intensity of fluorescence according to the concentration of a component released from a test subject with an excitation light. The measurement unit measures the intensity of fluorescence emitted by the phosphor. The processing unit determines the freshness index of the test subject using the intensity. The freshness index is, for example, a K value. 1. A freshness measurement system , comprising:an irradiation component configured to irradiate a phosphor that changes an intensity of fluorescence according to a concentration of a component released from a test subject with an excitation light;a measurement component configured to measure the intensity of fluorescence emitted by the phosphor; anda processor configured to determine a freshness index of the test subject using the measured intensity.2. The freshness measurement system according to claim 1 , wherein the freshness index is a K value.3. The freshness measurement system according to claim 1 , further comprising a notification component configured to make a notification of the freshness index.4. The freshness measurement system according to claim 1 , further comprising an installation part configured to install the phosphor so that the phosphor is exposed to a gas containing the component.5. The freshness measurement system according to claim 1 , further comprising the phosphor.6. The freshness measurement system according to claim 1 , wherein the excitation light irradiated by the irradiation component comprises ultraviolet light.7. The freshness measurement system according to claim 1 , wherein the freshness index of the test subject is ...

General-purpose optical measuring device and method of same

A general-purpose optical measuring device enables at least measurement of a nucleic acid amplification amount; detection or quantitative measurement by a nucleic acid detection method, an immunoassay method, an enzyme method; or measurement of concentration or absorbance, and a method of the same. There are included a photometric content designation unit, an irradiation reception pair including an emission end that can emit measurement light, and a reception end that can receive light from the emission end, a photometric container that can store measurement target chemical substance solution, and includes a bottom portion having a formed translucent region, a nozzle communicated with a suction discharge mechanism of gas, a flow tube, an optical measurement unit, and a control unit configured to suck and hold the chemical substance solution into the flow tube, or store the chemical substance solution into the photometric container.

RENAL CLEARABLE NANOCATALYSTS FOR DISEASE MONITORING

Aspects of the present disclosure relate to methods and compositions useful for in vivo and/or in vitro profiling of environmental triggers (e.g., enzyme activity, pH or temperature). In some embodiments, the disclosure provides methods of in vivo enzymatic processing of exogenous molecules followed by detection of nanocatalysts as representative of the presence of active enzymes (e.g., proteases) associated with a disease, for example, cancer or infection. In some embodiments, the disclosure provides compositions and methods for production of in vivo sensors comprising nanocatalysts. 1. An in vivo or in vitro sensor comprising a scaffold comprising an environmentally-responsive linker that is attached to a nanocatalyst , wherein the nanocatalyst is capable of being released from the scaffold when exposed to an environmental trigger , and optionally wherein the sensor is formulated for in vivo delivery , optionally wherein the environmental trigger is an enzyme.2. The sensor of claim 1 , wherein the scaffold encapsulates a nanocatalyst claim 1 , optionally wherein the scaffold is a liposome claim 1 , polymersome claim 1 , or a PLGA nanoparticle.3. The sensor of any one of - claim 1 , wherein the nanocatalyst is a catalytic nanocluster or a nanocatalyst claim 1 , optionally claim 1 , wherein the catalytic nanocluster is a transition metal nanocluster selected from the group consisting of a platinum nanocluster claim 1 , a silver nanocluster claim 1 , and a gold nanocluster and optionally claim 1 , wherein the nanocatalyst is selected from the group consisting of an iron oxide nanoparticle and an iridium nanoparticle.4. The sensor of any one of - claim 1 , wherein the environmentally-responsive linker is temperature-responsive claim 1 , pH-responsive claim 1 , or an enzyme-specific substrate.5. The sensor of any one of - claim 1 , wherein the nanocatalyst is less than 5 nm in size claim 1 , optionally less than 2 nm in size.6. The sensor of any one of - claim 1 , ...

CLINICAL DIAGNOSTIC SYSTEM INCLUDING INSTRUMENT AND CARTRIDGE

In embodiments disclosed herein, a diagnostic system is provided having a cartridge comprising at least one needle; at least one reservoir; at least one fluidic seal; and at least one fluidic channel of a fluidic pathway, wherein the cartridge is configured to store at least one reagent and at least one waste material on the cartridge. The diagnostic system is provided also having a diagnostic instrument comprising the fluidic pathway; an electrochemiluminescence (ECL) detection system; and a pump, wherein the fluidic pathway begins and ends in the cartridge and has a substantially single direction of flow in a pathway fluidically connecting the diagnostic instrument and the cartridge. 125-. (canceled)26. A method of performing a diagnostic test in a diagnostic system , comprising: structural members;', 'a body and a cover, wherein the body and the cover mate together;', 'at least one reagent handling station formed from the body;', 'a septum seal between the body and the cover configured to establish a liquid and air-tight seal for the at least one reagent handling station and capable of establishing a fluidic connection with at least one probe of a diagnostic instrument in the diagnostic system;', 'a bottom seal adjacent to the body;', 'at least one fluidic channel formed from the body and sealed by the bottom seal, wherein the bottom seal defines in part the volume of the at least one fluidic channel; and', a framework comprising at least one of the structural members of the cartridge; and', 'at least one needle capable of establishing a fluidic connection between the cartridge and the sample container when the at least one needle pierces a septum of the sample container, wherein the framework is configured to guide the sample container into a position such that the sample container is capable of being fixed at an angle ranging from about 45° to about 5° from a horizontal axis of the cartridge;, 'a mounting apparatus for mounting a sample container to the ...

