Function resource configuration method and device

A function resource configuration method includes receiving, by a wearable device, a distribution request sent by a first terminal, where the distribution request is used to request the wearable device to distribute a first function resource of the wearable device to the first terminal, and where the first function resource is already occupied by a second terminal. The wearable device determines, based on the distribution request, whether to allow the first terminal to use the first function resource. If the wearable device allows the first terminal to use the first function resource, the wearable device sends a notification message to the first terminal that instructs the first terminal to use the first function resource.

PYRAZOLOPYRIMIDINE COMPOUNDS AND USES THEREOF

Disclosed are compounds of Formula (I), methods of using the compounds for inhibiting ALK2 activity and/or FGFR activity, and pharmaceutical compositions comprising such compounds. The compounds are useful in treating, preventing or ameliorating diseases or disorders associated with ALK2 activity and/or FGFR activity, such as cancer.

SUPPORT COMBINATION CARDS FOR ECOMMERCE

The claimed system and method allows for an electronic payment system to accept a single card that is both a debit card and a credit card. Further, a user may indicate a default value for the card regarding whether the card should be used as a debit card or a credit card.

System and method allowing advertisers to manage search listings in a pay for placement search system using grouping

A system for advertisers to efficiently manage their search listings in placement database search system includes grouping means for managing multiple categories for the search listings and query means for searching search listings. The system further includes quick-fill means for modifying an attribute in plurality of search listings by specifying the modification at single location.

MULTIPLE NETWORK DEVICE TYPE SUPPORT USING VARIABLE MAPPING

A system is disclosed for network management automation of multiple network devices from different vendors. Network devices from different vendors may include different variables, but a variable mapping of those different variables can be used for providing a single task that will perform the same function network devices from different vendors.

Method for measuring densities based on circular magnetic levitation

A sample to be measured is placed in a medium solution between two circular magnets to ensure that the sample to be measured is levitated in a set circular area between the two circular magnets, and a levitation position of the sample to be measured in the magnetic field is measured. The density of the sample is calculated according to formula (I): Compared to the prior art, the method of the present disclosure provides a novel method for measuring a density of a substance, in which the involved device is easy to operate and has low cost, and the measurement results are easy to observe and have high accuracy.

Superhigh torsional strength, metallic and airtight drillrod coupler

A superhigh torsional strength, metallic and airtight drillrod coupler including an externally threaded coupler having a radially outward outer shoulder at an end thereof in an axial direction, an inner end face at the other end thereof in the axial direction, and a first sealing face being provided in sequence in the axial direction of the externally threaded coupler. The coupler further includes an internally threaded coupler to be threadedly connected to the externally threaded coupler, the internally threaded coupler having a radially inward inner shoulder at an end thereof in an axial direction, and an outer end face at the other end thereof in the axial direction, with a second sealing face. Further, the first sealing face and the second sealing face are both sloped faces, and are in an interference-fit sealed connection with each other.

Function resource configuration method and device

A function resource configuration method and device relate to the field of communications technologies, where the configuration method includes receiving, by a wearable device, a distribution request from a first terminal, where the distribution request requests the wearable device to distribute a first function resource of the wearable device to the first terminal, and the first function resource is already occupied by a second terminal, determining, by the wearable device based on the distribution request, whether to allow the first terminal to use the first function resource, and sending, by the wearable device, a notification message to the first terminal instructing the first terminal to use the first function resource when the wearable device allows the first terminal to use the first function resource.

Structural flame retardant high strength low exothermic polymer grouting material for consolidating

A structural flame retardant high strength low exothermic polymer grouting material for consolidating, belonging to a technical field of polyurethane material, is produced by combined the polyether polyol and the modified isocyanate in a weight ratio of 100:(100-160), leading to internal reaction temperature ≤100° C., strength ≥60 mPa, bonding ≥3 mPa, oxygen index ≥28% while no halogen and no effect on water quality, odor level (80° C.) ≤3.5, and fog test ≤5 mg (which means no physical additive flame retardant is diffused into the environment). In particular, with no halogen, which is known as environmental hormones, in the plasticizers, there will be less combustion smoke, wherein the present invention will not release corrosive or irritating hydrogen halide gas, nor produce toxic carcinogens polybrominated benzoxins and polybrominated dibenzofurans, thereby avoiding the long-term impact of the material on the environment.

