Folding mast systems for watercraft

Improvements relating to masts

MULTI HULL BOAT

Water vehicle having a crane for lifting loads

The invention relates to a water vehicle (1) having a crane for lifting loads (15), said crane comprising a tower (11) and a boom (13) that can be rotated in relation to the tower, the tower being arranged within the outer contour of the water vehicle.

Adjustable ballast bulb for a sailing vessel

A sailing vessel is disclosed which comprises a hull, a keel depending from the hull and a mast. A ballast bulb is provided at the lower end of the keel. A first control mechanisms is provided for rotating the ballast bulb about a transverse axis to change the angle of attack of the bulb. A second control mechanism is provided for rotating the bulb about a longitudinal axis of the vessel.

INSTALLING A WIND TURBINE ON A SEMICONDUCTOR WAFER AND METHOD OF PRODUCING AN WITHOUT MAT HAS LATERAL SAILS

SHIP WITH AT LEAST ONE COLLAPSIBLE MAST

BIPLANE STEERABLE DEVICE FOR PROCESS

L'invention concerne un dispositif pour gréement biplan orientable pour la propulsion vélique d'un véhicule. La configuration « biplan » pour la propulsion vélique d'un véhicule est confronté au problème de la perte d'efficacité du plan sous le vent, lorsque l'orientation du vent apparent fait que le plan sous le vent se trouve dans les turbulences générées par le plan au vent. Pour pallier à ce problème, l'invention consiste en un dispositif qui permette la rotation du gréement biplan, de manière à pouvoir l'orienter de façon optimale quelque soit la direction du vent apparent par rapport au véhicule. En référence à la figure pour l'abrégé (figure 1), ce dispositif est constitué des principaux éléments suivants : une base (1) conçue pour reprendre les efforts du gréement et pour pouvoir pivoter autour d'un axe vertical, deux mâts (2) en appui sur la base, une barre de flèche (3) reliant les mâts, quatre haubans (4) reliant les mâts et la base de façon rendre l'ensemble géométriquement stable, les organes de contrôle (5) des éléments mobiles du gréement et de la voilure. Le dispositif selon l'invention est particulièrement destiné aux bateaux à voile. The invention relates to a biplane orientable rigging device for the propulsion of a vehicle. The "biplane" configuration for the propulsion of a vehicle is confronted with the problem of the loss of efficiency of the leeward plane, when the apparent wind direction causes the leeward plane to be in the turbulence generated by the plan in the wind. To overcome this problem, the invention consists of a device that allows the rotation of the biplane rig, so as to be able to orient it optimally regardless of the direction of the apparent wind relative to the vehicle. Referring to the figure for the abstract (Figure 1), this device consists of the following main elements: a base (1) designed to take the efforts of the rigging and to be able to pivot about a vertical axis, ...

[...] DEVICE OF A MAT ON A CATAMARAN WITH A FRONT BEAM

L'objet de l'invention est un agencement d'un catamaran de loisir, du type à propulsion par au moins une voile solidaire d'un mât (14-1) comprenant au moins une poutre (30) avant interposée entre les deux flotteurs, du type ferme triangulée avec au moins un entrait (30-1) et deux arbalétriers (30-2B, 30-2T) formant un triangle isocèle et munie de moyens (30-5) de réception dudit mât, caractérisé en ce que ces moyens (30-5) de réception du mât sont constitués d'au moins une bride (30-6) disposée au sommet de la poutre (30). The object of the invention is an arrangement of a recreational catamaran of the propulsion type by at least one sail attached to a mast (14-1) comprising at least one beam (30) front interposed between the two floats , of the firm triangulated type with at least one entering (30-1) and two rafters (30-2B, 30-2T) forming an isosceles triangle and provided with means (30-5) for receiving said mast, characterized in that these means (30-5) for receiving the mast consist of at least one flange (30-6) disposed at the top of the beam (30).

Antenna post for ships

СПЕЦИФИЧЕСКИЕ АНТИТЕЛА К АЛЬФА-ЕНОЛАЗЕ И СПОСОБ ПРИМЕНЕНИЯ ПРИ ИММУННЫХ ЗАБОЛЕВАНИЯХ

Folding mast systems for watercraft

DEVICE FOR THE CHANGE OF A KENTERMOMENTS OF A MEHRRUMPFBOOTES

Mast base assembly

The present invention is directed broadly to a marine vessel (10) comprising a deck (12) mounted to a hull (14) together with a sail (16) coupled to the marine vessel (10) via a mast base assembly (18). The mast base assembly (18) comprises a mast tilt assembly (22). The mast base assembly (18) also comprises a mast base mounting (20) to which the mast tilt assembly (22) is pivotally mounted for movement about a tilt axis (24) between stowed and operative positions. The mast base assembly (18) further comprises a sail slew assembly (26) mounted to the sail (16) associated with the marine vessel (10). The sail slew assembly (26) is operatively coupled to the mast tilt assembly (22) for slewing of the sail (16). The sail (16) is rotated or slewed about a slew axis (28) of the mast tilt assembly (22) to reorient the sail (16) relative to the marine vessel (10).

Stabilised rotary sail rigging

The invention relates to a stabilised rotary sail rigging for vessels, formed by a mast, a boom perpendicular to said mast and one or more sails bent on said shared boom and on the mast. The rigging can rotate freely, with all the elements that form same, about a vertical shaft, with the important and novel feature that the top of the mast is stabilised by means of shrouds and/or stays that tie same to the periphery of the deck or decks of the boat, without preventing the rotation of the rotary rigging about the vertical shaft. This stabilisation of the top of the mast also allows fixed headsails to be used.

MULTIPLE HULL BOAT

... : Ce bateau comprend quatre coques parallèles dont les deux coques centrales ont une longueur différente de celle des deux coques latérales, les extrémités postérieures des quatre coques étant situées sensiblement dans le même plan. La présente invention peut être appliquée à la réalisation de bateaux à déplacement rapide.

CANTILEVERED SAIL RIG

A wind powered craft carrying a generally vertical mast which is rotatable about its vertical axis, having a sail carried by the mast with its bottom edge attached in proximity to the bottom of the mast and extending to an attachment point in proximity to the top of the mast. A generally horseshoe-shaped member having an open end is and extending around said mast. The mast being rotatable within the horseshoe-shaped member. A bearing supported stationary member at the top of the mast is carried by the mast while allowing the mast to rotate. A support stay runs from the horseshoe-shaped member to the bearing supported member to support the horseshoe-shaped member. Additional stays are attached to the horseshoe-shaped member and splayed to attach to opposed sides of the hull of the watercraft. The sail is reefed around the mast through the open end of the horseshoe-shaped member.

SHIP WITH AT LEAST ONE COLLAPSIBLE MAST

La présente invention se rapporte à un navire (1) comportant un pont (P) et qui est équipé d'au moins un mât (2) pourvu d'une bôme (3), caractérisé par le fait que ledit mât (2) est solidaire d'un socle (4) implanté dans ledit pont (P), et en ce que ce mât (2) et ce socle (4) sont pourvus de moyens d'articulation mutuels (A), de sorte que ledit mât (2) est conformé pour être déplacé d'une position sensiblement verticale et perpendiculaire audit pont (P) dans laquelle son extrémité inférieure (20) est complètement engagée dans ledit socle (4), vers une position au moins partiellement basculée dans laquelle ladite partie inférieure (20) dudit mât (2) est au moins partiellement sortie dudit socle (4), la direction de basculement de la partie du mât (2) qui s'étend au-dessus desdits moyens d'articulation (A) étant orientée à l'opposé de ladite bôme (3). The present invention relates to a ship (1) having a bridge (P) and which is equipped with at least one mast (2) provided with a boom (3), characterized in that said mast (2) is secured to a base (4) implanted in said bridge (P), and in that said mast (2) and said base (4) are provided with mutual articulation means (A), so that said mast (2) ) is shaped to be moved from a position substantially vertical and perpendicular to said bridge (P) in which its lower end (20) is fully engaged in said base (4), to a position at least partially tilted in which said lower part ( 20) of said mast (2) is at least partially out of said base (4), the direction of tilting of the part of the mast (2) which extends above said articulation means (A) being oriented to the opposite said boom (3).

Method for rigging and controlling a wing sail

A rigging for a wing propelled craft comprises a mast having a starboard side and a port side, wherein the mast is controllably rotatable in either direction about a longitudinal axis; a flexible sail comprising a starboard flexible sail portion and a substantially identical port flexible sail portion, each flexible sail portion having a luff and a leach, wherein the luff of each sail portion is connected to a respective side of the mast; and a plurality of elongated battens, each of which extends substantially between the luff and the leach of one of the respective sail portions, each of which is in contact with the respective flexible sail portion. Rotation of the mast causes the battens connected to one of the sail portions to be compressed along their length so as to bend one of the sail portions to increase the camber thereof and causes the battens connected of the other sail portions to be tensioned along their length so as to partly straighten the other sail portion which changes ...

Device for varying a multihull capsizing torque

GREAGE DEVICE OF A MAT ON A CATAMARAN WITH A FRONT BEAM

MACHINE HAS VEIL HAS AUTOMATIC CONTRE-GITE

적재물을 리프팅하기 위한 크레인을 가진 선박

... 본 발명은 적재물 (15) 을 리프팅하기 위한 크레인을 가진 선박 (1) 에 관한 것이고, 상기 크레인은 타워 (11) 및 상기 타워에 대하여 회전할 수 있는 붐 (13) 을 포함하고, 상기 타워는 선박의 외부 윤곽 내부에 배열된다.

ENGIN A VOILE A CONTRE-GITE AUTOMATIQUE

L'INVENTION SE RAPPORTE A UN ENGIN A VOILE DU TYPE COMPRENANT UNE COQUE FLOTTANTE, UN MAT ARRIME SUR CETTE COQUE, UNE VOILE MONTEE SUR LE MAT ET UN MOYEN DE GOUVERNE. SELON L'INVENTION, LE MAT 2 EST MONTE ARTICULE VERS SA BASE AUTOUR D'UN AXE SENSIBLEMENT HORIZONTAL 8 TOURNANT DANS UNE STRUCTURE SOLIDAIRE DE LA COQUE 1 ET LE MAT ACTIONNE PAR UNE BARRE TRANSVERSALE 10 DES AILERONS DE BABORD 20 ET DE TRIBORD 19 QUI TOURNENT AUTOUR DE PIVOTS 13, 14 DE FACON A S'OPPOSER A LA GITE DU NAVIRE. UN PLAN DE GOUVERNE 7 ACTIONNABLE PAR UNE POIGNEE 6 MONTEE EN BOUT D'UN LEVIER 5 PERMET LA GOUVERNE DE L'ENGIN. L'INVENTION S'APPLIQUE AU SPORT DE LA VOILE.

Alpha-enolase specific antibodies and method of use in immune diseases

A method for treating an inflammatory disease or an immune disorder includes administering to a subject in need of such treatment an antagonist against ENO1. The antagonist binds ENO1 and inhibits ENO1 plasminogen receptor activity. The antagonist may be an anti-human ENO1 antibody, or an scFv, Fab, or F(ab) ...

Back guy roller rolling device

SAILING BOAT WITH IMPROVED MAST STRUCTURE

FORMING A SEMICONDUCTOR WAFER AND METHOD OF PRODUCING AN WITHOUT MAT HAS LATERAL SAILS

L'invention consiste à supprimer les mats verticaux des voiliers monocoques ou multicoques, portant les voiles, par des châssis latéraux (2) portant les voiles(1). fixés de chaque coté de la carène (3) et pouvant avoir un angle avec la carène selon les besoins de la navigation, donné par les moteurs électriques (16) et (17). Les voiles latérales élastiques (1) peuvent être formées par des boudins pneumatiques (4) et (5), à diamètre décroissant vers le centre de la voile, pour la meilleur prise au vent. Les châssis latéraux porte voile (2) portent un petit châssis porte voile (18) commandés par un moteur électrique (19) donnant l'angle nécessaire pour permettre selon le vent, une sortie de voile sans tourbillon. Ces dispositifs permettent aux voiliers monocoques ou multicoques sans mat vertical, mais avec des châssis porte voile latéraux, de naviguer sans risque de chavirage provoqué par des sautes de vent The invention consists in eliminating the vertical masts of monohull or multihull sailboats, carrying the sails, by side frames (2) carrying the sails (1). fixed on each side of the hull (3) and being able to have an angle with the hull according to the needs of navigation, given by the electric motors (16) and (17). The elastic side sails (1) can be formed by pneumatic flanges (4) and (5), with a diameter decreasing towards the center of the sail, for better wind resistance. The sail-carrying side frames (2) carry a small sail-carrying frame (18) controlled by an electric motor (19) giving the necessary angle to allow, depending on the wind, an exit of the sail without whirlwind. These devices allow monohull or multihull sailboats without a vertical mast, but with side sail-carrying frames, to navigate without the risk of capsizing caused by gusts of wind.

A propulsion system for a boat

Mast step and heel

Propulsion device

A wingsail 1 for a powered watercraft (100, Fig 16) comprising a first aerofoil element 10, a second aerofoil element 11, and a third aerofoil element 12. Each of the aerofoil elements is rotatable about an axis 10x, 11x, 12x and has an aerofoil section with a centre of area which is closer to its leading edge than its trailing edge. The aerofoil elements are movable to a configuration in which flow from the trailing edge of one of the first or third elements is directed toward the leading edge of the second element, and flow from the trailing edge of the second element is directed toward the leading edge of the other of the first or third element. A system comprising the wingsail and a controller arranged to control the aerofoils in response to a measured wind direction is also disclosed. A watercraft with the wingsail is also disclosed.