Clinical diagnostic systems

A diagnostic system is provided herein that includes an instrument comprising an electrochemiluminescence (ECL) detector, and a cartridge configured to fit within a portion of the instrument, wherein the cartridge includes at least one reagent including an ECL label and a blood collection holder. Also provided herein is a system that includes a diagnostic instrument, which includes a pump, an ECL detector, an incubator, a magnet, and an output device, and a cartridge configured to fit within a portion of the diagnostic instrument, a sample holder configured to fit within the cartridge, and a closed fluidic loop between the diagnostic instrument and the cartridge when the cartridge is fit within a portion of the diagnostic instrument, wherein the cartridge is configured to accept a sample from the sample holder and place the sample in fluidic communication with the diagnostic instrument via the closed fluidic loop.

DEGRADABLE CATIONIC SURFACTANTS AND USE THEREOF IN ENHANCING CHEMILUMINESCENCE

The present invention relates to methods of enhancing chemiluminescence from a chemiluminescent label comprising contacting a chemiluminescent label with an acid in the presence of a degradable cationic surfactant and hydrogen peroxide followed by the addition of a base. Related kits containing such degradable cationic surfactant are also provided. The degradable cationic surfactant can compress light emission time of the chemiluminescent label to an extent that is comparable to or shorter than conventional surfactants. The degradable cationic surfactant can also increase chemiluminescence of the chemiluminescent label, providing increased light emission output that is comparable to conventional surfactants. 2. The method of claim 1 , wherein said chemiluminescent label is an acridinium dimethylphenyl ester claim 1 , an acridinium sulfonamide claim 1 , or a derivative or conjugate thereof.3. The method of claim 1 , further comprising compressing light emission time of said chemiluminescent label claim 1 , thereby providing a compressed emission time than a standard emission time without surfactants claim 1 , wherein said compressed emission time is comparable to that of cetyltrimethylammonium chloride.4. The method of claim 3 , wherein said compressed emission time is shorter than that of cetyltrimethylammonium chloride.5. The method of claim 3 , wherein said compressed emission time is about 20% shorter than that of cetyltrimethylammonium chloride.6. The method of claim 3 , wherein said compressed emission time is about 30% shorter than that of cetyltrimethylammonium chloride.7. The method of claim 3 , wherein said compressed emission time is about 50% shorter than that of cetyltrimethylammonium chloride.8. The method of claim 1 , wherein said surfactant is as effective as cetyltrimethylammonium chloride in enhancing total light yield of the chemiluminescent label.9. The method of claim 1 , further comprising increasing chemiluminescence of said chemiluminescent ...

Fiber Sensor

There is provided a sensor fiber including an electrically insulating material having a fiber length. At least one transduction element is disposed along at least a portion of the fiber length and is arranged for exposure to an intake species. A photoconducting element is in optical communication with the transduction element. At least one pair of electrically conducting electrodes are in electrical connection with the photoconducting element. The pair of electrodes extend the fiber length. 1. A sensor fiber comprising:an electrically insulating material having a fiber length;at least one transduction element disposed along at least a portion of the fiber length and arranged for exposure to an intake species;a photoconducting element in optical communication with the transduction element; andat least one pair of electrically conducting electrodes in electrical connection with the photoconducting element, the pair of electrodes extending the fiber length.2. The sensor fiber of wherein the transduction element extends the fiber length.3. The sensor fiber of wherein the transduction element is disposed at an end of the fiber.4. The sensor fiber of wherein the transduction element comprises a plurality of transduction elements claim 1 , each transduction element in the plurality disposed at a different site along the fiber length.5. The sensor fiber of wherein the transduction element comprises a layer of material.6. The sensor fiber of wherein the transduction element comprises a layer of material that is disposed on an internal wall of the sensor fiber.7. The sensor fiber of wherein the transduction element comprises a material that emits light upon exposure to an intake species.8. The sensor fiber of wherein the transduction element comprises a plurality of transduction elements claim 1 , each transduction element in the plurality emitting light upon exposure to a different intake species.9. The sensor fiber of wherein the transduction element comprises a material ...

Rapid multi-path micro-lens imaging ultra-micro immunoassay apparatus

The presently claimed invention applies to an immunoassay apparatus based on micro-lens imaging technique and related product. In a preferred embodiment, the immunoassay apparatus comprises a monochromatic light source module, an intelligent auto-scanning and imaging module, a temperature controlled transparent toughened glass platform, a central control module, and a touchscreen displaying module. By automatically performing scan in focus imaging on the micro-lenses immersing in antigen-antibody solution and analyzing the data of the image, the apparatus can monitor the refractive index change of a sample solution before and after antigen-antibody reaction, so as to determine the concentration of antigen or antibody in the solution without requiring any labeling, expensive enzymes, pre-immobilization/modification, and post-washing. It can detect ultra-micro amount of Ag/Ab (˜pg/mL) in very low sample volume solution (several μL) within 2 minutes. It is of high accuracy and reliability. Moreover, the apparatus is simple and compact, can be portable for on-site immunoassay. 1. A compact multi-path micro-lens imaging micro-immunoassay apparatus based on the technique of micro-lens imaging for assaying fluid sample , comprising:(a) a monochromatic light source module for illumination,(b) an intelligent auto-scanning and imaging module for auto-scan imaging of micro-lenses immersed in antigen-antibody or other ligand-receptor solution,(c) a temperature controlled transparent toughened glass platform for placing micro-lens multi-well test plate and controlling temperature,(d) a central control module with specially designed software unit for controlling auto-scan imaging, intelligent micro-lens image auto-recognition and data analysis,(e) a touchscreen displaying module for displaying operation touch keys and resulting images and data.2. In an apparatus as defined in wherein said monochromatic light source module is a monochromatic light source which emits monochromatic ...

