29-11-2019 дата публикации
Номер: RU2707812C1
FIELD: biotechnologies.SUBSTANCE: invention relates to the biotechnology. Described is a method of treating an inflammatory disease, comprising administering to an individual in need thereof an ENO1 antibody, where the antibody specifically binds to the epitope on ENO1 and inhibits ENO1 activity as a plasminogen receptor, where epitope is located in region consisting of sequenceFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKS(SEQ ID NO:39) ENO1 human, where the inflammatory disease is selected from a group consisting of multiple sclerosis, rheumatoid arthritis, Crohn's disease, ulcerative colitis, systemic lupus erythematosus, chronic obstructive pulmonary disease (COPD), asthma, allergy, psoriasis, atherosclerosis and their combination. Also described is a method of treating an immune disorder, comprising administering to an individual in need thereof an ENO1 antibody, where the antibody binds to the epitope on ENO1 and inhibits ENO1 activity as a plasminogen receptor, where the epitope is located in a region consisting of sequence 296FDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKS336 (SEQ ID NO:39) human ENO1, wherein the immune disorder is selected from a group consisting of chronic obstructive pulmonary disease (COPD), type 1 diabetes, osteoporosis, atherosclerosis and combinations thereof. Disclosed is a pharmaceutical composition for treating an inflammatory disease comprising an effective amount of an antibody or fragment thereof scFv, Fab or F (ab), which specifically binds to the epitope on ENO1 and inhibits ENO1 activity as a plasminogen receptor, where epitope is located in region consisting of sequenceFDQDDWGAWQKFTASAGIQVVG DDLTVTNPKRIAKAVNEKS(SEQ ID NO: 39) human ENO1, where the inflammatory disease is selected from a group consisting of multiple sclerosis, rheumatoid arthritis, Crohn's disease, ulcerative colitis, systemic lupus erythematosus, chronic obstructive pulmonary disease (COPD), asthma, allergy, psoriasis, atherosclerosis and a combination thereof ...
Подробнее