Alpha-enolase specific antibodies and method of use in immune diseases

A method for treating an inflammatory disease or an immune disorder includes administering to a subject in need of such treatment an antagonist against ENO1. The antagonist binds ENO1 and inhibits ENO1 plasminogen receptor activity. The antagonist may be an anti-human ENO1 antibody, or an scFv, Fab, or F(ab) ...

Water vehicle having a crane for lifting loads

The invention relates to a water vehicle (1) having a crane for lifting loads (15), said crane comprising a tower (11) and a boom (13) that can be rotated in relation to the tower, the tower being arranged within the outer contour of the water vehicle.

DEVICE FOR A ROTARY-STEERABLE BIPLANE

INSTALLING A WIND TURBINE ON A SEMICONDUCTOR WAFER AND METHOD OF PRODUCING AN WITHOUT MAT HAS LATERAL SAILS

L'innovation concerne les voiliers monocoques et multicoques (catamaran - trimaran) sans mat à voiles latérales. L'innovation consiste à installer sur des voiliers une ou plusieurs éoliennes verticales au dessus des châssis (2) porte voiles (1). disposés de chaque côté de la carène (3) Ceci est possible car il n'y a ni mat ni voile ni haubans. L'éolienne verticale (4) est placée sur un amortisseur du type antisismique (5) porté par une structure (6). Cette structure (6) est portée dans le fond de la carène, sur un autre amortisseur (7) pour isoler la structure (6) de la carène (3) et éviter des vibrations dans le navire. L'éolienne verticale (4) sert à charger les accumulateurs qui alimentent les moteurs électriques du voilier sans mat à voiles latérales ...

MACHINE HAS VEIL HAS AUTOMATIC CONTRE-GITE

Stayed roller furler

A wind powered craft carrying a generally vertical mast which is rotatable about its vertical axis, having a sail carried by the mast with its bottom edge attached in proximity to the bottom of the mast and extending to an attachment point in proximity to the top of the mast. A generally horseshoe-shaped member having an open end is and extending around said mast. The mast being rotatable within the horseshoe-shaped member. A bearing supported stationary member at the top of the mast is carried by the mast while allowing the mast to rotate. A support stay runs from the horseshoe-shaped member to the bearing supported member to support the horseshoe-shaped member. Additional stays are attached to the horseshoe-shaped member and splayed to attach to opposed sides of the hull of the watercraft. The sail is reefed around the mast through the open end of the horseshoe-shaped member.

EXTERNAL TACKLE SYSTEM OF MAST CAPABLE OF TURNING

The invention relates to a mast, mounted on board with bearing, fixed to the board by a tackle system, consisting of shrouds led at one or more level from the surface of the mast, fixed through rollers or similar connecting parts running on formable elements fasted on more than one point of the mast surface at the same or nearly same horizontal level, or on runner moving on elliptic rigid orbit, then (the shroud) led through spreader construction keeping distance from the mast, to the board or other stabile place of the sailing vessel, where the spreader construction is built of more than one rod, mounted with swivels in certain distance from each other on or near the surface of the mast, and are connected again by swivels by bar or similar rigid construction with the same or similar length as the distance of the rods connection on the mast surface, and the shroud is lent to and through this coupling bar, the overall stabilizing system enabling the mast to turn along its vertical axis.

ALPHA-ENOLASE SPECIFIC ANTIBODIES AND METHOD OF USE IN IMMUNE DISEASES

A method for treating an inflammatory disease or an immune disorder includes administering to a subject in need of such treatment an antagonist against ENO1. The antagonist binds ENO1 and inhibits ENO1 plasminogen receptor activity. The antagonist may be an anti-human ENO1 antibody, or an scFv, Fab, or F(ab)2 fragment thereof, that specifically binds to human ENO1 (GenBank: AAH50642.1) for the treatment of an inflammatory disease or an immune disorder, which may be multiple sclerosis, rheumatoid arthritis, Crohn's disease, ulcerative colitis, systemic Lupus erythematosus, chronic obstructive pulmonary disease (COPD), asthma, allergy, psoriasis, type 1 diabetes mellitus, artherosclerosis or osteoporosis.

Mast holder

A mast holder 1 comprises a carriage 3 to receive a mast heel 20. The carriage is arranged for translational movement on a base 4 of the holder, and the holder comprises a latch arrangement 6 to releasably secure the mast heel in the carriage. The latch arrangement is arranged to releasably lock the mast heel to the carriage. An adjuster that allows translational positioning of the carriage and therefore adjustment of the rake angle of the mast, is also provided.

SAILING BOAT WITH IMPROVED MAST STRUCTURE

... 1,224,690. Masts and sails. A. J. G. BAUDOU. 8 Oct., 1969 [8 Oct., 1968], No. 49524/69. Heading B7V. A sailing boat mast structure comprises two parallel masts 10, 10a each of which is mounted for rotation about its own axis in a rigid support capable of rotating freely about supporting shaft 1. Two sails are each fitted between a mast and a boom perpendicular to the mast, and the shaft 1 is fixed to the hull at a point in the longitudinal median plane of the hull and extends vertically or at a slight angle to the vertical. In Fig. 4 a rectangular sail is shown hoisted between the two masts, the assembly of the three sails 11, 11a and 11b then forming a good spinnaker with a following wind.

Cantilevered sail rig

A wind powered craft carrying a generally vertical mast which is rotatable about its vertical axis, having a sail carried by the mast with its bottom edge attached in proximity to the bottom of the mast and extending to an attachment point in proximity to the top of the mast. A generally horseshoe-shaped member having an open end is and extending around said mast. The mast being rotatable within the horseshoe-shaped member. A bearing supported stationary member at the top of the mast is carried by the mast while allowing the mast to rotate. A support stay runs from the horseshoe-shaped member to the bearing supported member to support the horseshoe-shaped member. Additional stays are attached to the horseshoe-shaped member and splayed to attach to opposed sides of the hull of the watercraft. The sail is reefed around the mast through the open end of the horseshoe-shaped member.

CANTILEVERED SAIL RIG

A wind powered craft carrying a generally vertical mast which is rotatable about its vertical axis, having a sail carried by the mast with its bottom edge attached in proximity to the bottom of the mast and extending to an attachment point in proximity to the top of the mast. A generally horseshoe-shaped member having an open end is and extending around said mast. The mast being rotatable within the horseshoe-shaped member. A bearing supported stationary member at the top of the mast is carried by the mast while allowing the mast to rotate. A support stay runs from the horseshoe-shaped member to the bearing supported member to support the horseshoe-shaped member. Additional stays are attached to the horseshoe-shaped member and splayed to attach to opposed sides of the hull of the watercraft. The sail is reefed around the mast through the open end of the horseshoe-shaped member.

Ship mast structure

SAIL DEVICE FOR STERN OF VESSEL

BACKGROUND OF THE INVENTION 1. Field of the Invention The present invention relates to a beauty sail device provided at a rear end of a small ship, that is, in the vicinity of a sail, so that the ship can be steered easily and economically. The structure is a mast installed upright at the deck back of the ship; And a sail assembly mounted on the mast for raising or lowering the sail assembly; Wherein the sail assembly includes a pair of lower barbels installed at a lower portion of the mast so as to be individually rotatable about axes parallel to the mast; One upper barb being vertically movable up and down along the mast so as to be rotatable about an axis parallel to the mast; A first sail having an upper end bound to the upper barb and a lower end bound to one of the lower barb; And a second sail which is bound to the upper barb and whose lower end is bound to the other one of the lower barbars.

SAIL YACHT OPERATING BY SOLAR POWER

The present invention relates to a sail yacht operated by solar power generation, and provided is a sail yacht providing driving force through solar power generation, which is operated by the solar power generation, including: a power generation unit including a power generation module performing solar power generation; a wing unit located on the bottom of the power generation unit and stretching to a side from a center; a buoyancy unit allowing floating from a sea level on the bottom of the wing unit; and a blade including a steering fin extended to a front at a front side of the buoyancy unit.

Mast step and heel

A mast step 3 and heel 10 (figure 6) that fit together perfectly in a concave mortise 9 (figure 4) and convex tenon 11 (figure 6) pivoting joint which can rotate forward and backward within a set range to allow raking of a mast and evenly distributing the pressure around the bottom rim of the mast. The mast heel has an attachment sleeve 1 for receiving a mast of any size diameter. The mast step may include integral friction dampers 12 (figure 7) in the base of the heel. The mast foot may also have an indicating line 4 (figure 2) that could be used with a rake angle indicating scale 5 (figure 2) printed on the mast step. Lateral motion of the mast may be prevented by the tenon sitting in the mortice groove. The mast step may be secured to a boat through holes 7 and knurled on its underside to maximise grip to its affixed surface. A shackle may be fixed to the back of the mast step via shackle holes 8 (figure 4) and a pin 2 by which the kicking strap may be attached. The step may have a hole ...

VORRICHTUNG ZUR ÄNDERUNG EINES KENTERMOMENTS EINES MEHRRUMPFBOOTES

Adjustable ballast bulb for a sailing vessel

A sailing vessel is disclosed which comprises a hull, a keel depending from the hull and a mast. A ballast bulb is provided at the lower end of the keel. A first control mechanisms is provided for rotating the ballast bulb about a transverse axis to change the angle of attack of the bulb. A second control mechanism is provided for rotating the bulb about a longitudinal axis of the vessel.

WING-TYPE SAIL SYSTEM

A wing-type sail system is provided. The system includes a mast assembly pivotally mounted on a swiveling base attachable to a craft and a substantially rigid multi-element asymmetric wing pivotally attached to a top of the mast assembly. The system further includes a control mechanism for modifying roll and yaw of the substantially rigid wing with respect to the craft. 1. A wing-type sail system comprising:(a) a mast assembly pivotally mounted on a swiveling base attachable to a craft;(b) a substantially rigid wing pivotally attached to a top of said mast assembly, said wing having an asymmetric profile; and(c) a control mechanism for modifying a roll and yaw of said substantially rigid wing with respect to the craft.2. The system of claim 1 , wherein said wing is pivotally attached to a top of said mast assembly at a central portion thereof.3. The system of claim 1 , wherein said mast assembly forms a triangular tower.4. The system of claim 1 , wherein said wing is oriented to wind side by rolling said wing and rotating said swiveling base.5. The system of claim 3 , wherein a top of said triangular tower is attached to said wing through a pin-type hinge.6. The system of claim 1 , wherein said mast assembly includes a plurality of mast poles each being separately connected to said swiveling base and said wing.7. The system of claim 1 , wherein said control mechanism includes control wires for modifying said roll and yaw of said wing.8. The system of claim 2 , wherein said control mechanism is further capable of modifying a height or pitch of said wing.9. The system of claim 6 , wherein a length of each of said plurality of mast poles is telescopically adjustable.10. The system of claim 1 , wherein said wing is pivotally attached to said mast assembly around a center of gravity of said wing.11. The system of claim 1 , further comprising wind speed and direction sensors mounted on said mast assembly and/or on said wing.12. The system of claim 1 , further comprising a ...

Passive, automatic wing control mechanism for vessels

Embodiments of the present invention are directed to a passive, automatic wing-control mechanism for sailing vessels. A cam is attached to one end of a rotatable mast as part of a rotatable wing, and a tensioner is configured to exert a constant force perpendicularly against the cam. When a wing is in a no-go sailing angle with respect to an apparent wind, the cam does not exert a torque on the mast. When the wing is outside the no-go sailing angle, the cam exerts a counter-torque to a torque caused by the apparent wind acting on the rotatable wing, causing the wing to remain at a predetermined angle with respect to the apparent wind.

Rise and fall mechanism for a plenum rotor

PASSIVE, AUTOMATIC WING CONTROL MECHANISM FOR VESSEL

Embodiments of the present invention are directed to a passive, automatic wing-control mechanism for sailing vessels. A cam is attached to one end of a rotatable mast as part of a rotatable wing, and a tensioner is configured to exert a constant force perpendicularly against the cam. When a wing is in a no-go sailing angle with respect to an apparent wind, the cam does not exert a torque on the mast. When the wing is outside the no-go sailing angle, the cam exerts a counter-torque to a torque caused by the apparent wind acting on the rotatable wing, causing the wing to remain at a predetermined angle with respect to the apparent wind.

VESSEL HAVING AT LEAST ONE HINGED MAST

PASSIVE, AUTOMATIC WING CONTROL MECHANISM FOR VESSELS

Alpha-enolase specific antibodies and method of use in immune diseases

Vessel with a rigid wingsail installation

A vessel provided with at least one rigid wingsail installation with a mast structure and a rigid wingsail. The mast structure comprises a foot and a mast top which is rotatable about a substantially vertical wingsail rotation axis relative to the vessel. The mast top is provided with a primary tilting assembly. The rigid wingsail comprises a main panel connected to the mast structure via the primary tilting assembly. This assembly allows tilting of the main panel relative to the mast top about a primary tilt axis. The rigid wingsail also comprises a top panel which is connected at its lower end to the upper end of the main panel via a secondary tilting assembly. This assembly allows tilting of the top panel relative to the main panel about a secondary tilting axis.

Vorrichtung zum Stellen oder Legen eines Masts

Offenbart ist eine Vorrichtung zum Stellen oder Legen eines Mastes.