NEW IRIDIUM-BASED COMPLEXES FOR ECL

Novel iridium-based Ir(III) luminescent complexes, conjugates comprising these complexes as a label and their application, for example in the electrochemiluminescence based detection of an analyte. 2. The compound according to claim 1 , wherein the linker Q is a saturated C1-C12 alkyl chain or a 1 to 12 atom chain with a backbone consisting of carbon atoms and one or more heteroatoms selected from O claim 1 , N and S.3. The compound according to claim 1 , wherein the functional group Y is selected from the group consisting of carboxylic acid claim 1 , N-hydroxysuccinimide ester claim 1 , amino group claim 1 , halogen claim 1 , sulfhydryl claim 1 , maleimido claim 1 , alkynyl claim 1 , azide and phosphoramidite.4. A conjugate comprising a compound according to and covalently bound thereto an affinity binding agent.5. The conjugate of claim 4 , wherein the affinity binding agent is selected from the group consisting of antigen and antibody claim 4 , biotin or biotin analogue and avidin or streptavidin claim 4 , sugar and lectin claim 4 , nucleic acid or nucleic acid analogue and complementary nucleic acid and receptor and ligand.6. The conjugate according to claim 4 , wherein said affinity binding agent is a nucleic acid or an antibody.7. A method for measuring an analyte by an in vitro method claim 4 , the method comprising the steps of:a) providing a sample suspected or known to comprise the analyte;{'claim-ref': {'@idref': 'CLM-00004', 'claim 4'}, 'b) contacting said sample with a conjugate according to under conditions appropriate for formation of an analyte conjugate complex; and'}c) measuring the complex formed in step (b) and thereby obtaining a measure of the analyte.8. The method of claim 7 , wherein said step of contacting is performed in an aqueous solution.9. The method of claim 7 , wherein the affinity binding agent is selected from the group consisting of antigen and antibody claim 7 , biotin or biotin analogue and avidin or streptavidin claim 7 , sugar ...

IMAGING SYSTEM

Disclosed is an imaging system which includes an imaging device to be used by multiple users, allows each user to perform imaging at an appropriate timing, and is capable of efficiently using the imaging device. An imaging system includes an imaging device, a plurality of terminal devices, and an authorization unit which gives the terminal devices the authority to specify controllable functions of the imaging device. The authorization unit switches between a first state where the terminal devices are given a first authority to exclusively occupy a part of functions of the imaging device with a controllable state and a second state where one terminal device is given a second authority to exclusively occupy and control the part of functions and to release the occupation, and the terminal devices other than one terminal device are given a third authority with the restriction of the control of the part of functions. 1. An imaging system comprising:an imaging device which photoelectrically reads fluorescence or chemiluminescence emitted from an object to image the object;a plurality of terminal devices which output control information for controlling the imaging device to the imaging device; andan authorization unit which gives the respective terminal devices an authority to specify controllable functions of the imaging device,wherein the authorization unit switches betweena first state where the respective terminal devices are given a first authority to exclusively occupy a part of functions of the imaging device and to bring the part of functions into a controllable state; anda second state where one terminal device among the plurality of terminal devices is given a second authority to exclusively occupy and control the part of functions and to release the occupation, and the terminal devices other than one terminal device are given a third authority with the restriction of the control of the part of functions.2. The imaging system according to claim 1 ,wherein the ...

SYSTEM FOR IMAGING CAPTURED CELLS

A system for imaging captured cells comprising: an illumination module configured to illuminate a target object; a platform configured to position the target object in relation to the illumination module; a filter module configured to filter light transmitted to the target object and/or to filter light received from the target object, an optical sensor configured to receive light from the target object and to generate image data; and a focusing and optics module configured to manipulate light transmitted to the optical sensor. The system can further comprise one or more of: a control system configured to control at least one of the illumination module, the platform, the focusing and optics module, the filter module, and the optical sensor; a tag identifying system configured to identify and communicate tag information from system elements; a thermal control module configured to adjust temperature parameters of the system; and an image stabilization module. 1. A system comprising: a platform configured to support a substrate, and', 'a heating element configurable to transfer heat to the substrate; and, 'a thermal control subsystem comprising a set of excitation filters,', 'a light source configured to transmit light toward an excitation filter of the set of excitation filters,', 'the excitation filter configured to receive light from the light source and transmit light from the light source toward the substrate,', 'a set of emission filters comprising an emission filter configured to receive light from the substrate and transmit light from the substrate toward a lens,', 'the lens configured to receive light from the emission filter and transmit light from the emission filter toward an optical sensor,', 'a platform control module configured to provide relative translation between components of the system and the platform along a direction perpendicular to a first axis perpendicular to a broad surface of the platform, to align the substrate with the light source, and', ...