SYSTEMS, METHODS, AND COMPUTER PRODUCTS FOR IMPLEMENTING SHADOW VERSIONING TO IMPROVE DATA DEPENDENCE ANALYSIS FOR INSTRUCTION SCHEDULING

Systems, methods and computer products for implementing shadow versioning to improve data dependence analysis for instruction scheduling. Exemplary embodiments include a method to identify loops within the code to be compiled, for each loop a dependence initializing a matrix, for each loop shadow identifying symbols that are accessed by the loop, examining dependencies, storing, comparing and classifying the dependence vectors, generating new shadow symbols, replacing the old shadow symbols with the new shadow symbols, generating alias relationships between the newly created shadow symbols, scheduling instructions and compiling the code.

Bluetooth connection method and terminal

Embodiments of the present invention provide a Bluetooth connection method, including: sending, by a first terminal, a Bluetooth low energy BLE advertising message, where the BLE advertising message includes device information; receiving, by a second terminal, the BLE advertising message; obtaining, by the second terminal, the device information; matching, by the second terminal, the device information with prestored device information; if the device information successfully matches the prestored device information, initiating, by the second terminal, a classic Bluetooth connection request to the first terminal; and establishing, by the first terminal, a classic Bluetooth connection to the second terminal. Power consumption of BLE is low.

NETWORK ADAPTIVE MONITORING

A system is disclosed for network management automation using network intent or adaptive monitoring automation. Network intent (NI) represents a network design and baseline configuration for that network or network devices with an ability to diagnose deviation from the baseline configuration. The NI can be automated to update and replicate the diagnosis. The monitoring of the network can be adapted to capture network problems in advance with adaptive monitoring automation.

Data splitting for recursive data structures

Embodiments of the present invention provide a method, system and computer program product for the data splitting of recursive data structures. In one embodiment of the invention, a method for data splitting recursive data structures can be provided. The method can include identifying data objects of a recursive data structure type, such as a linked list, within source code, the recursive data structure type defining multiple different data fields. The method further can include grouping the data objects into some memory pool units, each of which can contain the same number of data objects. Each memory pool unit can be seen as an array of data objects. The method can include data splitting, which could be maximal array splitting in each different memory pool unit. Finally, the method can include three different approaches, including field padding, field padding and field splitting, to handle irregular field sizes in the data structure.

Photovoltaic connector

Embodiments of the present invention provide a photovoltaic (PV) connector, comprising a first connecting unit and a second connecting unit detachably connected with the first connecting unit, wherein the first connecting unit includes a first conductor, a first stop ring, a first housing and a first conductor core provided inside and detachably connected to the first housing; the first conductor is electrically connected with a pressing end of the first conductor core; the first stop ring is detachably connected with the first housing; the second connecting unit includes a second conductor, a second housing, a second stop ring and a second conductor core provided inside and detachably connected to the second housing; the second conductor is electrically connected with a pressing end of the second conductor core; the second stop ring is detachably connected with the second housing.

METHOD, SYSTEM, AND NETWORK ELEMENT FOR SERVICE PROCESSING AFTER DATA OF NETWORK ELEMENT IS INVALID OR NETWORK ELEMENT FAILS

A method, a system, and a network element for service processing after data of a network element is invalid or a network element fails is provided. When the service network element receives the service request message from the network and is initiated to a called end and the user data is invalid, the service network element returns a data invalid message of the called end to the network. When a network element containing registration data of a user is abnormal and the registration data of the user is invalid, by using the present invention, the service unavailable time is shortened, and user services can be recovered rapidly.

Method of preparing liquid state non-solvent silicone resin and resin formed thereby

A liquid state non-solvent silicone resin obtained from a polycondensation reaction of material (A) dimethyl poly siloxane, material (B) vinyl methyl cyclo siloxane and material (C) diphenyl dihydroxy silane, the reaction being performed at a temperature within about 140~180° C. under the presence of an anionic polymerization catalyzer.