Vorrichtung für ein Wasserfahrzeug, die das Aufspannen eines Segels mithilfe von rotierbaren Stangen ermöglicht

Um den Treibstoffverbrauch von motorisierten Frachtschiffen zu senken, können Segel zum Einsatz kommen. Hierbei ist es erstrebenswert, dass diese nachrüstbar auf bestehenden Schiffen angebracht werden können, dabei aber weder die Ladefläche verringern noch das Be- und Entladen behindern. Die Vorrichtung für ein Wasserfahrzeug, die das Aufspannen eines Segels mithilfe von rotierbaren Stangen ermöglicht, kann mit Seilwinden oder Hydraulikzylindern betrieben werden. Die Vorrichtung ist stabil genug, um auch hohe Windgeschwindigkeiten nutzbar zu machen und bei einem geringen Platzbedarf eine große Segelfläche zu ermöglichen.

Cantilevered sail rig

세일요트용 능동형 돛 제어시스템 및 이를 구비한 세일요트

... 본 발명은 세일요트용 능동형 돛 제어시스템 및 이를 구비한 세일요트에 관한 것으로, 컴팩트한 슬라이드 도어 타입 구조에 의해 바람을 맞는 돛의 면적을 용이하게 조절할 수 있도록 함으로써 해상 상황에 맞추어 바람에 의한 추진력 및 추진방향의 제어가 원활하게 이루어지며 목적지까지의 최단 거리 주행이 가능하도록 한 것이다. 이러한 본 발명은, 선체에 수직축을 중심으로 회전 가능하게 세워지며, 개구된 후측변으로부터 전측변 인근에 이르기까지 전후 폭방향을 따라 가로지르는 형태로 형성된 슬라이드홈을 구비한 메인 돛; 상기 메인 돛의 슬라이드홈에서 슬라이딩 동작에 의해 진퇴하면서 출입하도록 설치되어, 상기 메인 돛의 슬라이드홈으로부터 인출된 상태가 되면 바람을 맞는 전체 면적을 확대시킬 수 있도록 한 가변 돛;을 포함하여, 상기 메인 돛의 회전각도와 상기 가변 돛이 상기 메인 돛으로부터 인출된 정도에 따라 선체의 추진력 및 추진방향을 조절할 수 있도록 한 것을 특징으로 한다.

Moving mechanism for cruiser arch

A cruiser arch moving and control mechanism includes a pair of carriage guides ( 32, 150, 188 ) fixed to opposite sides of a cruiser hull, and a pair of carriages ( 30, 170 ), each mounted to one of the opposing legs of the cruiser arch. Each of the carriage guides includes a slot ( 40, 156, 190 ) with an elongate linear track section and an adjacent arcuate track section. Each carriage includes a pair of spaced apart bearings ( 76/78, 164/176, 198/200 ) that are confined for reciprocal travel along one of the slots to support the carriage moveably relative to the associated carriage guide. Two linear actuators ( 34 ), one coupled between each carriage and its associated guide, are extendable and retractable in concert to move the arch between working and clearance positions. The carriage guides are configured to prevent any substantial rotation of the carriages until the arch is extended linearly at least a predetermined distance from the working position.

Adjustable ballast bulb for a sailing vessel

A sailing vessel is disclosed which comprises a hull, a keel depending from the hull and a mast. A ballast bulb is provided at the lower end of the keel. A first control mechanisms is provided for rotating the ballast bulb about a transverse axis to change the angle of attack of the bulb. A second control mechanism is provided for rotating the bulb about a longitudinal axis of the vessel.

Dreiteilig versenkbare und bewegliche Segelmasten für Schiffe und Yachten (Containerschiffe, Segelyachten, Transport- und Frachtschiffe)

Kurzfassung◯ Die versenkbare und bewegliche Segelmastkonstruktion, bestehend aus zwei Hauptmasten und einem Hilfsmast zur Aufstellung eines oder mehrerer Segel.Technisches Problem der Erfindung◯ Schiffe können die Windenergie nutzen und somit den Kraftstoffverbrauch senken.◯ Die Wirtschaftlichkeit der Berufsschifffahrt steigern und dient zur Einsparung von Kraftstoffen in der Schifffahrt, ca. 3-10% Einsparpotential◯ Leichte Handhabung und Bedienbarkeit, durch hydraulische Hilfsmittel und Segelsoftware die die Steuerung erleichtern.◯ Nachträglicher Einbau auf jedem Schiff oder Yacht möglich.Lösung des Problems bzw. der technischen Aufgabe◯ Die Mastkonstruktion kann zur jeder Zeit aufgestellt oder eingefahren werden. Die Segel können ohne Probleme im Wind gestellt werden und dessen Energie zur Fortbewegung nutzen.◯ Schiffe können auf See die Windenergie nutzen und im Hafen beim Be- und Entladen entsteht keine Behinderung durch diese Konstruktion.Anwendungsgebiet◯ Berufsschifffahrt, Yachten ...

Lifting mechanism for Brazine rotor

WATER VEHICLE HAVING A CRANE FOR LIFTING LOADS

A watercraft may include a crane for lifting loads. The crane may include a tower and a boom that is rotatble with respect to the tower. The tower may be positioned inside the outer contour of the watercraft so as to minimize the profile of the watercraft on radar. The watercraft may include a superstructure within which the tower may be disposed. The superstructure may include planar outer walls that are obtuse relative to a horizontal plane. A rotary bearing may be utilized to connect the boom to the tower and permit the boom to rotate relative to the tower. Further, when the boom is in a rest position, a lower edge of the boom may be positioned 10 cm or less above the crane deck.”

Sail Mounting Assembly

A mast assembly for a sailing vessel includes a first tubular portion defining an interior and an end, and a second tubular portion defining an interior and an end. The mast assembly also includes a ferrule having a first end disposed within the interior of the first tubular portion, and a second end disposed within the interior of the second tubular portion. An intersection ring is disposed over the ferrule and positioned between the ends of the first and second tubular portions. The intersection ring includes a plurality of apertures formed therein for receiving rigging lines.

Hybrid wing rigging for wind-propelled vessel

A rigging for a wind-propelled vessel includes: a rotating airfoil-shaped mast; a sail movably coupled to a trailing edge of the airfoil-shaped mast and configured to be hoisted or lowered along the airfoil-shaped mast; a swiveling masthead coupled to a top section of the airfoil-shaped mast; and a plurality of stays supporting the airfoil-shaped mast, each stay having a first end connected to the swiveling masthead and a second end connected to a hull of the vessel.

적재물을 리프팅하기 위한 크레인을 가진 선박

... 본 발명은 적재물 (15) 을 리프팅하기 위한 크레인을 가진 선박 (1) 에 관한 것이고, 상기 크레인은 타워 (11) 및 상기 타워에 대하여 회전할 수 있는 붐 (13) 을 포함하고, 상기 타워는 선박의 외부 윤곽 내부에 배치된다.

Vorrichtung zum Aufspannen von Segelflächen sowie zum Verändern und Fixieren der Segelstellung auf Segelfahrzeugen

Bei herkömmlichen Konstruktionen zum Aufspannen von Segelflächen bildet der Mast oftmals die Anströmkante der Hauptsegelfläche, wobei für das Mastprofil ein Kompromiss zwischen hoher Tragfähigkeit und guter aerodynamischer Ausformung gefunden werden muss. Bei Segelfahrzeugen mit konstruktiv aufgerichteten Segelflächen wird zum Verändern und Fixieren der Segelstellung mindestens eine Schot verwendet. Durch den Holepunkt für die Schot an Deck des Segelfahrzeuges sind die Segelflächen nicht frei drehbar. Dadurch ist z. B. das Schwenken der Segelfläche über den Bug des Segelfahrzeuges bei der Halse nicht möglich. Die erfindungsgemäße Konstruktion bildet einen Rahmen um die aufzuspannende Segelfläche und erfordert dadurch keine Bauteile im Luftstrom auf die Anströmkante der Segelfläche. Dadurch können die Segelflächen ungehindert angeströmt werden. In der Zeichnung ist das Segel (14) zwischen den Seitenmasten (12) aufgespannt, wodurch das Vorliek (14a) ungehindert vom Wind angeströmt werden kann. Die konstruktiv aufgerichtete Segelfläche ist drehbar gelagert und kann bei der Halse über den Bug geschwenkt werden. Durch Sperren der Drehbarkeit kann die Segelstellung auch ohne Schot fixiert werden. Die Einrichtungen zum Sperren der Drehbarkeit im oberen Drehlager (4) können über die an der Ruderpinne (8) angebrachten Bedienelemente (9a, 9b, 9c) aktiviert und deaktiviert werden. Aufspannen von Segelflächen sowie Verändern und Fixieren der Segelstellung auf Segelfahrzeugen mit konstruktiv aufgerichteten Segelflächen. In conventional constructions for mounting sail surfaces, the mast often forms the leading edge of the main sail surface, whereby a compromise between high load capacity and good aerodynamic shape must be found for the mast profile. In sailing craft with constructive upright sail surfaces at least one sheet is used to change and fix the feathered position. Due to the Holepunkt for the sheet on the deck of the sailing craft, the sail surfaces are not freely ...

SELF-MOVING SHIP USING SOLAR CELL PANEL AS SAIL

The present invention relates to a self-moving ship using a solar cell panel as a sail. More specifically, the self-moving ship generates power through the solar cell panel and uses the solar cell panel as a sail at the same time in order to move in a self-initiated manner on the water. According to the present invention, the self-moving ship using the solar cell panel as a sail includes: a hull including a base plate and a buoyant body coupled to the base plate to float the base plate on the water; a solar power generation unit including multiple solar cell panels arranged on the upper surface of the base plate to collect solar light and a battery storing the power generated by the solar cell panel; a panel driving unit which operates with the lower supplied from the battery, moves a part of the solar cell panels up and down with respect to a vertical shaft, and individually rotates the solar cell panels around the vertical shaft and around the horizontal shaft perpendicular to the vertical ...

Sail mounting assembly

A mast assembly for a sailing vessel includes a first tubular portion defining an interior and an end, and a second tubular portion defining an interior and an end. The mast assembly also includes a ferrule having a first end disposed within the interior of the first tubular portion, and a second end disposed within the interior of the second tubular portion. An intersection ring is disposed over the ferrule and positioned between the ends of the first and second tubular portions. The intersection ring includes a plurality of apertures formed therein for receiving rigging lines.

BRIDGE ERECTION BOAT FOLDING MAST

The device disclosed herein is for a folding mast device for use on watercraft. In the preferred embodiment, the mast is used on a bridge erection boat; however, additional watercraft may also incorporate this device. The mast includes clamps and other components in order to allow the mast to be assembled and disassembled without tools, which also makes the assembly and disassembly quick. The mast is also quickly removable and replaceable. The mast also can incorporate safety features, such as lighting and other devices needed for safe navigation, and is capable of adjusting to accommodate fabrication differences. 1. A folding mast system comprising:(a) at least two mast pole pieces erectable to define a mast;(b) a mast hinge;(c) a centering clamp;(d) a mast base;(e) a safety locking pin; and(f) at least two adjustable stays to connect with the deck of a watercraft when the mast is in an erected position;wherein the mast pole pieces are connected at the mast hinge and when, in use, the mast is erected, the mast pole pieces are centrally aligned and the centering clamp is installed around and clamps the connection between the two mast pole pieces.2. The folding mast system of claim 1 , wherein:one of said mast pole pieces has a conical male end part;another of said mast pole pieces has a conical female end part cooperably engageable with said male end part to align and center said two mast pole pieces; andthe centering clamp is configured to clamp around the engaging end parts when said mast is in an erected position.3. The folding mast system of claim 1 , wherein said mast pole pieces are hollow.4. The folding mast system of claim 3 , wherein the interior of said mast pole pieces is watertight.5. The folding mast system of claim 3 , further comprising safety lighting.6. The folding mast system of claim 4 , further comprising safety lighting claim 4 , wherein electrical wire to conduct power to the safety lighting is run through the hollow mast pole pieces.7. The ...

태양전지패널을 돛으로 이용하는 자가 이동 선박

... 본 발명은 태양전지패널을 돛으로 이용하는 자가 이동 선박에 관한 것으로, 보다 상세하게는 태양전지패널을 통해 전력을 생산함과 동시에 태양전지패널을 돛으로 이용해 수상에서 자가 이동이 가능한 태양전지패널을 돛으로 이용하는 자가 이동 선박에 관한 것이다. 본 발명에 따른 태양전지패널을 돛으로 이용하는 자가 이동 선박은 베이스판과, 상기 베이스판이 수상에 부유되도록 상기 베이스판에 결합되는 부력체를 포함하여 구성된 선체부와; 태양광을 집광하도록 상기 베이스판의 상부면에 배열되는 복수개의 태양전지패널과, 상기 태양전지패널에 의해 생산된 전력을 저장하는 축전지를 포함하여 구성된 태양광발전부와; 상기 축전지로부터 전원을 공급받아 작동되되, 상기 복수개의 태양전지패널 중 일부 태양전지패널을 수직축을 기준으로 상하 이동시키고, 상기 수직축 및 상기 수직축과 연직한 수평축을 기준으로 각각 독립적으로 회동시킬 수 있는 패널구동부와; 상기 패널구동부의 작동을 제어하는 제어부를; 포함하되, 상기 제어부는, 발전모드 또는 이동모드의 선택이 가능하되, 이동모드가 선택되는 경우 상기 패널구동부에 의해 이동 및 회동되는 태양전지패널이 상하 방향으로 세워지며 풍력에 의해 상기 선체부를 수상에서 이동시킬 수 있는 돛으로 동작될 수 있도록 상기 패널구동부의 작동을 제어하는 것을 특징으로 한다.