SINGLE MOLECULE PEPTIDE SEQUENCING METHODS

The invention, in part, includes methods of single molecule protein sequencing that include using weak binding spectra in the amino acid identification. 1. A method of polypeptide sequencing comprising:(a) contacting a polypeptide with a non-optimized plurality of low-affinity amino acid binders to allow binding of one or more binders of the non-optimized plurality to a N-terminal amino acid of the polypeptide, wherein the binding produces a specific detectable signal;(b) identifying, based on the specific detectable signal, the N-terminal amino acid in the polypeptide, thereby generating an identified N-terminal amino acid;(c) removing the identified N-terminal amino acid in the polypeptide thereby exposing a subsequent N-terminal amino acid in the polypeptide; and(d) repeating steps (a) through (c) to identify the subsequent N-terminal amino acid in the polypeptide.2. The method of claim 1 , further comprising repeating steps (c) and (d) a sufficient number of times to identify a portion or all of the amino acid sequence of the peptide.3. The method of claim 1 , wherein the specific detectable signal is a fluorescent signal claim 1 , a luminescent signal claim 1 , or an electrical signal.4. The method of claim 1 , wherein the detectable signal is detected using a single-photon avalanche diode (SPAD) detection method.5. The method of claim 1 , further comprising determining the specific detectable signals produced by the binding of the one or more binders to the N-terminal amino acid and the subsequent N-terminal amino acid after removing the identified N-terminal amino acid in the polypeptide in step (c).6. The method of claim 5 , wherein a means of determining the specific detectable signals comprises an optical detection method.7. The method of claim 6 , wherein the optical detection method comprises microscopy.8. The method of claim 5 , wherein a means of determining the specific detectable signals comprises an electrical detection method.9. The method of claim ...

COMPOSITIONS AND METHODS FOR DETECTING GROUP B STREPTOCOCCUS NUCLEIC ACID

Disclosed are nucleic acid oligomers, including amplification oligomers and detection probes, for detection of Group B (GBS; ) nucleic acid. Also disclosed are methods of specific nucleic acid amplification and detection using the disclosed oligomers, as well as corresponding reaction mixtures and kits. 127-. (canceled)28Streptococcus. A composition for determining the presence or absence of Group B (GBS) in a sample , said composition comprising: [ '(B) SEQ ID NO:4, or an RNA equivalent or DNA/RNA chimeric thereof; and', '(a) (A) SEQ ID NO:3, or an RNA equivalent or DNA/RNA chimeric thereof, and'}, '(B) SEQ ID NO:8, or an RNA equivalent or DNA/RNA chimeric thereof.', '(b) (A) SEQ ID NO:7, or an RNA equivalent or DNA/RNA chimeric thereof, and'}], 'an amplification oligomer combination comprising first and second SIP-specific amplification oligomers capable of amplifying a target region of a GBS SIP target nucleic acid, wherein the first and second SIP-specific amplification oligomers comprise, respectively, first (A) and second (B) SIP-specific target-hybridizing sequences selected from the group consisting of'}29. The composition of claim 28 , wherein the first and second SIP-specific target-hybridizing sequences are the target-hybridizing sequences of (a).30. The composition of claim 28 , wherein the first and second SIP-specific target-hybridizing sequences are the target-hybridizing sequences of (b).31. The composition of claim 28 , wherein said composition further comprises a SIP-specific detection probe oligomer comprising a SIP-specific detection probe target-hybridizing sequence that is from about 15 to about 35 nucleotides in length and is configured to hybridize to a target sequence contained within a SIP amplicon amplifiable by the first and second SIP-specific amplification oligomers.32. The composition of claim 31 , wherein the first and second SIP-specific target-hybridizing sequences are the target-hybridizing sequences of (a) and the SIP-specific ...

WIDE RANGE LUMINESCENT IMMUNOASSAYS

The present invention relates to a method for quantitating an analyte having a wide range concentration in a single assay without having to dilute the sample and repeating the assay. The key feature of the invention is having two cycles of events including sample binding to probe, binding reactions, and detection. After the first cycle of binding and detecting, the probe is dipped into the same sample vessel to bind additional analyte in the sample vessel at a condition that is more favorable to binding than the condition in the first cycle. 1. A method of detecting an analyte in a wide concentration range in a liquid sample , comprising the steps in the order of:(a) obtaining a probe having a first antibody immobilized on the tip of the probe, wherein the diameter of the tip surface area is ≦5 mm;(b) dipping the probe tip into a sample vessel containing a sample solution having an analyte to bind the analyte to the first antibody on the probe tip;(c) dipping the probe tip into a reagent vessel containing a reagent solution comprising a reagent of a second antibody conjugated with a first member of a binding pair to bind the reagent to the analyte, wherein the first antibody and the second antibody are antibodies against the analyte;(d) dipping the probe tip into a washing vessel containing a wash solution to wash the probe tip;(e) dipping the probe tip into an amplification vessel containing an amplification solution comprising a second member of the binding pair conjugated with one or more luminescent labels, to form an immunocomplex of the analyte, the first antibody, the second antibody, and the first and the second members of the binding pair on the probe tip;(f) obtaining a first result by measuring a luminescent signal of the immunocomplex formed on the probe tip;(g) dipping the probe tip of (f) without further processing into the same sample vessel and flowing the sample solution laterally in the sample vessel in a more favorable binding condition of a ...

OPTOELECTRONIC DETECTION SYSTEM

The invention relates to optoelectronic systems for detecting one or more target particles. The system includes a reaction chamber, a specimen collector, an optical detector, and a reservoir containing cells, each of the cells having receptors which are present on the surface of each cell and are specific for the target particle to be detected, where binding of the target particle to the receptors directly or indirectly activates a reporter molecule, thereby producing a measurable optical signal. 1. A method for detecting a target particle in a liquid sample comprising:a) adding the liquid sample to a chamber;b) adding emitting cells, comprising one or more receptors (such as antibodies) suitable for interaction with a target particle and emitter molecules that emit photons (luminescence or fluorescence) in response to one or more receptors interacting with the target particle, to the chamber to form a mixture;c) measuring for photon emission from the cells in the mixture (luminescence or fluorescence).2. A method for detecting a target particle in a liquid sample comprising:a) adding emitter cells, comprising one or more receptors suitable for interaction with a target particle and emitter molecules that emit photons in response to one or more receptors interacting with the target particle, to a chamber;b) localizing the cells within the chamber by sedimentation;c) adding target particles in a liquid sample to form a mixture;d) localizing the target particles by allowing sedimentation;e) measuring for photon emission from the cells in the mixture.3. A method for detecting a target particle in a liquid sample comprising:a) adding emitter cells, comprising one or more receptors suitable for interaction with a target particle and emitter molecules that emit photons in response to one or more receptors interacting with the target particle, to a chamber;b) localizing the cells within the chamber by sedimentation;c) adding target particles in a liquid sample to form a ...