Rectangular working well with preset pipe jacking hole and sliding back wall in water-rich stratum and construction method thereof

A construction method of a rectangular working well includes steps of: (I) designing functional requirements for the rectangular working well; (II) constructing a caisson of an enclosing structure of the rectangular working well; (III) constructing an edge protector; (IV) excavating earthwork of the rectangular working well; (V) forming a back cover for the rectangular working well, and pre-embedding a sliding track, a pull ring and a back wall anchor; (VI) installing a ladder for entering the rectangular working well; (VII) preventing joint leakage; (VIII) installing a water-proof pressure plate at an entrance of the preset pipe jacking hole; (IX) constructing the sliding back wall; (X) lifting the sandwich concrete slab wall at a top of the preset pipe jacking hole; and (XI) performing pipe jacking. The structure system constructed by the present invention has many advantages such as clear function, safety, quickness, and flexible design. 1. A construction method of a rectangular working well with a preset pipe jacking hole and a sliding back wall in a water-rich stratum , comprising steps of:(I) designing functional requirements for the rectangular working well, comprising steps of:(1) collecting relevant data to determine a plane size, a depth, and a treatment method of a working well back cover, so as to satisfy well operation requirements;(2) determining a height and a diameter of the preset pipe jacking hole according to a position, a diameter, a material and a connection method of a proposed pipeline, wherein a quantity of the preset pip jacking hole is at least one; and(3) calculating and drawing a structure of the rectangular working well: using comparative calculation analysis of a rod system element method and numerical simulation to obtain an optimal supporting structure composition of the rectangular working well, and then drawing to complete functional requirement design for the rectangular working well;(II) constructing a caisson of an enclosing ...

Method for Establishing Wireless Communication Connection, and Device

A method includes a first device and sends a network scanning request to a second device over a short-range wireless communication connection between the first device and the second device; the first device receives a scanning result that is of at least one first wireless signal and that is sent by the second device; and the first device sends a wireless connection request to at least one third device based on a wireless signal scanning result to establish a wireless connection to the at least one third device, where the wireless signal scanning result includes the scanning result of the at least one first wireless signal. 127-. (canceled)28. A wireless communication connection method implemented by a first device , the wireless communication connection method comprising:stopping scanning a first wireless signal;sending, in response to stopping the scanning, a network scanning request to a second device over a short-range wireless communication connection between the first device and the second device, wherein the network scanning request instructs the second device to scan the first wireless signal;receiving a first scanning result of the first wireless signal from the second device; andsending a wireless connection request to a third device to establish a wireless connection to the third device based on one or more wireless signal scanning results, wherein the one or more wireless signal scanning results comprise the first scanning result.29. The wireless communication connection method of claim 28 , further comprising scanning a second wireless signal to obtain a second scanning result claim 28 , wherein the one or more wireless signal scanning results further comprise the second scanning result.30. The wireless communication connection method of claim 29 , wherein before sending the wireless connection request to the third device claim 29 , the wireless communication connection method further comprises: detecting a user selection for the one or more wireless ...

CREATOR EXPERIMENTATION FRAMEWORK

In one embodiment, a method includes a computer server machine receiving a request from a first user to interact with a multimedia content. The computer server machine then associates the first user with a control group, wherein the control group comprises a first set of users interacting with the multimedia content. When the first user is associated with the control group, the computer server machine then applies a first content insertion model to the multimedia content and records a first set of metrics based on the interaction of the first user with the multimedia content. 1. A method , comprising:by a computer server machine, receiving a request from a first user to interact with a multimedia content;by the computer server machine, associating the first user with a control group, wherein the control group comprises a first set of users interacting with the multimedia content;by the computer server machine, applying a first content insertion model to the multimedia content when the first user is associated with the control group;by the computer server machine, recording a first set of metrics, wherein the first set of metrics comprises a first quantifier of attributable results generated by the interaction of the first user with the multimedia content;by the computer server machine, obtaining a second set of metrics comprising a second quantifier of attributable results generated by interaction of a second user with the multimedia content, wherein the second user is associated with an experimental group corresponding to a second content insertion model; andby the computer server machine, determining a recommended content insertion model based on a comparison of the first quantifier of attributable results and the second quantifier of attributable results.2. The method of claim 1 , further comprising:by the computer server machine, receiving a request from a second user to interact with the multimedia content;by the computer server machine, associating the second ...