Propulsion system for a boat

A propulsion system for a boat comprises a plurality of aerofoils connected to a main mast. At least one of the aerofoils is a displaceable aerofoil adapted to be displaced along the main mast between an open position and a closed position. When the displaceable aerofoil is in its open position the aerofoils together form a sail of open sail area. When the displaceable aerofoil is in its closed position at least some of the aerofoils overlap to form a sail of closed sail area, the closed sail area being less than the open sail area. The propulsion system can include a displacement mechanism to displace the displaceable aerofoil between its open and closed positions; at least one of the aerofoils having a solar panel thereon; and/or a stub mast extending along and free to rotate about a stub axis and connected to the main mast by a stub pivot.

Twin arm gin pole

A twin arm gin pole is an apparatus that is used for leverage when raising or lowering a deck stepped mast on a sail boat. The apparatus includes a first arm, a second arm, a first lifeline stanchion coupler, a second lifeline stanchion coupler, a winch, and a halyard connector. The first arm and the second arm are connected in a V-shaped structural body. Each of the distal ends for the V-shaped structural body is hingedly connected to the boat by one of the lifeline stanchion coupler. The winch is connected adjacent to the vertex of the V-shaped structural body, and the halyard connector is connected adjacent to the V-shaped structural body, opposite the winch. The winch is cranked to either pull the V-shaped structural body towards or away from the deck of the boat. A halyard line is tethered between the halyard connector and the top of the mast.

Wasserfahrzeug

Wasserfahrzeug (1), welches mindestens ein Schott (2) und/oder einen Doppelschichtrumpf (3) aufweist, und auch einen oder mehrere Masten (4) aufweisen kann, dadurch gekennzeichnet, dass: die Schotten (2) und/oder der Doppelschichtrumpf (3) durch die Luke/n (5) mit Rettungswest, Rettungsring, Netzschwimmer und anderem Schwimmkörper im Netz zusammenhaltend gefüllt werden können/kann, so dass das Wasserfahrzeug (1) inkl. seines Nennladungsgewichts beim Volllaufen eine geringere Dichte als Wasser aufweist; und ein oder mehrere Masten (4) kontrollierbar durch den Wasserfahrzeugboden runtergefahren und wieder hochgefahren werden kann/können, so dass der Schwerpunkt des Wasserfahrzeugs (1) inkl. seines Nennladungsgewichts in der normaler Lage bei Bedarf noch tiefer unter der Wasserfläche verlegt werden kann. Watercraft (1) which has at least one bulkhead (2) and / or a double-layer hull (3), and may also have one or more masts (4), characterized in that: the bulkheads (2) and / or the double-layered hull ( 3) through the hatch (s) (5) with life jacket, life buoy, net floats and other floating bodies in the net can be filled so that the watercraft (1) including its nominal load weight at full run has a lower density than water; and one or more masts (4) controllably down through the bottom of the vessel and can be raised again / can, so that the center of gravity of the vessel (1) incl. Its nominal load weight in the normal position can be laid even lower than the water surface if necessary.

Alpha-enolase specific antibodies and methods of use in immune diseases

Method for rigging and controlling a wing sail

A rigging comprises a mast controllably about a longitudinal axis; a flexible sail comprising a starboard and port flexible sail portions; a plurality of elongated battens which extend a luff and a leach of sail portions; each batten is pivotally connected to a respective outermost part of the respective side of the mast. Rotation of the mast causes the battens connected to one of the sail portions to be compressed along their length and causes the battens connected of the other sail portions to be tensioned along their length so as to change the shape of an aerofoil formed by the sail.

MAST BASE ASSEMBLY

The present invention is directed broadly to a marine vessel () comprising a deck () mounted to a hull () together with a sail () coupled to the marine vessel () via a mast base assembly (). The mast base assembly () comprises a mast tilt assembly (). The mast base assembly () also comprises a mast base mounting () to which the mast tilt assembly () is pivotally mounted for movement about a tilt axis () between stowed and operative positions. The mast base assembly () further comprises a sail slew assembly () mounted to the sail () associated with the marine vessel (). The sail slew assembly () is operatively coupled to the mast tilt assembly () for slewing of the sail (). The sail () is rotated or slewed about a slew axis () of the mast tilt assembly () to reorient the sail () relative to the marine vessel (). 128-. (canceled)29. A mast base assembly of an unmanned surface vessel , said mast base assembly comprising:a mast base mounting adapted to secure to the unmanned surface vessel;a mast tilt assembly including a mast coupling pivotally mounted to the mast base mounting about a tilt axis for movement of the mast tilt assembly between stowed and operative positions;a sail fitted to the mast coupling for slewing about the mast coupling;a sail slew gear including a worm associated with a worm drive mounted to the sail;a mast slew gear in the form of a worm gear fixed to the mast coupling and operatively meshed to the worm which on rotation via the worm drive effects slewing movement of the sail together with the sail slew gear about the mast coupling to reorient the sail relative to the unmanned surface vessel;a slew gear housing secured to a lower portion of the sail, said gear housing configured to i) contain the worm and the associated worm drive, and ii) to contain and rotate about the mast slew gear.30. The mast base assembly as claimed in wherein the slew gear housing is located internally of and contoured with the lower portion of the sail.31. The mast base ...

Device capable of putting down mast

ADJUSTABLE BALLAST BULB FOR A SAILING VESSEL

A sailing vessel is disclosed which comprises a hull, a keel depending from the hull and a mast. A ballast bulb is provided at the lower end of the keel. A first control mechanisms is provided for rotating the ballast bulb about a transverse axis to change the angle of attack of the bulb. A second control mechanism is provided for rotating the bulb about a longitudinal axis of the vessel. 126-. (canceled)27. A sailing vessel having a hull , a keel , a mast , a ballast bulb providing ballast at the base of the keel and a control apparatus for controlling adjustment of the ballast bulb in relation to the keel , wherein the control apparatus includes: a first rotating mechanism for rotating the ballast bulb around a lateral axis of the ballast bulb to change the pitch of the ballast bulb in relation to the keel; and a second rotating mechanism for rotating the ballast bulb around a longitudinal axis of the ballast bulb to change the roll of the ballast bulb in relation to the keel.28. The sailing vessel as claimed in claim 27 , wherein said control apparatus includes a pitch actuator and a roll actuator connected to the ballast bulb by means of wires between each quadrant of an upper surface of the ballast bulb and the keel.29. The sailing vessel as claimed in claim 27 , wherein the ballast bulb includes a compartment extending longitudinally within the ballast bulb and a movable mass housed within the compartment and movable longitudinally in the compartment to alter the ballast distribution in the ballast bulb.30. The sailing vessel as claimed in claim 29 , wherein the ballast bulb includes at least one further compartment which is accessible when the sailing vessel is out of the water.31. The sailing vessel as claimed in claim 28 , wherein the ballast bulb includes a compartment extending longitudinally within the ballast bulb and a movable mass housed within the compartment and movable longitudinally in the compartment to alter the ballast distribution in the ...

Wasserfahrzeug mit einem Kran zum Heben von Lasten

Die vorliegende Erfindung betrifft ein Wasserfahrzeug mit einem Kran zum Heben von Lasten, welcher einen Turm und einen gegenüber dem Turm drehbaren Ausleger aufweist, wobei der Turm innerhalb der Außenkontur des Wasserfahrzeugs angeordnet ist.

WING-TYPE SAIL SYSTEM

Bridge erection boat folding mast

The device disclosed herein is for a folding mast device for use on watercraft. In the preferred embodiment, the mast is used on a bridge erection boat; however, additional watercraft may also incorporate this device. The mast includes clamps and other components in order to allow the mast to be assembled and disassembled without tools, which also makes the assembly and disassembly quick. The mast is also quickly removable and replaceable. The mast also can incorporate safety features, such as lighting and other devices needed for safe navigation, and is capable of adjusting to accommodate fabrication differences.

WATER VEHICLE HAVING A CRANE FOR LIFTING LOADS

STAYED ROLLER FURLER

A wind powered craft carrying a generally vertical mast which is rotatable about its vertical axis, having a sail carried by the mast with its bottom edge attached in proximity to the bottom of the mast and extending to an attachment point in proximity to the top of the mast. A generally horseshoe-shaped member having an open end is and extending around said mast. The mast being rotatable within the horseshoe-shaped member. A bearing supported stationary member at the top of the mast is carried by the mast while allowing the mast to rotate. A support stay runs from the horseshoe-shaped member to the bearing supported member to support the horseshoe-shaped member. Additional stays are attached to the horseshoe-shaped member and splayed to attach to opposed sides of the hull of the watercraft. The sail is reefed around the mast through the open end of the horseshoe-shaped member.

Sailing craft

A sailing craft of the type which includes a floating hull, a mast secured to the hull, a sail mounted on the mast and rudder means, wherein the mast is pivotally mounted with an articulation near but spaced from the base thereof with respect to a substantially horizontal axis, and a pair of mobile fins having variable lift movably mounted, each on a respective one of the port and starboard sides of the hull, and a linkage interconnecting the mast and the mobile fins for actuating the fins such that they act in the water in a manner so as to tend to right the hull under the dynamic action of water on the fins in a direction opposite to the direction in which the mast pivots, and in which the craft would normally heel under the action of the wind to which it is exposed.

Water vehicle having a crane for lifting loads

A watercraft may include a crane for lifting loads. The crane may include a tower and a boom that is rotatble with respect to the tower. The tower may be positioned inside the outer contour of the watercraft so as to minimize the profile of the watercraft on radar. The watercraft may include a superstructure within which the tower may be disposed. The superstructure may include planar outer walls that are obtuse relative to a horizontal plane. A rotary bearing may be utilized to connect the boom to the tower and permit the boom to rotate relative to the tower. Further, when the boom is in a rest position, a lower edge of the boom may be positioned 10 cm or less above the crane deck.

Rotating ring mast sailing vessel and a method of vessel operation

A system for powering a water vessel having as its principal components rectangular sails secured to a rectangular frame which in turn is attached to an annular mast rotatably mounted on a plurality of supports rigidly affixed to the vessel. In a second system the supports are rotatably mounted on the vessel in a manner such that the supports and the annular mast may rotate independently of each other.

A PROPULSION SYSTEM FOR A BOAT

A propulsion system for a boat comprises a plurality of aerofoils connected to a main mast. At least one of the aerofoils is a displaceable aerofoil adapted to be displaced along the main mast between an open position and a closed position. When the displaceable aerofoil is in its open position the aerofoils together form a sail of open sail area. When the displaceable aerofoil is in its closed position at least some of the aerofoils overlap to form a sail of closed sail area, the closed sail area being less than the open sail area. The propulsion system can include a displacement mechanism to displace the displaceable aerofoil between its open and closed positions; at least one of the aerofoils having a solar panel thereon; and/or a stub mast extending along and free to rotate about a stub axis and; connected to the main mast by a stub pivot. 1. A propulsion system for a boat comprising:a main mast;a plurality of aerofoils connected to the main mast, at least one of the aerofoils being a displaceable aerofoil, the at least one displaceable aerofoil being adapted to be displaced along the main mast between an open position and a closed position;wherein when the at least one displaceable aerofoil is in its open position the aerofoils together form a sail of open sail area;and when the at least one displaceable aerofoil is in its closed position at least some of the aerofoils overlap to form a sail of closed sail area, the closed sail area being less than the open sail area;a displacement mechanism adapted to displace the at least one displaceable aerofoil between its open and closed positions;at least one of the aerofoils having a solar panel thereon; and,a stub mast extending along a stub axis, the stub mast being free to rotate about the stub axis;the stub mast being connected to the main mast by a stub pivot.2. A propulsion system as claimed in claim 1 , wherein each aerofoil has a solar panel thereon.3. A propulsion system as claimed in claim 1 , wherein the ...

Sailing craft

A sailing craft of the type which includes a floating hull, a mast secured to the hull, a sail mounted on the mast and rudder means, wherein the mast is pivotally mounted with an articulation near but spaced from the base thereof with respect to a substantially horizontal axis, and a pair of mobile fins having variable lift movably mounted, each on a respective one of the port and starboard sides of the hull, and a linkage interconnecting the mast and the mobile fins for actuating the fins such that they act in the water in a manner so as to tend to right the hull under the dynamic action of water on the fins in a direction opposite to the direction in which the mast pivots, and in which the craft would normally heel under the action of the wind to which it is exposed.

Canted Sail Rig

The present invention entails a canting sailboat sail rig. Mast support struts are attached at one end to the outer edges or railings of the hull(s), to the stern of the mast, and the mast struts attach at the other end to the lower sections of the mast. The mast foot base is attached to a circular track that runs from the centerline of the sailboat outward, toward the edges of the hulls, and upward the bow(s). When the mast foot move outward and upward toward the railing and bow(s) the upper section of the sail tilts or cants in the opposite direction from the mast foot outward direction, creating forward thrust, lift and reduced heeling. A jib can be attached to the head of the mast and the combination canting mainsail and jib can create force, lift and less heeling.

Twin Arm Gin Pole

A twin arm gin pole is an apparatus that is used for leverage when raising or lowering a deck stepped mast on a sail boat. The apparatus includes a first arm, a second arm, a first lifeline stanchion coupler, a second lifeline stanchion coupler, a winch, and a halyard connector. The first arm and the second arm are connected in a V-shaped structural body. Each of the distal ends for the V-shaped structural body is hingedly connected to the boat by one of the lifeline stanchion coupler. The winch is connected adjacent to the vertex of the V-shaped structural body, and the halyard connector is connected adjacent to the V-shaped structural body, opposite the winch. The winch is cranked to either pull the V-shaped structural body towards or away from the deck of the boat. A halyard line is tethered between the halyard connector and the top of the mast.