MULTIPLE REACTION PARALLEL MEASUREMENT APPARATUS AND METHOD FOR THE SAME

A multiple reaction parallel measurement apparatus is intended to measure a large number of reactions quickly, simply and with high accuracy. The apparatus includes: a plurality of light guiding paths corresponding to a plurality of reaction spot array elements, including a measuring end able to be in proximity of or in contact with each one of the reaction spots, and arranged to guide light generated by a reaction at the reaction spot to a connecting end; a measurement head arranged such that the measuring ends reach all together predetermined measurement positions of the corresponding reaction spots of the reaction spot array elements at a predetermined scan period; a light guiding path selector including a light guiding region optically connected to the connecting end; a light receiving unit; and a digital data converter to obtain digital data by converting image region data obtained from the light receiving unit. 1. A multiple reaction parallel measurement apparatus comprising:a reaction spot array body constituted with a plurality of reaction spot array elements including two or more reaction spots on which reaction related to measurement takes place and arranged in a predetermined mode distinguishable from the outside;a plurality of light guiding paths provided corresponding to the reaction spot array element, including a measuring end configured to be able to be in proximity of or in contact with each one of the reaction spots, and arranged so as to be able to guide light obtained on the basis of an optical state that can be generated by a reaction at the reaction spot to a connecting end;a measurement head relatively movably arranged with respect to the array body such that the measuring ends of the plurality of light guiding paths reach all together predetermined measurement positions of the corresponding reaction spots of the respective reaction spot array elements at a predetermined scan period;a light guiding path selector configured to select the ...

METHOD OF MONITORING AN OPERATION OF DETECTION OF AN ANALYTE IN A LIQUID SAMPLE

A method of monitoring detection of an analyte in a liquid sample using a measuring cell, the measuring cell comprising a working electrode for excitation of electrochemiluminescence in the liquid sample, an optical detector for detecting the excited electrochemiluminescence, the excitation and detection being performed in an measurement cycle, the measurement cycle comprising transporting the liquid sample via a transport path to the working electrode using a support liquid, the method comprising: coupling light of a light source into the transport path during part of the measurement cycle, the transport path forming a light guide between the light source and the optical detector, detecting the coupled light by the optical detector, analyzing the detected light for a gas bubble in the transport path, providing a measurement state if the result of the analysis deviates from a target state regarding the presence of a gas bubble in the transport path. 1. A method of monitoring an operation of detection of an analyte in a liquid sample using a measuring cell , the measuring cell comprising a working electrode for excitation of electrochemiluminescence in the liquid sample , an optical detector for detecting the excited electrochemiluminescence , the excitation and detection being performed in an electrochemiluminescence measurement cycle , the measurement cycle comprising transporting the liquid sample via a transport path to the working electrode using a support liquid , the method comprising:coupling light of a light source into the transport path during part of the measurement cycle, the transport path forming a light guide between the light source and the optical detector,detecting the coupled light by the optical detector,analyzing the detected light regarding the presence of a gas bubble in the transport path,providing a measurement state in case the result of the analysis deviates from a target state regarding the presence of a gas bubble in the transport path.2 ...

LIQUID AND PLATE SENSORS FOR MICROPLATE INJECTOR SYSTEM

In a sample analyzing apparatus, an injector assembly injects a reagent onto a sample, and luminescent light from the sample is transmitted to a detector. The assembly may be movable toward and away from the sample. The assembly may include one or more needles that communicate with one or more reservoirs supplying reagent or other liquids. The assembly may include a light guide for communicating with the detector. A cartridge may be provided in which the assembly, one or more reservoirs, and one or more pumps are disposed. The cartridge and/or the apparatus may be configured for enabling rinsing or priming to be done outside the apparatus. The cartridge and/or the apparatus may include one or more types of sensors configured for detecting, for example, the presence of liquid or bubbles in one or more locations of the apparatus and/or the cartridge. 1. A sample analyzing apparatus , comprising:an apparatus housing;a sample carrier disposed in the apparatus housing and configured for supporting a sample;a reagent reservoir;a pump communicating with the reagent reservoir;an injector assembly disposed in the apparatus housing and comprising an injector housing and an injector needle extending through the injector housing and configured for communicating with the reagent reservoir via the pump; anda luminescence detector positioned in the apparatus housing to receive optical signals from the sample.2. The sample analyzing apparatus of claim 1 , wherein the sample carrier is movable to align the injector assembly with a sample contained on the sample carrier.3. The sample analyzing apparatus of claim 1 , comprising a luminescence cartridge removably mounted at the sample analyzing apparatus claim 1 , the luminescence cartridge comprising a cartridge housing comprising a cartridge housing opening claim 1 , and a driver disposed in the cartridge housing claim 1 , wherein the reservoir support and the pump are disposed in the cartridge housing claim 1 , and the injector ...