Systems and Methods to Reduce the Impact of Short Bits in Phase Change Memory Arrays

A memory device includes a memory array comprising a plurality of memory elements and a memory controller coupled to the memory array. The memory controller when in operation receives an indication of a defect in the memory array determines a first location of the defect when the defect is affecting only one memory element of the plurality of memory elements, determines a second location of the defect when the defect is affecting two or more memory elements of the plurality of memory elements, and performs a blown operation on a defective memory element at the second location when the defect is affecting two or more memory elements of the plurality of memory elements.

Cavity creation tool by crushing with multi-stage controllable water jet for natural gas hydrate development

A cavity creation tool by crushing with multi-stage controllable water jet, it is used in natural gas hydrate development and mainly consists of an inner tube upper joint, an inner tube lower joint, an intermediate sleeve, an inner structure consisting of a coaxial throttle push rod, an outer layer sleeve, an outer layer structure consisting of a supporting ring, a jet head mounted to the intermediate sleeve and threading the outer layer sleeve, and a jet crushing structure consisting of a single-stage telescopic jet head and a two-stage telescopic jet head.

Support tool and back-pressure grouting device for leakage repair of inspection well and repair method thereof

A support tool for leakage repair of an inspection well includes: a curved loading plate having multiple grouting holes thereon, a telescopic adjustment device, and a base; wherein: one end of the telescopic adjustment device is connected to an inner side face of the curved loading plate, and the other end of the telescopic adjustment device is connected to the base; the telescopic adjustment device adjusts a distance between the curved loading plate and the base. The support tool is firstly hoisted at a leakage position of the inspection well; then a telescopic length of the telescopic adjustment device is adjusted, so that the curved loading plate and the base are in a close contact with opposite sides of the inspection well wall; and a grouting system is used to inject a double-slurry quick-setting repair material into a grouting pipe on the curved loading plate for plugging leakage.

Polymer expanding material used in infiltration or seepage watery environment and preparation method thereof

The present invention relates to a polymer expanding material in infiltration or seepage multi-water environment and a preparation method thereof, belonging to a technical field of polymer expanding foam materials. The polymer expanding material includes the following parts of materials by weight: 20-30 parts of rosin polyester polyol, 20-50 parts of isocyanate, 20-40 parts of PhireGuard® MB-512, 5-10 parts of HFO-1233zd, 1-2 parts of surfactant, 0.01-1 part of catalyst, and 0.01 parts of benzoyl chloride. The present invention has high sand fixing body strength, fast curing speed, good elastoplasticity, good pouring property and permeability, and good expanding property, which is suitable for infiltration or seepage multi-water environment, especially for dam infiltration, piping, and other problems during construction and subsequent operation of water conservancy projects.

Detecting and repairing method for external diseases of buried drainage pipeline

A method for detecting and repairing external diseases of a buried drainage pipeline includes steps of: S1, controlling a robot to enter the pipeline to perform comprehensive detection of pipeline diseases; S2, analyzing detected pipeline diseases with a computer terminal based on detection results of the robot, and determining locations of external diseases of the pipeline; S3, controlling the robot to detect a depth of the external diseases of the pipeline relative to a ground surface; S4, determining a projection position of the external diseases of the pipeline on the ground surface according to detection results of the step S2, and drilling a hole from the ground surface; determining a drilling depth according to detection results of the step S3, and inserting a grouting pipe; and S5, grouting and repairing the external diseases of the pipeline through the grouting pipe.

In-service repair method combining externally bonded pre-stressed FRP and polymer grouting for PCCP with broken wire

A in-service repair method combing externally bonded pre-stressed FRP and polymer grouting for PCCP with broken wire, includes excavating PCCP, supporting the PCCP, treating outer wall of PCCP, bonded an external of the PCCP with pre-stressed FRP for repairing, laying grouting pipe, backfilling and grouting for densing. First of all, excavating a PCCP pipeline to be repaired and supporting the PCCP pipeline with a supporting device, smoothing the outer wall of the PCCP pipeline at a broken wire position and applying primer, and winding the FRP around a damaged portion of the PCCP pipeline, pre-stressing the FRP by applying a pre-stressing device and applying dipping glue to the FRP after tension to stick the FRP on the pipe wall, then laying a grouting pipe, backfilling the pipeline repaired, and finally injecting polymer into the soil after backfilling and compacting the soil by the grouting pipe pre-buried.