Mast base assembly

The present invention is directed broadly to a marine vessel (10) comprising a deck (12) mounted to a hull (14) together with a sail (16) coupled to the marine vessel (10) via a mast base assembly (18). The mast base assembly (18) comprises a mast tilt assembly (22). The mast base assembly (18) also comprises a mast base mounting (20) to which the mast tilt assembly (22) is pivotally mounted for movement about a tilt axis (24) between stowed and operative positions. The mast base assembly (18) further comprises a sail slew assembly (26) mounted to the sail (16) associated with the marine vessel (10). The sail slew assembly (26) is operatively coupled to the mast tilt assembly (22) for slewing of the sail (16). The sail (16) is rotated or slewed about a slew axis (28) of the mast tilt assembly (22) to reorient the sail (16) relative to the marine vessel (10).

Canted sail rig

The present invention entails a canting sailboat sail rig. Mast support struts are attached at one end to the outer edges or railings of the hull(s), to the stern of the mast, and the mast struts attach at the other end to the lower sections of the mast. The mast foot base is attached to a circular track that runs from the centerline of the sailboat outward, toward the edges of the hulls, and upward the bow(s). When the mast foot move outward and upward toward the railing and bow(s) the upper section of the sail tilts or cants in the opposite direction from the mast foot outward direction, creating forward thrust, lift and reduced heeling. A jib can be attached to the head of the mast and the combination canting mainsail and jib can create force, lift and less heeling.

Sailing vessel

The present disclosure is directed generally toward sailing vessels. One example is a catamaran with one or more pivoting masts per hull member, which may pivot from a generally perpendicular upright position, to a generally flat stowed position toward the bow of the hulls. The masts are capable of sustaining a plurality of sails, which may travel 180 degrees with respect to the hulls.

Ship mast retraction structure

A RAISING AND LOWERING MECHANISM FOR A FLETTNER ROTOR

Alpha-enolase specific antibodies and methods of use in immune diseases

本發明係關於一種用於治療發炎性疾病或免疫疾病的方法，包括投予一抗ENO1的拮抗劑至受試者。該拮抗劑結合ENO1並抑制ENO1血纖維蛋白溶酶原受體活性，該拮抗劑可以是一種專一性地結合人類ENO1(GenBank：AAH50642.1)之抗-人類ENO1抗體，其用於治療發炎性疾病或免疫性疾病，例如多發性硬化症，風濕性關節炎，克隆氏症(Crohn's disease)，潰瘍性結腸炎，全身性紅斑狼瘡，慢性阻塞性肺疾病(COPD)，氣喘，過敏症，牛皮癬，第1型糖尿病，動脈粥樣硬化及骨質疏鬆症。

Improvements relating to masts

The invention relates to improvements to masts and in particular a mast apparatus ( 17 ) for raising and/or lowering a mast ( 18 ) on a vessel such as a vessel, and a vessel incorporating such a mast apparatus. In one example embodiment, the mast apparatus for raising and/or lowering the mast on a vessel comprises a mast; a mast housing ( 28 ); a pivot ( 44 ) for the mast fixedly connected to the mast housing; a lateral movement control mechanism ( 34 ) for enabling controllable lateral movement of the mast with respect to the pivot and the mast housing; a lateral movement control mechanism such as hydraulic ram ( 30 ) connected to the mast and connected to the mast housing, or connected to the mast and connectable to a vessel, for driving the mast to rotate about the pivot and move laterally under the control of the lateral movement control mechanism so as to raise or lower the mast and move the mast laterally in a controlled manner.

COLLAPSIBLE MAST OF A YACHT

A collapsible mast of or for a yacht includes a base, a top section, and a rotation mechanism arranged between the base and the top section configured to rotate the top section relative to the base between an upright extended state, in which the top section extends in line with the base, and a collapsed state, in which the top section is rotated downward to reduce a height of the mast. The rotation mechanism comprises an axis oriented transverse through the base. Further, the rotation mechanism comprises a rotation arm, which is rotatably connected to the base via the axis. 1. A collapsible mast for a yacht , comprising:a base;a top section; anda rotation mechanism arranged between the base and the top section configured to rotate the top section relative to the base between an upright extended state, in which the top section extends in line with the base, and a collapsed state, in which the top section is rotated downward to reduce a height of the mast, wherein the rotation mechanism comprises an axis oriented transverse through the base,wherein the rotation mechanism comprises a rotation arm, which is rotatably connected to the base via the axis.2. The collapsible mast of claim 1 , wherein the arm is extendible from a shorter effective length in the upright extended state to a larger effective length in the collapsed state to keep the base and the top section apart in the collapsed state and have the base and top section abut in the upright extended state.3. The collapsible mast of claim 2 , wherein the extendible arm is accommodated in a through hole in a mounting plate inside the top section claim 2 , with a traction mechanism extending along the top section and back through an interior of the top section to the mounting plate.4. The collapsible mast of claim 1 , wherein the traction mechanism is anchored on a boom claim 1 , extending sideways from the base.5. The collapsible mast of claim 4 , wherein the traction mechanism comprises a cable.6. The collapsible ...

VESSEL WITH A RIGID WINGSAIL INSTALLATION

A vessel provided with at least one rigid wingsail installation with a mast structure and a rigid wingsail. 1. A vessel provided with at least one rigid wingsail installation , said installation comprising:a mast structure and a rigid wingsail supported by the mast structure,wherein the mast structure comprises a foot that is secured to the vessel and a mast top,wherein the mast top is rotatable about a substantially vertical wingsail rotation axis relative to the vessel to adjust the angle of incidence of the wind,and wherein the mast top is provided with a primary tilting assembly,wherein the rigid wingsail comprises:a rigid wingsail main panel having a lower end, an upper end, a leading edge, and a trailing edge, which rigid wingsail main panel is connected at a position intermediate its lower and upper ends to the mast structure via the primary tilting assembly, the primary tilting assembly allowing for tilting of the rigid wingsail main panel relative to the mast top about a primary tilt axis that is non-parallel to the vertical wingsail rotation axis,a rigid wingsail top panel having a lower end, an upper end, a leading edge, and a trailing edge, which rigid wingsail top panel is connected at its lower end to the upper end of the rigid wingsail main panel via a secondary tilting assembly, the secondary tilting assembly allowing for tilting of the rigid wingsail top panel relative to the rigid wingsail main panel about a secondary tilt axis that is non-parallel to the vertical wingsail rotation axis.2. Vessel according to claim 1 , wherein the main panel is provided with an elongated mast structure receiving recess wherein the mast structure is received when the main panel is in its vertically erected sailing position.3. Vessel according to claim 1 , wherein the wingsail installation is adapted to bring the wingsail in a docking position claim 1 , wherein the main panel is substantially horizontal and the top panel is oriented downwards.4. Vessel according to ...

Twin Arm Gin Pole

A twin arm gin pole is an apparatus that is used for leverage when raising or lowering a deck stepped mast on a sail boat. The apparatus includes a first arm, a second arm, a first lifeline stanchion coupler, a second lifeline stanchion coupler, a winch, and a halyard connector. The first arm and the second arm are connected in a V-shaped structural body. Each of the distal ends for the V-shaped structural body is hingedly connected to the boat by one of the lifeline stanchion coupler. The winch is connected adjacent to the vertex of the V-shaped structural body, and the halyard connector is connected adjacent to the V-shaped structural body, opposite the winch. The winch is cranked to either pull the V-shaped structural body towards or away from the deck of the boat. A halyard line is tethered between the halyard connector and the top of the mast. 1. A twin arm gin pole comprises:a first arm;a second arm;a first lifeline stanchion coupler;a second lifeline stanchion coupler;a winch;a halyard connector;said first arm and said second arm each comprise a proximal end and a distal end;said first arm being oriented at an acute angle with said second arm;said proximal end of first arm being connected to said proximal end of said second arm;said distal end of said first arm being adjacently and hingedly connected to said first lifeline stanchion coupler;said distal end of said second arm being adjacently and hingedly connected to said second lifeline stanchion coupler;said winch being adjacently connected to said distal end of both said first arm and said second arm; andsaid halyard connector being adjacently connected to said distal end of both said first arm and said second arm, opposite to said winch.2. The twin arm gin pole as claimed in claim 1 , wherein said first lifeline stanchion coupler and said second lifeline stanchion coupler are a pair of twisted D-shackles.3. The twin arm gin pole as claimed in claim 1 , wherein said winch is a 1500-pound brake winch.4. The ...

Watercraft having a wind-powered drive unit

A watercraft incorporating a wind propulsion system, revealing a main mast and an auxiliary mast. According to the invention, provision is made for a length of the auxiliary mast between a flexible joint and the deck as well as an included angle α from the main mast and deck capable of being locked in position on variable lines.

Submersible vessel having retractable wing and keel assemblies

A submersible vessel having wing and keel assemblies that are extendable for wind-powered surface operation and retractable to reduce drag for submerged operation or to place the vessel in a more compact configuration. A deployment mechanism including an actuator and linkage pivots the wing and keel assemblies simultaneously between the deployed and retracted configuration. The vessel may have first and second pressure hulls flanking the wing and keel assemblies. A drive mechanism including a motor and a gear train employing pulley-and-cable assemblies rotates either the wing and flap together such that the flap angle relative to the wing is constant, or to change the flap angle relative to the wing with the wing angle of incidence held constant. The invention also provides a retractable wind-powered propulsion apparatus that is mountable to the hull assembly of a submersible or non-submersible vessel. 1. A submersible vessel , comprising:a hull assembly;a wing assembly comprising at least one substantially rigid wing member;a keel assembly comprising at least one keel member; anda deployment mechanism comprising at least one actuator and a linkage interconnecting said wing assembly and said keel assembly, that in response to operation of said actuator pivots said wing assembly and said keel assembly simultaneously between the (i) a deployed configuration in which said wing assembly and said keel assembly extend outwardly above and below said hull assembly for wind-powered surfaced operation of said vessel and (ii) retracted configuration in which said wing assembly and said keel assembly are angled back towards said hull assembly to reduce drag for submerged operation of said vessel.2. The submersible vessel of claim 1 , wherein said linkage of said deployment mechanism comprises:a crank member that is supported from said hull assembly for rotation about a first substantially horizontal axis.3. The submersible vessel of claim 2 , wherein said actuator comprises:a ...

Mast-head Rigging Connection Device

One embodiment of a mast-head standing rigging connection device, allowing for sail module rotation about a mast axis, is disclosed. The embodiment allows for connection of shrouds and conventional single mast forestay and backstay rigging systems. Additional embodiments, utilizing modifications of the first embodiment, for multi-mast and triangular fore-aft sail mast roller reef-furl systems, are described. 2. The mast-head standing rigging connection device of claim 1 , wherein said first bearing is a ball bearing.3. The mast-head standing rigging connection device of claim 1 , wherein said second bearing and said third bearing are tapered roller bearings.4. The mast-head standing rigging connection device of claim 1 , wherein claim 1 , for a backstay oriented either horizontally or angled upward from said mast-head claim 1 , said backstay connection beam may be eliminated and said backstay attachment lug is connected directly to said central barrel.5. The mast-head standing rigging connection device of claim 4 , wherein claim 4 , for rigging geometries where a forestay does not interfere with said sail module or fore-aft triangular sail claim 4 , said forestay connection beam may be eliminated and said forestay attachment lug is connected directly to said central barrel.6. The mast-head standing rigging connection device of claim 1 , wherein claim 1 , for a forestay oriented either horizontally or angled upward from said mast-head claim 1 , said forestay connection beam may be eliminated and said forestay attachment lug is connected directly to said central barrel. This is a division of U.S. patent application Ser. No. 15/192,658, filed 2016 Jun. 24, the entire content of which is incorporated herein by reference.The following is a tabulation of some prior art that presently appears relevant:The cross-referenced U.S. patent application discloses a wind sail design which includes a mast which is rigidly affixed to a ship or wind-propelled land vehicle. The first ...

Rigid sail for vessels, in particular large ships, and vessel with a rigid sail

In order to provide a rigid sail or aerofoil sail which has a lower overall weight, is cost-effective to manufacture and does not affect the passing under bridges, power lines or similar structures arranged over busy waters, in the case of a rigid sail for vessels, in particular, for large ships, such as bulk carriers, tankers, car transporters or bulkers, comprising a mast and a first aerofoil wing body mounted on the mast with a base and a head, wherein the mast is inserted through the base into the first aerofoil wing body and is arranged within the first aerofoil wing body, it is proposed that the mast, starting from the base, does not extend beyond a maximum height of the first aerofoil wing body, in particular, less than 75% of the maximum height.

DEVICE FOR CONTROLLING HORIZONTALITY OF SMALL SHIP BY USING VARIABLE MAST

Disclosed, as a device for correcting the horizontality of the small ship according to the present invention, is a device for controlling the horizontality of a small ship by using a variable mast, the device comprising: a tilt sensing unit for sensing the tilt of the small ship; a position adjustment unit formed such that at least a portion thereof can move in the horizontal direction on the deck of the small ship, and having a separate mast loaded on an upper part thereof to support the mast such that the mast is located at a predetermined height or higher; and a horizontality control unit for correcting the center of gravity of the small ship by adjusting a position of the mast through the position adjustment unit in correspondence to the tilt sensed by the tilt sensing unit. 1. A device for correcting horizontality of a small ship by using a variable mast , the device comprising:a tilt sensing unit for sensing a tilt of the small ship;a position adjustment unit formed such that at least a portion thereof can move in a horizontal direction on a deck of the small ship, and having a separate mast loaded on an upper part thereof to support the mast such that the mast is located at a predetermined height or higher; anda horizontality control unit for adjusting a position of the mast through the position adjustment unit in correspondence to the tilt sensed by the tilt sensing unit and correcting a center of gravity of the small ship.2. The device of claim 1 , wherein the horizontality control unit compares a preset target value for the tilt of the small ship with a measurement value measured by the tilt sensing unit and move the mast in correspondence to a generated error value to correct the center of gravity of the small ship.3. The device of claim 1 , wherein the tilt sensing unit is provided in one side of the small ship and measures trim and heel of the small ship in real time.4. The device of claim 1 , wherein the position adjustment unit comprises:a first ...