GASTROINTESTINAL TRACT DETECTION METHODS, DEVICES AND SYSTEMS

The present disclosure relates to gastrointestinal (GI) tract detection methods, devices and systems. 1. A composition , comprising:a dye; anda reagent capable of selectively lysing eukaryotic cells.2130.-. (canceled)131. The composition of claim 1 , wherein the dye is capable of binding to or reacting with a target component of a viable cell.132. The composition of claim 131 , wherein the dye exhibits fluorescence that is measurably altered when the dye is bound to or reacted with the target component of the viable cell.13311. The composition of claim claim 131 , wherein the dye exhibits fluorescence when bound to a nucleic acid.134. The composition of claim 1 , wherein the dye is a lipophilic dye that exhibits fluorescence when metabolized by a cell.135. The composition of claim 1 , wherein the dye exhibits fluorescence when reduced by a cell or a cell component.136. The composition of claim 1 , wherein the dye comprises a member selected from the group consisting of resazurin claim 1 , C-resazurin claim 1 , 7-hydroxy-9H-(1 claim 1 ,3 dichloro-9 claim 1 ,9-dimethylacridin-2-ol) N-oxide claim 1 , 6-chloro-9-nitro-5-oxo-5H-benzo[a]phenoxazine claim 1 , and a tetrazolium salt.137. The composition of claim 1 , wherein the dye exhibits fluorescence when oxidized by a cell or a cell component.138. The composition of claim 1 , wherein the dye exhibits fluorescence when de-acetylated and/or oxidized by a cell or a cell component.139. The composition of claim 1 , wherein the dye exhibits fluorescence when reacted with a peptidase.140. The composition of claim 1 , wherein the dye comprises a chemiluminescent dye that exhibits chemiluminescence when metabolized by a viable cell.141. The composition of claim 1 , wherein the dye comprises luminol.142. The composition of claim 1 , wherein the reagent comprises a detergent.143. The composition of claim 1 , wherein the reagent comprises a non-ionic detergent.144. The composition of claim 1 , further comprising a second reagent ...

ASSAY METHODS

The present disclosure is directed to a kit for the detection of an analyte of interest in a sample comprising, in one or more vials, containers, or compartments, a. a surface comprising (i) a capture reagent for the analyte, said capture reagent bound to the surface, and (ii) an anchoring reagent bound to an anchoring oligonucleotide sequence, said anchoring reagent bound to the surface, b. a first detection reagent for the analyte that is linked to a first nucleic acid probe, wherein the first nucleic acid probe comprises an extended sequence that is complementary to the anchoring oligonucleotide sequence and c. a second detection reagent for the analyte that is linked to a second nucleic acid probe. 1. A method of detecting an analyte of interest in a sample comprising:a. binding the analyte to: (i) a capture reagent on a surface comprising the capture reagent for the analyte, and an anchoring reagent comprising an anchoring oligonucleotide sequence; (ii) a first detection reagent for the analyte that is linked to a first nucleic acid probe; and (iii) a second detection reagent for the analyte that is linked to a second nucleic acid probe; thereby forming a complex on the surface comprising the binding reagent, the analyte and the first and second detection reagents;b. using an extension process that requires the first and second probes to be in proximity, extending the second probe to form an extended sequence comprising an anchoring sequence complement that is complementary to the anchoring sequence;c. hybridizing the anchoring sequence to the anchoring sequence complement; andd. measuring the amount of extended sequence bound to the surface.2. The method of wherein the capture reagent is an antibody claim 1 , antigen claim 1 , ligand claim 1 , receptor claim 1 , oligonucleotide claim 1 , hapten claim 1 , epitope claim 1 , mimitope claim 1 , or an aptamer.3. The method of wherein the capture reagent is an antibody.4. The method of wherein the first detection ...

MEASUREMENT METHOD AND MEASUREMENT DEVICE

A method according to one or more aspects may be a method of measuring a detection material contained in a sample by using a cartridge including: chambers each capable of housing at least one of the detection material and a reagent; and a path through which the detection material is transferred between the chambers. The method may include: moving at least one of the chambers and the path to a measurement position and an image capturing range by rotating the cartridge about a rotational shaft; measuring the detection material in the measurement position; and capturing an image of a monitoring target comprising at least one of the chambers and the path in the image capturing range. 1. A measurement method for measuring a detection material contained in a sample by using a cartridge comprising: chambers each capable of housing at least one of the detection material and a reagent; and a path through which the detection material is transferred between the chambers , the method comprising:moving at least one of the chambers and the path to a measurement position and an image capturing range by rotating the cartridge about a rotational shaft;measuring the detection material in the measurement position; andcapturing an image of a monitoring target comprising at least one of the chambers and the path in the image capturing range.2. The measurement method according to claim 1 , whereinmeasuring the detection material comprises measuring light attributable to the detection material moved to the measurement position.3. The measurement method according to claim 1 , whereinthe image is captured in a direction facing to a surface of the cartridge, andthe image capturing range is disposed on a circumferential movement path on which the monitoring target moves with rotation.4. The measurement method according to claim 3 , whereinthe image capturing range is disposed at a distance between L1 and L2 inclusive (L2>L1) from the rotational shaft, andin the cartridge, the monitoring ...

Oxidase-based chemiluminescence assay of phagocytic leukocytes in whole blood and body fluids applicable to point-of-care (poc) diagnostic testing point-of-care (poc) measurement of absolute neutrophil function (anf)

A method for estimating a number of phagocytes in a body fluid of an animal includes stimulating NADPH oxidase activity of the phagocytes; and quantifying a resulting reductive deoxygenation of a chemiluminigenic substrate by an emitted chemiluminescence of the chemiluminigenic substrate using an instrument capable of measuring light. The NADPH oxidase activity of the phagocytes is preferably stimulated by an immunologic or chemical capable of activating a respiratory burst by the phagocytes, and by a stimulus in solution or coated to a surface contacted by the phagocytes. The stimulus is preferably phorbol myristate acetate (PMA). The animal is preferably human, and the body fluid is preferably blood and/or spinal fluid. The phagocytes are preferably neutrophil leukocytes, and the chemiluminigenic substrate is preferably lucigenin (N,N′-dimethyl-9,9′-biacridinium dinitrate). Also provided is a method of treatment based on the estimation method.