Wireless communication connection method and terminal

A wireless communication coupling method and a terminal, where the method includes selecting, by a first terminal, a wireless coupling mode in a target application, determining a target identifier in an identifier list of the target application, sending, using a wireless network, a wireless coupling request for the wireless coupling mode to a second terminal corresponding to the target identifier, and establishing a wireless communication coupling in the wireless coupling mode to the second terminal when receiving an acknowledgement response to the wireless coupling request.

In-service and trenchless repair method for disconnection of drainage pipeline

A in-service trenchless repair method for disconnection of a drainage pipe includes steps of: detecting the disconnection by a pipe sonar, and making a traction rope; pulling a hollowed cylindrical airbag to the disconnection according to the mark on the traction rope; controlling an airbag valve by an air compressor on the ground to inflate the hollowed cylindrical airbag, so that the hollowed cylindrical airbag is in close contact with pipeline wall after inflation; drilling a grouting hole on the ground surface directly above and on both sides of the disconnection until reaching the disconnection, and inserting a grouting pipe into the grouting hole; then injecting a double-slurry quick-curing repair material into the disconnection through a grouting system on the ground and waiting for curing; deflating the hollowed cylindrical airbag and pulling out by the traction rope.

Cylindrical Retroreflector Array for Rotation Tracking

An electronic device is described. The electronic device may include a housing, a rotatable crown, and a self-mixing interferometry (SMI) sensor positioned within the housing. The rotatable crown may include an array of retroreflective surface features that reflect incident light back to a light source. Each retroreflective surface feature of the array of retroreflective surface features may be formed as a corner-cube with three perpendicular faces. The SMI sensor or associated processing electronics may compare originally emitted light with reflected light to identify a movement or distance of the rotatable crown with respect to the SMI sensor.

Methods and systems for extracting blood vessel

A method for extracting a blood vessel is provided. An image relating to a blood vessel may be acquired. The image may include multiple slices. A region of interest in the image may be determined. A blood vessel model may be obtained. The blood vessel may be extracted from the region of interest based on the blood vessel model.

Track-type jet grouting integrated system

A track-type shotcrete integrated system includes: a proportioner working bin, a storage bin, a power bin, and load-bearing legs, wherein bottom sections of the load-bearing legs are equipped with a track chassis for moving, and the track chassis is electrically connected to a track controller; the storage bin contains a storage tank I and a storage tank II for storing different raw materials; a feed pump I is installed on a top of the storage tank I, and a feed pump II is installed on a top of the storage tank II; inlet pipes of the feed pump I and the feed pump II insert into the storage tank I and storage tank II respectively, and outlet pipes of the feed pump I and the feed pump II are connected to a feed pipe I and a feed pipe II respectively . . . 112115171719191621201862081868201868453145323242324. A track-type jet grouting integrated system , comprising: a proportioner working bin () , a storage bin () , a power bin () , and load-bearing legs () , wherein bottom sections of the load-bearing legs () are equipped with a track chassis () for moving , and the track chassis () is electrically connected to a track controller (); the storage bin () is made of two storage tanks , a storage tank I () and a storage tank II () , for storing different raw materials; a feed pump I () is installed on a top of the storage tank I () , and a feed pump II () is installed on a top of the storage tank II (); inlet pipes of the feed pump I () and the feed pump II () are inserted into the storage tank I () and storage tank II () , respectively; and outlet pipes of the feed pump I () and the feed pump II () are connected to a feed pipe I () and a feed pipe II () , respectively; a slurry proportioner () is mounted inside the proportioner working bin () , and both the feed pipe I () and the feed pipe II () are connected to the slurry proportioner (); an outlet () of the slurry proportioner () is connected to a spray head () , and an air nozzle () is provided beside the spray head ...