Ship rotary mast

СУДОВАЯ ПОВОРОТНАЯ МАЧIA , DiapLHpiiO устанозлеьтна  via ста-дг-рое и содержаща  противовес и устройство дл  ее поворота, отличающа с  тем. ч,-, целью упрощени  конструкции и снижспк-; ее стоимости, устройство дл  поворота ты выполнено с закрытой емкостью, снао женной напорным и сливным трубопровода ми соответственно дл  подачи в нее и слив.ч жидкого балласта, создающего момент вращени , противоположно направленный моменту от действи  противовеса, а мачта снабжена установленным соответственна на стандерсе упором с возможностью его контактировани  с противовесом мачты. 00 Ot ел 4 00 SHIP'S TURNING MACHIA, DiapLHpiiO is installed via a stage and contains a counterweight and a device for its rotation, characterized in that. h, -, the purpose of simplifying the design and reducing wps; its cost, the device for turning is made with a closed tank, filled with pressure and drain pipes, respectively, for supplying it and draining liquid ballast, which creates a torque opposite to the counterweight from the counterweight, and the mast is equipped with a support installed on the standart with the possibility of contact with the counterweight of the mast. 00 Ot ate 4 00

Sailing vessel rig has a mast with interlocked spars and a sliding deck mounting so that the mast can be lowered single-handedly with the stays in place to pass under low bridges etc

The sailing vessel mast has two interlocked spars with supports. The foresail is at the forestay, and the mainsail is at the boom mounted to the deck, independently of the mast. The support butts are fixed to the hull in sliding mountings, with rotating mountings at the upper ends for the spars. The sliding mountings allow the mast to be lowered, forwards, together with the attached stays, to be secured at one side of the deck.

Commercial ship equipped with a duplex rigging

La présente invention concerne un dispositif dénommé navire commercial équipé d'un gréement duplex permettant d'utiliser l'énergie éolienne en tant que force motrice du navire. La particularité de ce dispositif est d'utiliser un gréement constitué de mâts solidaires en position jumelée, chaque mât étant placé sur les côtés de la coque au lieu de la position classique centrale, un navire pouvant contenir plusieurs couples de mâts duplex. Cette disposition des mâts présente plusieurs avantages, dont celui de réduire l'emprise des mâts sur la structure, celui de laisser un espace optimal au chargement, celui d'offrir une meilleure emprise au vent, celui de réduire le gîte, et celui de positionner les mâts en des points structuraux très robustes. Un haubanage transversal et longitudinal assorti d'entretoises robustes entre les mâts duplex assure une très grande robustesse à l'ensemble. Optionnellement, grâce au haubanage garantissant l'assise mécanique du gréement, les mâts peuvent être à la base montés sur des articulations permettant un démontage ou un basculement facilitant la maintenance et la navigation en zone à faible tirant d'air (fleuves, embouchures, voies maritimes...). The present invention relates to a device called a commercial ship equipped with a duplex rig making it possible to use wind energy as the driving force of the ship. The particularity of this device is to use a rigging made up of integral masts in the twin position, each mast being placed on the sides of the hull instead of the classic central position, a ship being able to contain several pairs of duplex masts. This arrangement of the masts has several advantages, including that of reducing the grip of the masts on the structure, that of leaving an optimal space for loading, that of offering a better grip in the wind, that of reducing the heel, and that of positioning masts at very robust structural points. A transverse and longitudinal bracing matched ...

A vessel with a rigid wingsail installation

A vessel (1) provided with at least one rigid wingsail installation (10) with a mast structure (15) and a rigid wingsail (10). The mast structure comprises a foot (16) and a mast top (17) which is rotatable about a substantially vertical wingsail rotation axis relative to the vessel. The mast top is provided with a primary tilting assembly (20). The rigid wingsail comprises a main panel (31) connected to the mast structure (15) via the primary tilting assembly. This assembly allows tilting of the main panel relative to the mast top about a primary tilt axis (21). The rigid wingsail also comprises a top panel (35) which is connected at its lower end to the upper end of the main panel via a secondary tilting assembly (40). This assembly allows tilting of the top panel relative to the main panel about a secondary tilting axis (41).

NAUTICAL RECREATIONAL AND COMPETITIVE VEHICLE WITH INCLINABLE SHELLS AND MATURE

La présente invention concerne un véhicule nautique de loisir et de compétition, caractérisé en ce qu'il est constitué de trois coques en appui sur la surface de l'eau, dites « coque flottante » (200)(300) dont deux « coque latérale » (200) équipées de « Safran directif » (210) et une « coque directive » indépendante (300), associées entre-elles au moyen d'une structure rigide intermédiaire dite « structure de liaison » (100), constituée d'un élément principal dit « corps de structure » (110) portant de manière fixe et solidaire au moins deux couples de bras supports incurvés opposés dits « bras de liaison » (120), deux ailerons latéraux opposés dits « aileron d'appui » (130), un « balancier » (400)(410) et un mât dit « mât principal » (500), les « coque latérale » (200), la « coque directive » (300), le « mât principal » (500) et les « safran directif » (210) étant reliés à un dispositif dynamique dit « dispositif d'orientation » (non représenté) permettant de provoquer séparément ou simultanément sur commande de l'utilisateur : la rotation des « coque latérale » (200) autour de leur axe longitudinal (ALC), la rotation de la « coque directive » (300) autour de son axe vertical (AVS), l'inclinaison du « mât principal » (500) par rapport à son axe vertical (AVM) et l'orientation des « safran directif » (210). The present invention relates to a recreational and competitive nautical vehicle, characterized in that it consists of three hulls resting on the surface of the water, called "floating hull" (200) (300), including two "hulls "(200) equipped with" Directive Saffron "(210) and an independent" directive shell "(300), associated with each other by means of an intermediate rigid structure called" link structure "(100), consisting of a main element called "structural body" (110) fixedly and securely supporting at least two pairs of opposite curved support arms called "connecting ...

Marine vessel with integrated trailer has integral chassis with cross axle extending through hull of vessel

The marine vessel has a chassis (102) with longitudinal beams (106) and cross pieces (108). The chassis is connected to the hull at its interior. The chassis has a head (104) crossing the prow and an axle (110) extending through the hull. The axle supports wheels outside the hull. The head can have a removable tow hitch.

REMOVABLE FLEETABLE FLOAT DEVICE FOR TRANSFORMING A MONOCOQUE BOAT INTO A MULTICHARGED BOAT AND A BOAT COMPRISING SAME

Inclinable, adjustable mast for all types of boats and craft moved by the wind

Inclinable and steerable mast for all types of boats and craft moved by the wind. The invention consists essentially of a device allowing the sail-carrying mast 1 to be inclined. Adjustable arrangement while the said craft is being manoeuvred by the driver, whatever the medium on which (or in which) it is moving. The device consists of an additional two-legged support 2A 2B fastened, at its lower part, to two rails 16, the mast resting on a movable shoe 3; the assembly can be adjusted in various ways making it possible to obtain adjustable and controlled inclination of the mast. 1. Adjustment takes place by displacement of one or both feet of the two-legged support 2A 2B, the mast foot 7 being then fixed but articulated via a vibration damper 4. 2. Adjustment takes place by displacement of the mast foot 7 on the shoe 3, the two-legged support 2A 2B being fixed but articulated by vibration dampers 5A 5B and 6A 6B. The main applications may relate to sailing boats, whether they are single or multihull, land yachts and all craft moved by the wind.

Adjustable matt.

NAUTICAL RECREATIONAL AND COMPETITIVE VEHICLE WITH INCLINABLE SHELLS AND MATURE

La présente invention concerne un véhicule nautique de loisir et de compétition, caractérisé en ce qu'il est constitué de trois coques en appui sur la surface de l'eau, dites « coque flottante » (200)(300) dont deux « coque latérale » (200) équipées de « Safran directif » (210) et une « coque directive » indépendante (300), associées entre-elles au moyen d'une structure rigide intermédiaire dite « structure de liaison » (100), constituée d'un élément principal dit « corps de structure » (110) portant de manière fixe et solidaire au moins deux couples de bras supports incurvés opposés dits « bras de liaison » (120), deux ailerons latéraux opposés dits « aileron d'appui » (130), un « balancier » (400)(410) et un mât dit « mât principal » (500), les « coque latérale » (200), la « coque directive » (300), le « mât principal » (500) et les « safran directif » (210) étant reliés à un dispositif dynamique dit « dispositif d'orientation » (non représenté) permettant de provoquer séparément ou simultanément sur commande de l'utilisateur : la rotation des « coque latérale » (200) autour de leur axe longitudinal (ALC), la rotation de la « coque directive » (300) autour de son axe vertical (AVS), l'inclinaison du « mât principal » (500) par rapport à son axe vertical (AVM) et l'orientation des « safran directif » (210). The present invention relates to a recreational and competitive nautical vehicle, characterized in that it consists of three hulls resting on the surface of the water, called "floating hull" (200) (300), including two "hulls "(200) equipped with" Directive Saffron "(210) and an independent" directive shell "(300), associated with each other by means of an intermediate rigid structure called" link structure "(100), consisting of a main element called "structural body" (110) fixedly and securely supporting at least two pairs of opposite curved support arms called "connecting ...

Mast foot arrangement

Sailing ship

IMPLANTING RACE OR CRUISE SHIP

The invention concerns a competition or cruiser sailboat comprising a hull (1) closed by deck (2), and wherein is implanted the lower end of a mast (4) bearing the rigging, characterised in that the mast (4) is a tilting mast without side stays, mounted pivoting in particular on bearings about a substantially horizontal axis (x-x') of the hull (1) such that, whatever the weather conditions, its centre of gravity (G) can be placed in the wind, in the sailboat centre of rotation, and the rigging plane perpendicular to the air streams.

Nautical leisure and competition vehicle with tiltable hulls and mast

The present invention concerns a nautical leisure and competition vehicle, characterised in that it is made up of three hulls resting on the surface of the water, referred to as "floating hulls" (200) (300) including two "lateral hulls" (200) equipped with a "rudder blade" (210) and a separate "steering hull" (300), associated with each other by means of an intermediate rigid structure referred to as the "linking structure" (100), made up of a main element referred to as the "structure body" (110) carrying, in a fixed and integral manner, at least two pairs of opposing curved support arms referred to as "linking arms" (120), two opposing lateral ailerons referred to as "support ailerons" (130), an "outrigger" (400) (410) and a mast referred to as the "main mast" (500), the "lateral hulls" (200), the "steering hull" (300), the "main mast" (500) and the "rudder blades" (210) being linked to a dynamic device referred to as the "orientation device" (not shown) that allows the following to be triggered separately or simultaneously, upon the user's command: rotation of the "lateral hulls" (200) about the longitudinal axis (ALC) of same, rotation of the "steering hull" (300) about the vertical axis (AVS) of same, tilting of the "main mast" (500) relative to the vertical axis (AVM) of same and orientation of the "rudder blades" (210).

Device for varying a multihull capsizing torque

The invention concerns a device for varying the capsizing torque of a multihull (12) consisting of at least two floaters (9) linked together by at least two beams respectively called front link beam (8) and rear link beam (6). The invention is characterised in that it comprises a geometrical platform (15) supporting a masting (1) and a crew dinghy (10) and said platform (15) is mounted transversely sliding on the multihull (12) to enable, depending on the equilibrium desired by the crew, the displacement of the masting (1) and the crew dinghy (10) from one side to the other of the multihull (12). The invention also concerns a multihull equipped with such a device.

RIGGING FOR YACHTS AND MULTIHULLS, FOLDING AND QUICK DISMANTLING.

Sailboat heel control device

The device is set up on a sailboat comprising a sail-mast moving transversally in respect to the hull and in dependence of the wind force. The leeward-side hull of the multi-hull sinks secured to float-rod guides, in consequence of the sail-mast movement. Thus, the buoyancy caused by sinking opposes the heeling moment caused by the wind. To achieve the same performances, the single-hull sailboat comprises two floats positioned on the two sides of the hull. The crew can manually set any required sailing condition, acting the invented device installed between the sail-mast and the lateral hulls or the lateral floats. Therefore, we can use a single sailboat for many purposes, enormously increasing the number of the users.

Adjustable boom coupling for yacht, made of stainless steel, with bolt and rollers controlling diverted cable served by self-locking cable roller

The boom coupling is made of stainless steel. The connection between the boom and the forestay holder can be controlled by a bolt (19), the slackening and tightening of which enables the cable to be controlled via rollers through which it is diverted. The cable is served by a self-locking cable roller.