Method and device for pathogen or antibody detection using unmodified signaling substances with or without unlabeled detection reagents

Disclosed herein are methods and devices for pathogen or antibody detection using unmodified signaling substances with or without unlabeled detection reagents. Unmodified signaling substance include, but are not limited to, a molecule, a material or a part of a material that is not modified with an antibody, an antigen, a pathogen, a DNA probe or an aptamer molecule. Unlabeled detection reagent refers to an antibody, an antigen, a pathogen, a DNA probe, or an aptamer that is not labeled with a signaling molecule such as enzyme, biotin, streptavidin, fluorescence or chemiluminescence probe, etc.

CHEMICAL LUMINESCENCE ANALYSIS AND MEASUREMENT METHOD, SYSTEM USING SAME, AND KIT

A chemical luminescence immune analysis and measurement method, a system using the chemical luminescence immune analysis and measurement method, and a kit are disclosed. The method broadens a detection range and indicates an HD-HOOK sample or a sample that is beyond the detection range by way of selecting two signal values from signal values that are read in multiple times. 1. A chemical luminescence immune analysis and measurement method , comprising the following steps:(1) mixing and reacting a sample to be detected suspected of containing target molecules to be detected with reagents required for a chemiluminescent immunoreaction to form a mixture to be detected;{'sup': 'th', '(2) exciting the mixture to be detected successively t times to cause the mixture to be detected to undergo chemiluminescence, and recording n times signal values with respect to the chemiluminescence, wherein an n-time-recorded signal value with respect to the chemiluminescence is marked as RLUn;'}(3) selecting any two signal values from the signal values with respect to the chemiluminescence recorded in the n times, marking the selected two signal values as RLUm and RLUk, respectively, and marking a growth rate from RLUm to RLUk as A;(4) making a standard curve based on a series of known concentrations of standard substances containing the target molecules to be detected as well as a growth rate A′ from RLUm′ to RLUk′ read with respect to any two reactions of the standard substances happened in step (2) and step (3), wherein the concentrations of the standard substances are lower than a concentration at which a HOOK effect occurs; and(5) diluting the sample to be detected and measuring the diluted sample to be detected again, if the growth rate A is greater than a maximum value of the standard curve,wherein t, n, m, and k are natural numbers greater than 0, and k Подробнее

LUMINESCENT OXYGEN CHANNELING IMMUNOASSAY UTILIZING THREE ANTIBODIES AND METHODS OF PRODUCTION AND USE THEREOF

A chemiluminescent detection system, as well as kits and microfluidics devices containing same, are disclosed. Methods of using the system, kits, and devices are also disclosed. The first, second, and third antibodies or binding fragments thereof may be provided in any form that allows these antibodies/binding fragments to function in accordance with the presently disclosed and claimed inventive concept(s). For example, each of the first, second, and third antibodies/binding fragments may be a polyclonal antibody/binding fragment or a monoclonal antibody/binding fragment. 1. A kit containing a chemiluminescent detection system for a specific analyte , the kit comprising:(a) a first composition comprising a singlet-oxygen activatable chemiluminescent compound and a first antibody or binding fragment thereof associated therewith, wherein the first antibody or binding fragment thereof is a detection antibody that specifically binds to a first epitope of the analyte whereby the singlet-oxygen activatable chemiluminescent compound is capable of indirectly binding to the analyte via the first antibody or binding fragment thereof;(b) a second composition comprising a singlet-oxygen activatable chemiluminescent compound and a second antibody or binding fragment thereof associated therewith, wherein the second antibody or binding fragment thereof is a detection antibody that specifically binds to a second epitope of the analyte whereby the singlet-oxygen activatable chemiluminescent compound is capable of indirectly binding to the analyte via the second antibody or binding fragment thereof, and wherein the first and second epitopes at least partially overlap such that the first and second antibodies or binding fragments thereof cannot both bind to a single analyte molecule; and(c) a third composition comprising a third antibody or binding fragment thereof, the third antibody or binding fragment thereof being a capture antibody that specifically binds to a third epitope of ...

Gas analyzing apparatus

A gas analyzing apparatus includes a gas analyzing unit, a luminescence inducing component generating unit, and a measurement signal calculating unit. The gas analyzing unit receives a sample gas containing a component gas and/or a standard gas and the luminescence inducing gas. The gas analyzing unit is configured to output a detection signal based on an intensity of a reaction light generated by the interaction between the component gas and the luminescence inducing component. The luminescence inducing component generating unit generates the luminescence inducing gas by electric discharge generated repeatedly at specified intervals. The measurement signal calculating unit calculates a first measurement signal based on a first detection signal, based on the reaction light generated when the sample gas and the luminescence inducing gas are introduced, and a second detection signal, based on the reaction light generated when the standard gas and the luminescence inducing gas are introduced.