Hook and messenger deployment device for launching and recovery of unmanned surface vehicle

According to the present invention, provided is a recovery hook and messenger line delivery apparatus for launching and recovering an unmanned ship. The recovery hook and messenger line delivery apparatus includes: a delivery pillar having one end connected to an unmanned ship, having the other end at which a recovery messenger line fixing ring and a towing messenger line fixing ring are formed, and having a telescopic shape enabling length adjustment in accordance with a power supply state; a recovery messenger line hooking and placing a longitudinal end, which is connected with a recovery line provided on a launching and recovering means of a mothership, on the recovery messenger line fixing ring when launching or recovering the unmanned ship; a towing messenger line hooking and placing a longitudinal end, which is connected with a towing line provided on the launching and recovering means of the mothership, on the towing messenger line fixing ring when launching or recovering the unmanned ship; a recovery messenger line winch installed on the unmanned ship, and winding or unwinding the recovery messenger line in a state in which the other end of the recovery messenger line is connected; a towing messenger line winch installed on the unmanned ship, and winding or unwinding the towing messenger line in a state in which the other end of the towing messenger line is connected; a recovery hook unit installed on the unmanned ship, and hooking a recovery hook provided on the recovery line when launching or recovering the unmanned ship from the mothership; a towing hook unit installed on the unmanned ship, and hooking a towing hook provided on the towing line when launching or recovering the unmanned ship from the mothership; and a control part installed on the unmanned ship, and controlling whether to deliver the power of the delivery pillar when launching or recovering the unmanned ship from the mothership, controlling the operation of the recovery messenger line winch ...

Mast step

A mast step for a kayak sailing rig is provided. The mast step supports a mast relative to a deck of the kayak at a desired angle to facilitate an optimum sail shape. The step also has a convex below a surface which contacts the deck, allowing the mast to be rotated forward or aft in use, and in particular allowing the mast to be rotated from an upright position to a flat position against the deck of the kayak.

SAILBOAT

REMOVABLE FLEETABLE FLOAT DEVICE FOR TRANSFORMING A MONOCOQUE BOAT INTO A MULTICHARGED BOAT AND A BOAT COMPRISING SAME

Le dispositif (1) pour transformer une embarcation monocoque (2) en embarcation multicoque comprend une structure porteuse (3) fixée de manière amovible à l'embarcation (2), et au moins un flotteur latéral (4) solidarisé à cette structure porteuse (3) de manière articulée autour d'au moins un axe géométrique (BB') ledit flotteur (4) pouvant occuper une première position stable déployée selon laquelle il est parallèle au plan géométrique longitudinal vertical (PP') contenant la ligne de quille de l'embarcation (2) et par le point le plus bas de sa ligne de quille il est disposé sous l'axe géométrique (BB') et une seconde position stable repliée, angulairement écartée de la précédente.L'invention porte également sur une embarcation dotée de ce dispositif. The device (1) for transforming a monohull boat (2) into a multihull boat comprises a support structure (3) removably attached to the boat (2), and at least one lateral float (4) secured to this carrying structure ( 3) hinged about at least one geometric axis (BB ') said float (4) can occupy a first deployed stable position in which it is parallel to the vertical longitudinal geometric plane (PP') containing the keel line of the boat (2) and by the lowest point of its keel line it is arranged under the geometric axis (BB ') and a second stable position folded, angularly spaced from the previous one.The invention also relates to a boat equipped with this device.

Sailable multi-hull vessel

A multi-hull sailing vessel comprising a main hull having a generally trawler-shaped configuration at least two amas connected to the main hull and at least one sail mounted to the main hull.

Sliding keel sailboat with a hull with reduced rolling

The present invention refers to a sliding keel sailboat of the type comprising a sailing hull, a mast and a sailing arrangement whereon aero-dynamic forces, apt to be transferred to the hull through said mast, push, said mast being integral with a pivoting structure which can swing around a pivoting axis, parallel to a longitudinal central axis of the sailboat, in a respective seat in the sailing hull, said pivoting structure being arranged so that the crew can stand on it so as to balance said forces acting on the mast.

Alpha-enolase specific antibodies and method of use in immune diseases

A method for treating an inflammatory disease or an immune disorder includes administering to a subject in need of such treatment an antagonist against ENO1. The antagonist binds ENO1 and inhibits ENO1 plasminogen receptor activity. The antagonist may be an anti-human ENO1 antibody, or an scFv, Fab, or F(ab)2 fragment thereof, that specifically binds to human ENO1 (GenBank: AAH50642.1) for the treatment of an inflammatory disease or an immune disorder, which may be multiple sclerosis, rheumatoid arthritis, Crohn's disease, ulcerative colitis, systemic Lupus erythematosus, chronic obstructive pulmonary disease (COPD), asthma, allergy, psoriasis, type 1 diabetes mellitus, artherosclerosis or osteoporosis.

Improvements relating to masts

The invention relates to improvements to masts and in particular a mast apparatus (17) for raising and/or lowering a mast (18) on a vessel such as a vessel, and a vessel incorporating such a mast apparatus. In one example embodiment, the mast apparatus for raising and/or lowering the mast on a vessel comprises a mast; a mast housing (28); a pivot (44) for the mast fixedly connected to the mast housing; a lateral movement control mechanism (34) for enabling controllable lateral movement of the mast with respect to the pivot and the mast housing; a lateral movement control mechanism such as hydraulic ram (30) connected to the mast and connected to the mast housing, or connected to the mast and connectable to a vessel, for driving the mast to rotate about the pivot and move laterally under the control of the lateral movement control mechanism so as to raise or lower the mast and move the mast laterally in a controlled manner.

Sliding keel sailboat with a hull with reduced rolling

The present invention refers to a sliding keel sailboat of the type comprising a sailing hull, a mast and a sailing arrangement whereon aero-dynamic forces, apt to be transferred to the hull through said mast, push, said mast being integral with a pivoting structure which can swing around a pivoting axis, parallel to a longitudinal central axis of the sailboat, in a respective seat in the sailing hull, said pivoting structure being arranged so that the crew can stand on it so as to balance said forces acting on the mast.

Device for sailing boats with an oscillating mast and a polar axle

A device for sailing boats comprising an oscillating mast (10) and a polar axle (14) that allows to adapt the mast to cruising or racing navigation requirements is described.

A device for lowering/raising the upper part of a pole or mast, in particular for lighting and a lowering/rising pole or mast, in particular for lighting

A device for lowering/raising the upper part (4) of a separable pole or mast (1) comprising two hinged (12) clamping rings (11) fastening the outside surface of said pole or mast (1) by opening respectively closing one halfring, a lug assembly (20) located opposite to the hinge (12) connecting the rings (11), and a lowering/raising mechanism (23) in the form of a two-way axial movement drive fastened to guiding units (22) located on pins (21) in the lug assemblies (20) permanently connected with said clamping rings (11). A lowering/rising pole or mast (1) is also disclosed, comprising a lower part (3) and a upper part (4) detachably connected together, the joining area having on each pole-part a permanently connected ring (5), the ring being equipped with means for mounting a lowering/raising device (10) for the upper part (4) of the pole or mast (1).

Directional equipment for mast of single hulled watercraft

The equipment allows the orientation of the mast and the surface of the sail to be adjusted, at least laterally, independent of the angle of the hull. The base of the mast is moved by the lengthening or shortening of stays. A winch may be used to shorten or lengthen the stays, or a trolley moving on a bridge may be used. Three various elements may be activated by a mechanical system or an electrical system or a system using hydraulic power.

Hinged radar arch for marine vessels

An arch assembly 10 for pivotably mounting on a boat 12 , its method of manufacture, and deployment in use. The assembly 10 has an arch 14 with a generally inverted U-shaped configuration, a forward edge region 16 and an aft edge region 18 , a laterally extending top portion 20 generally spanning the width of the boat 12 and a pair of downwardly extending leg portions 22, 24 for connection to the boat 12 . Each leg portion 22, 24 has a lower basal edge 26, 28 . A knuckle joint 30, 32 is provided adjacent to an edge region of the basal edge 26, 28 about which the arch assembly 10 may pivot from a secured upright position through intermediate positions 36 to an extended lower position 38 through a number (R) degrees of arcuate displacement. An anchoring subassembly 40, 41 provided adjacent to another region of the basal edge 26, 28 for releasably securing the arch assembly 10 to the boat 12 . Means for influencing 42 pivotable movement 43 of the arch assembly 10 as it moves arcuately are also provided.

Roll-on roll-off cargo sailing vessel

The invention relates to a single-hull vessel (11), especially a cargo vessel, comprising: a) a so-called duplex rig (110) comprising two transversely interspaced masts (111, 112), each one provided with a boom (130) for respectively carrying a sail (141, 142) extending between said mast and the boom (130), said two masts (111, 112) being connected by structural elements (121, 122), so-called standard rigging, so as to form a portal; and b) stabilising bilge keels (161, 162) below the submerged part of the hull; c) characterised in that the connection from the portal (110) to the hull of the vessel comprises a pivoting connection along a transverse axis (220) and the stabilising bilge keels (161, 162) are retractable.

Removable device comprising collapsible floats, which is used to convert a monohull vessel into a multihull vessel, and vessel comprising same

Le dispositif (1) pour transformer une embarcation monocoque (2) en embarcation multicoque comprend une structure porteuse (3) fixée de manière amovible à l'embarcation (2), et au moins un flotteur latéral (4) solidarisé à cette structure porteuse (3) de manière articulée autour d'au moins un axe géométrique (BB') ledit flotteur (4) pouvant occuper une première position stable déployée selon laquelle il est parallèle au plan géométrique longitudinal vertical (PP') contenant la ligne de quille de l'embarcation (2) et par le point le plus bas de sa ligne de quille il est disposé sous l'axe géométrique (BB') et une seconde position stable repliée, angulairement écartée de la précédente. L'invention porte également sur une embarcation dotée de ce dispositif.

Catamaran has one hull acting as a boom for the sail on the windward side with a mainsheet from the upper part of the sailing rig to the boom hull to counteract forces on the mast foot

The catamaran sailing boat, with two hulls (10,22), has spars (18) between them supporting a rig of at least one mast (12) with a sail (14). The smaller hull (22) acts as the boom, remaining on the windward side. The upper section of the rig has a block and tackle mainsheet (24), to the boom hull (22) of the boat, which counteracts forces working on the foot of the mast.

Wind-propelled boat having parallel self-righting paired masts for wind-assisted propulsion for boats

A wind-propelled vessel is described herein. The vessel includes at least one hull and at least one set of paired masts. Each paired mast of the at least one set of paired masts has a first mast located to one side of the vessel and a second mast located on the opposite side of the vessel. Also, each mast of the at least one set of paired masts has a spar located at or near the top of the mast. Moreover, each one of the spar located at or near the top of the mast extends inwards towards a center plane of the vessel, and an inward end of the spar is connected by a connector to another inward end of another one of the each one of the spar located at or near the top of the mast. In accordance with the illustrative examples provided herein, the connector imparts a dynamic force upon connected spars that responsively pulls the connected ones of the inward ends of the spars to their nearest position when tops of the masts to which the spars are fixably attached move away from a relative nearest position to a paired one of one set of paired masts.

A mast raised or lowered by means of drive member

Method for rigging and controlling a wing sail

rigging for a wing propelled craft comprises a mast having a starboard side and a port side, wherein the mast is controllably rotatable in either direction about a longitudinal axis; a flexible sail comprising a starboard flexible sail portion and a substantially identical port flexible sail portion, each flexible sail portion having a luff and a leach, wherein the luff of each sail portion is connected to a respective side of the mast; and a plurality of elongated battens, each of which extends substantially between the luff and the leach of one of the respective sail portions, each of which is in contact with the respective flexible sail portion. Rotation of the mast causes the battens connected to one of the sail portions to be compressed along their length so as to bend one of the sail portions to increase the camber thereof and causes the battens connected of the other sail portions to be tensioned along their length so as to partly straighten the other sail portion which changes the shape of an aerofoil formed by the sail. on, each flexible sail portion having a luff and a leach, wherein the luff of each sail portion is connected to a respective side of the mast; and a plurality of elongated battens, each of which extends substantially between the luff and the leach of one of the respective sail portions, each of which is in contact with the respective flexible sail portion. Rotation of the mast causes the battens connected to one of the sail portions to be compressed along their length so as to bend one of the sail portions to increase the camber thereof and causes the battens connected of the other sail portions to be tensioned along their length so as to partly straighten the other sail portion which changes the shape of an aerofoil formed by the sail.

SAILBOAT.

A sailing boat having a pivotally mounted mat (12). Guy wires (16) are attached to the mast (12) and are arranged to maintain the latter in a vertical position with a predetermined biasing force. The guy wires (16) are attached to hydraulically operating piston-and-cylinder units (18) which are part of a hydraulic system (18, 22, 24, 26). The hydraulic system is arranged to control the position of a train of weights (30) which are moveable transversely across the hull (28) of the sailing boat (10). When the wind acts on the sails of the sailing boat (10) the guy wires (16) affect the hydraulic system, whereby the weights (30) will be moved to a predetermined position wherein they generate a moment of forces balancing the effects of the wind, whereby the hull (28) will remain in a horizontal position.

IMPLANTING RACE OR CRUISE SHIP

Submersible vessel having retractable wing and keel assemblies

A submersible vessel (10) having wing (14) and keel (16) assemblies that are extendable for wind-powered surface operation and retractable to reduce drag for submerged operation or to place the vessel in a more compact configuration. The vessel may have first (52a) and second (52b) pressure hulls flanking the wing and keel assemblies. A deployment mechanism (60) including an actuator (62) and linkage pivots the wing and keel assemblies simultaneously between the deployed configuration in which the wing and keel assemblies extend outwardly above and below the hull assembly for wind-powered surfaced operation of the vessel and a retracted configuration in which the wing and the keel assemblies are angled back towards the hull assembly to reduce drag for submerged operation.

TILTING AND ADJUSTABLE MAT FOR ALL TYPES OF WIND-MOUNTED VESSELS AND VESSELS

Sailing propulsion unit, and ship incorporating such a unit

Un navire comprend une unité de propulsion vélique (100) allongée dans une direction verticale en position d’utilisation et comprenant des éléments propulsifs (111, 112) et un mât (121). Il est prévu selon l’invention, un dispositif de basculement comprenant une embase (210) solidaire d’une région proximale du mât (121) d’une unité et tournant autour d’un axe principal (A) horizontal sur un support (220) fixé sur un pont du navire, un dispositif (216, 217) de commande de basculement provoquant une rotation de l’embase par rapport au support et comprenant un premier actionneur (217) apte à générer un effort linéaire dans une direction horizontale et un élément de renvoi (216) reliant ledit actionneur à l’embase (210) pour opérer sur l’embase un effort en une première région (218) située à distance dudit axe principal, et un dispositif (300) de verrouillage de l’embase (210) sur l’élément support (220) comprenant un deuxième actionneur (310) apte à exercer, en une deuxième région (215) de l’embase (218), un effort de retenue en direction verticale. L’unité de propulsion vélique (100) peut être déplacée grâce au(x) premier(s) actionneur(s) (217) entre une position inactive où elle s’étend le long du pont du navire et une position érigée, le dispositif de verrouillage (300) étant apte à contribuer au maintien de l’unité dans sa position active. (Figure 2) A ship includes a sail propulsion unit (100) elongated in a vertical direction in the position of use and comprising propulsion elements (111, 112) and a mast (121). There is provided according to the invention, a tilting device comprising a base (210) secured to a proximal region of the mast (121) of a unit and rotating around a main horizontal axis (A) on a support (220 ) fixed on a deck of the ship, a tilt control device (216, 217) causing rotation of the base relative to the support and comprising a first actuator (217) able to generate a linear force in a horizontal direction and a return element (216) connecting ...

Watercraft having a crane for lifting loads

SLIDING KEEL SAILBOAT WITH REDUCED BALANCE HELMET.

Una embarcación a vela de quilla deslizable, del tipo que comprende un casco (1) de dicha embarcación, un mástil (2), y una disposición de velas, cuyo mástil (2) está montado de manera integral con una estructura pivotante (5) mediante un eje de pivotar, paralelo a un eje central longitudinal de la embarcación, con respecto a la estructura de casco (1), caracterizado porque dicha estructura de pivotar (5), libre de girar con relación al casco (1) de la embarcación, está dispuesta para permitir que la tripulación se incline o apoye sobre ella para equilibrar las fuerzas del viento que actúan sobre el mástil inclinado. A sliding keel sail vessel, of the type comprising a hull (1) of said vessel, a mast (2), and a sail arrangement, whose mast (2) is integrally mounted with a pivoting structure (5) by means of a pivot axis, parallel to a longitudinal central axis of the vessel, with respect to the hull structure (1), characterized in that said pivot structure (5), free to rotate relative to the hull (1) of the vessel , is arranged to allow the crew to lean or rest on it to balance the wind forces acting on the inclined mast.

Mast holder

Luffing mechanism for fret narrow rotor

Specific antibodies to alpha-enolase and method of using in immune diseases

FIELD: biotechnologies.SUBSTANCE: invention relates to the biotechnology. Described is a method of treating an inflammatory disease, comprising administering to an individual in need thereof an ENO1 antibody, where the antibody specifically binds to the epitope on ENO1 and inhibits ENO1 activity as a plasminogen receptor, where epitope is located in region consisting of sequenceFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKS(SEQ ID NO:39) ENO1 human, where the inflammatory disease is selected from a group consisting of multiple sclerosis, rheumatoid arthritis, Crohn's disease, ulcerative colitis, systemic lupus erythematosus, chronic obstructive pulmonary disease (COPD), asthma, allergy, psoriasis, atherosclerosis and their combination. Also described is a method of treating an immune disorder, comprising administering to an individual in need thereof an ENO1 antibody, where the antibody binds to the epitope on ENO1 and inhibits ENO1 activity as a plasminogen receptor, where the epitope is located in a region consisting of sequence 296FDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKS336 (SEQ ID NO:39) human ENO1, wherein the immune disorder is selected from a group consisting of chronic obstructive pulmonary disease (COPD), type 1 diabetes, osteoporosis, atherosclerosis and combinations thereof. Disclosed is a pharmaceutical composition for treating an inflammatory disease comprising an effective amount of an antibody or fragment thereof scFv, Fab or F (ab), which specifically binds to the epitope on ENO1 and inhibits ENO1 activity as a plasminogen receptor, where epitope is located in region consisting of sequenceFDQDDWGAWQKFTASAGIQVVG DDLTVTNPKRIAKAVNEKS(SEQ ID NO: 39) human ENO1, where the inflammatory disease is selected from a group consisting of multiple sclerosis, rheumatoid arthritis, Crohn's disease, ulcerative colitis, systemic lupus erythematosus, chronic obstructive pulmonary disease (COPD), asthma, allergy, psoriasis, atherosclerosis and a combination thereof ...

DEVICE FOR SAILBOAT RIGGING WITH PORTABLE FIXED MAST

Tilting rigging for sailing vessel has arcuate mast which can fold flat for retraction

The tilting rigging for a sailing vessel has a mast (26) with an arcuate section extending transversely to the boat hull and with its feet (32) resting on the bridge. The feet are mounted (34) for translational movement on the bridge. The feet move between positions in which the mast is folded flat and the feet are adjacent to the poop and another in which the mast is raised.

Vessel having at least one hinged mast

La présente invention se rapporte à un navire (1) comportant un pont (P) et qui est équipé d'au moins un mât (2) pourvu d'une bôme (3), caractérisé par le fait que ledit mât (2) est solidaire d'un socle (4) implanté dans ledit pont (P), et en ce que ce mât (2) et ce socle (4) sont pourvus de moyens d'articulation mutuels (A), de sorte que ledit mât (2) est conformé pour être déplacé d'une position sensiblement verticale et perpendiculaire audit pont (P) dans laquelle son extrémité inférieure (20) est complètement engagée dans ledit socle (4), vers une position au moins partiellement basculée dans laquelle ladite partie inférieure (20) dudit mât (2) est au moins partiellement sortie dudit socle (4), la direction de basculement de la partie du mât (2) qui s'étend au-dessus desdits moyens d'articulation (A) étant orientée à l'opposé de ladite bôme (3). The present invention relates to a ship (1) having a bridge (P) and which is equipped with at least one mast (2) provided with a boom (3), characterized in that said mast (2) is secured to a base (4) implanted in said bridge (P), and in that said mast (2) and said base (4) are provided with mutual articulation means (A), so that said mast (2) ) is shaped to be moved from a position substantially vertical and perpendicular to said bridge (P) in which its lower end (20) is fully engaged in said base (4), to a position at least partially tilted in which said lower part ( 20) of said mast (2) is at least partially out of said base (4), the direction of tilting of the part of the mast (2) which extends above said articulation means (A) being oriented to the opposite said boom (3).

Moving mechanism for cruiser arch

A cruiser arch moving and control mechanism includes a pair of carriage guides (32, 150, 188) fixed to opposite sides of a cruiser hull, and a pair of carriages (30, 170), each mounted to one of the opposing legs of the cruiser arch. Each of the carriage guides includes a slot (40, 156, 190) with an elongate linear track section and an adjacent arcuate track section. Each carriage includes a pair of spaced apart bearings (76/78, 164/176, 198/200) that are confined for reciprocal travel along one of the slots to support the carriage moveably relative to the associated carriage guide. Two linear actuators (34), one coupled between each carriage and its associated guide, are extendable and retractable in concert to move the arch between working and clearance positions. The carriage guides are configured to prevent any substantial rotation of the carriages until the arch is extended linearly at least a predetermined distance from the working position.

A propulsion system for a boat

A propulsion system for a boat comprising: - a main mast (6); - a plurality of aerofoils (9) connected to the main mast, at least one of the aerofoils being a displaceable aerofoil., the at least one displaceable aerofoil being adapted to be displaced along the main mast between an open position and a closed position; - wherein when the at least one displaceable aerofoil is in its open position the aerofoils together form a sail of open sail area; - and when the at least one displaceable aerofoil is in its closed position at least some of the aerofoils overlap to form a sail of closed sail area, the closed sail area being less than the open sail area; - a displacement mechanism adapted to displace the at feast one displaceable aerofoil between its open and closed positions; - at least one of the aerofoils ' having a solar panel thereon; and, - a stub mast (3) extending along a stub axis, the stub mast being free to rotate about the stub axis; - the stub mast being connected to the main mast by a stub pivot (7).

Vessel having at least one hinged mast

Device allowing the lateral inclination of the rigging of a sail-propelled craft

The present invention aims to allow lateral inclination of the rigging of any sailing boat, and particularly on a ballasted monohull capable of heeling at large angles, with the aim of making better use of its return couple and therefore increasing the ratio of the sail surface to the overall weight; and in addition, at certain sailing trims with respect to the wind (when running free for example) to make it possible to obtain an effect of dynamic lift of the sails. For this purpose, the rigging comprises, at its lower portion, a connection part 1 connecting the mast 4 to the lateral shrouds 6 attached to its outer ends 3. It is joined to the hull 10 via a longitudinal shaft 2 on the extension of which are located the fore and aft stay or stays of the rigging; this shaft allows the lateral inclination of the whole assembly; this same part 1 is also joined to the hull at the chainplates 9 by mechanical means 8 enabling this lateral inclination to be adjusted.

Verfahren und Vorrichtung zur Kentersicherung und zur Aufrichtung nach Kentern, insbesondere für Mehrrumpfyachten

Navire muni d’une extension et d’une défense

La présente divulgation porte sur un navire (1) comprenant :un bordé (12) ;une extension (2) ; etune défense (3) montée mobile par rapport à l’extension (2) entre : une position de navigation ; et une position d’accostage. Figure pour l’abrégé : Fig. 3

Sailing vessel

The present disclosure is directed generally toward sailing vessels. One example is a catamaran with one or more pivoting masts per hull member, which may pivot from a generally perpendicular upright position, to a generally flat stowed position toward the bow of the hulls. The masts are capable of sustaining a plurality of sails, which may travel 180 degrees with respect to the hulls.

Sailing vessel

The present disclosure is directed generally toward sailing vessels. One example is a catamaran with one or more pivoting masts per hull member, which may pivot from a generally perpendicular upright position, to a generally flat stowed position toward the bow of the hulls. The masts are capable of sustaining a plurality of sails, which may travel 180 degrees with respect to the hulls.

Sailing rig system

The invention relates to a sailing rig system (SRS) for a sailing ship comprising one or more airfoil sails comprising one or more sail defining frames including at least three airfoil sail shape-defining edges and/or at least theree airfoil sail shape-defining corners. The sail may be controllable, rotatable, pivotable, trimmable, reefable, stowable, slidable, windable, guidable, coaxial, weathervaning, wind/sun tracking, freestanding; it may provide cambering, reinforcing, sealing, boundary layer control, shielding means, sections and connections and it may be transparent. The frame may be a closable/deployable rotor sail frame. The frame may include rig components and the SRS may further comprise vertical/oblique/horizontal spars coupled with spar couplings. It may further comprise lateral, fore-and-aft, superposed sails, actuators, power generators, power sources, thermal management systems, defined rotor sails. It may provide sail twist. It may be coupled with a sailing ship with defined ship couplings. A sailing method is proposed.

Method and apparatus for reducing a heeling moment of a sailing vessel

Various embodiments of a sailing vessel are disclosed configured to reduce a heeling moment acting on the sailing vessel as a wind acts on a sail of the sailing vessel. Generally, a mast of the sailing vessel is allowed to cant to leeward, thus reducing the heeling moment.

船舶用の、特に大型船用の、硬帆、及び硬帆を具備した船舶

【課題】総重量が少なく、製造の際に費用対効果が高く、混雑した海域に跨って配設された橋梁、電線又は同様の構造下を通過することに影響しない、硬帆すなわち翼帆を提供すること。【解決手段】船舶（１０）用の、特に、ばら積み貨物船、タンカ、自動車運搬船、又はばら積み船などの大型船用の、硬帆（１００）であって、マスト（１４）と、マスト（１４）に取り付けられて底部（１５）及び頭部（１７）を具備した第１の翼帆体（１２）と、を備え、マスト（１４）が第１の翼帆体（１２）内に底部（１５）を貫通して挿入されて第１の翼帆体（１２）内に配設されている、硬帆（１００）において、マスト（１４）が、底部（１５）から始まり、第１の翼帆体（１２）の最大高さ（２１）までは延びていないこと、特に最大高さ（２１）の７５％未満までしか延びていないこととした。【選択図】図１

Voiles rigides pour un navire, couchées en épi

L’invention décrit un ensemble de propulsion vélique pour un navire (100), comprenant au moins deux voiles rigides (10) disposées à distance le long d’un axe de navire (N) et formant des ailes à profil aérodynamique s’étendant selon un axe de voile (A), dans lequel chaque voile rigide (10) est montée pivotante autour de l’axe de voile (A) et autour d’un axe de pivotement de couchage (P), entre une position hissée dans laquelle l’axe de voile (A) est perpendiculaire à un plan de navire formé par l’axe de pivotement de couchage (P) et l’axe de navire (N), et une position couchée sur la tranche ou une position couchée en tuilage, dans lesquelles l’axe de voile (A) est parallèle au plan de navire, et forme un angle non nul par rapport à l’axe de navire (N). Figure pour l’abrégé : Fig. 5b