CHEMILUMINESCENCE DETECTOR SAMPLE ENCLOSURE

There is provided a chemiluminescence detector sample enclosure. The enclosure comprises a first interface member forming part of a chemiluminescence detector and having a first sealing element and a second interface member comprising a plurality of sample holders, each sample holder having a second sealing element. The first interface member is engagable with and moveable between sample holder subsets of the plurality of sample holders, engagement with a respective sample holder subset providing engagement of the first interface member with each sample holder of the respective sample holder subset and relative movement of the first and second interface members providing movement between sample holder subsets; and when the first interface member is engaged with each respective sample holder, the first sealing element and the respective second sealing element are adapted to interact so as to form a light restricting seal between the first interface member and said sample holder. 1. A chemiluminescence detector sample enclosure , comprising:a first interface member forming part of a chemiluminescence detector and having a first sealing element; anda second interface member comprising a plurality of sample holders, each sample holder having a second sealing element, whereinthe first interface member is engagable with and moveable between sample holder subsets of the plurality of sample holders, engagement with a respective sample holder subset providing engagement of the first interface member with each sample holder of the respective sample holder subset and relative movement of the first and second interface members providing movement between sample holder subsets, and whereinwhen the first interface member is engaged with each respective sample holder, the first sealing element and the respective second sealing element are adapted to interact so as to form a light restricting seal between the first interface member and said sample holder.2. The enclosure according ...

METHODS FOR WATERMARKING AND IDENTIFYING CHEMICAL COMPOSITIONS

The present disclosure provides methods and compositions to “watermark” chemical compounds. The disclosed methods provide methods whereby the unique watermark allows identification of substantially similar chemical reactions in a single qPCR reaction mixture. Further, the disclosure provides methods whereby the unique watermark allows for identification of reaction mixtures. 1. A method of verifying the synthesis of a chemical mixture , said method comprising i) a chemical mixture, comprising a first chemical component and a second chemical component;', 'ii) a first watermarking agent configured to emit a first detectable signal, wherein said first watermarking agent indicates the presence of said first chemical component; and', 'iii) a second watermarking agent configured to emit a second detectable signal, wherein said second watermarking agent indicates the presence of said second chemical component; and, 'a) providing a sample comprisingb) detecting the presence of said first detectable signal and said second detectable signal, thereby verifying the synthesis of said chemical composition.2. The method of claim 1 , further comprising obtaining a time stamp.3. The method of claim 2 , wherein said time stamp indicates a synthesis time.4. The method of claim 3 , further comprising outputting a report with a value of said first detectable signal claim 3 , a value of said detectable signal claim 3 , and said time stamp.5. The method of claim 1 , further comprising obtaining a geo-tag.6. The method of claim 5 , wherein said geo-tag indicates a location of verification of synthesis or a location of synthesis.7. A method of tracking a batch of chemical mixture claim 5 , said method comprising i) a chemical mixture; and', 'ii) a first watermarking agent configured to emit a first detectable signal, 'a) providing chemical mixture comprisingb) detecting said first detectable signal; andc) comparing said first detectable signal to a reference signal indicative of a batch of ...

CHEMILUMINESCENCE ANALYTICAL METHOD AND SYSTEM AND KIT USING SAME

Disclosed is a chemiluminescence analytical method in the technical field of chemiluminescence. The present method broadens a detection range and indicates an HD-HOOK sample or a sample that is beyond the detection range by way of selecting two signal values from signal values that are read in multiple times, and simply and quickly calculates the concentration of an analyte during detection. Disclosed are a system using the chemiluminescence analytical method and a kit for the chemiluminescence analytical method. 1. A chemiluminescence immune analytical method , comprising the following steps of:(1) mixing a sample to be detected suspected of containing a target molecule to be detected with a reagent required for a chemiluminescence immune reaction to react so as to form a mixture to be detected;{'sup': 'th', '(2) initiating the mixture to be detected for t times successively to generate chemiluminescence, and recording a signal value of the chemiluminescence for n times, wherein a signal value of the chemiluminescence recorded at the ntime is marked as RLUn;'}(3) selecting any two signal values from n-time recorded signal values of the chemiluminescence, marking the two signal values respectively as RLUm and RLUk, and marking a growth rate from RLUm to RLUk as A;(4) plotting a standard curve based on a growth rate A′ from RLUm′ to RLUk′ in any two reactions at step (2) and step (3) with respect to a series of standard substances with known concentrations containing the target molecule to be detected; and(5) comparing the growth rate A obtained at step (3) with the standard curve obtained at step (4) to determine a concentration of the target molecule to be detected,wherein t, n, m, and k are all natural numbers larger than 0, and k Подробнее

THREE-DIMENSIONAL TISSUE

Provided is a three-dimensional tissue, including: a first cellular region including cells of a first type; and a second cellular region including cells of a second type different from the first type, wherein the cells of the first type are cells that emit light by chemiluminescence, bioluminescence, or fluorescence in response to an external stimulus. 115-. (canceled)16. A three-dimensional tissue , comprising:a first cellular region that comprises cells of a first type; anda second cellular region that comprises cells of a second type different from the first type,wherein the cells of the first type are cells that emit light by chemiluminescence, bioluminescence, or fluorescence in response to an external stimulus.17. The three-dimensional tissue according to claim 16 ,wherein the cells of the first type are absent in the second cellular region, andwherein the cells of the first type are present abundantly in the first cellular region.18. The three-dimensional tissue according to claim 16 ,wherein relatively to the total region comprising both the first cellular region and the second cellular region, the proportion of the first cellular region is smaller than the proportion of the second cellular region.19. The three-dimensional tissue according to claim 16 ,wherein a surface of the first cellular region is present at a certain distance on an axis perpendicular to an interface to which a stimulus is applied.20. The three-dimensional tissue according to claim 16 ,wherein the first cellular region and the second cellular region are arranged inside a culture container.21. The three-dimensional tissue according to claim 20 ,wherein the first cellular region is not in contact with a circumferential wall of the culture container.22. The three-dimensional tissue according to claim 16 ,wherein a reporter gene is introduced into the cells of the first type.23. The three-dimensional tissue according to claim 16 ,wherein the cells of the second type are not cells that emit ...