FUNCTIONALIZED AZABORINE COMPOUNDS AND AZABORINE-CONTAINING BIARYLCARBOXAMIDES, AND COMPOSITIONS AND METHODS THEREOF

The invention provides novel azaborine compounds, methods for their syntheses and functionalization, and various applications thereof. For example, novel azaborine-containing biarylcarboxylic acids and biarylcarboxamides are disclosed herein, which provide the opportunity to be used as therapeutic agents in different diseases. The novel azaborine-containing compounds show unique physical and biological properties when compared to their corresponding all-carbon compounds. Also, disclosed herein are substituted 1,2-dihydro-1,2-azaborine compounds and methods for making the same including methods for the preparation of various substituted azaborines including alkyl, alkenyl, aryl, nitrile, heteroaryl, and fused ring substituents in the presence of B—H, B—Cl, B—O and N—H bonds from Br-substituted azaborines as well as the synthesis of new fused BN-heterocycles. 35-. (canceled)79-. (canceled)11. (canceled)1314-. (canceled)16. The method of claim 15 , wherein Xis a halogen.17. (canceled)18. The method of claim 15 , wherein the catalyst is PdCl(Potol)or Pd(PtBu).1923-. (canceled)25. The method of claim 24 , wherein Xis a halogen.26. The method of claim 25 , wherein Xis bromine.27. The method of claim 24 , wherein the catalyst is PdCl(Potol)or Pd(PtBu).28. The method of claim 24 , wherein the zincate is RZnX claim 24 , whereinR is an optionally substituted alkyl, alkoxy, aryl, alkenyl, alkynyl, heteroaryl, phosphinyl, amino, amide, silyl, thio, sunlfonyl, carbonyl, ester, or ketone desired to be added to formula (III); and{'sup': 'a', 'Xis a halogen.'}29. The method of claim 28 , wherein Xis bromine.30. The method of claim 28 , wherein the reaction is conducted in an organic solvent.3336-. (canceled)38. (canceled) This application claims the benefit of U.S. Provisional Application No. 61/979,049, filed Apr. 14, 2014, and 62/001,685, filed May 22, 2014, the entire content of each of which is incorporated herein by reference in its entirety.This invention was made with ...

Method for on-line measurement of polymer melt temperature and apparatus thereof

The present disclosure discloses a method for on-line measurement of the polymer melt temperature, comprising: on-line measurement of ultrasonic sound velocity c of melt in an injection molding process, on-line measurement of melt pressure P in the injection molding process, and obtaining melt temperature T in the injection molding process by formula (1). The present disclosure also discloses an apparatus for on-line measurement of the polymer melt temperature. The method and the apparatus provided in the present disclosure may enable on-line and in-situ characterization of the melt density and further enable on-line quantitative measurement of the melt quality. Compared with infrared measurement methods, the method provided herein is significantly reduced in cost, which is of great significance to theoretical researches of crystallization process and shear heating.

Method and system for versioning codes based on relative alignment for single instruction multiple data units

A method and system for generating efficient versioned codes for single instruction multiple data units whose memory systems have alignment constraints. The system creates multiple versions of codes based on relative alignments of the data streams involved in the computation. The system also analyzes characteristics of relative alignments (e.g. compile-time or runtime) to determine whether code versioning is beneficial based on a cost model.

Online Fault Detection and Avoidance Framework for Distributed Factory Control Systems

An on-line fault detection and avoidance method is provided for industrial control systems that include multiple interacting process controllers. The method addresses the problem that not all faults can be determined and removed at the time of system design and testing. When a fault translates into a time-out condition in one or more controllers, symptoms are identified, persistence is measured, other involved controllers are identified, the fault condition is identified and control laws are reconfigured to avoid the fault condition in the future.

METHOD, SYSTEM, AND ENTITY FOR EXERCISING POLICY CONTROL

A method and a system for exercising policy control, a PCEF, and a PCRF are provided, which can solve the problem that no policy control can be exercised over application service flows without an application function (AF). The method includes of the following steps: a PCRF receiving information about an application event sent by a PCEF; and the PCRF generating a control policy for a service flow of the application according to the information about the application event, and delivering the control policy to the PCEF. In the present invention, the PCEF sends the obtained information about the application event to the PCRF, so that the PCRF can generate a control policy according to policy contexts including the information about the application event and the like, so as to exercise an effective policy control over the QoS guarantee, charging and gating of the service flow.

Superconducting Quantum Chip

A superconducting quantum chip includes a coupler and a controller. The coupler is configured to couple a first superconducting bit circuit and a second superconducting bit circuit. A frequency response curve of the coupler includes at least one phase inversion point, and the phase inversion point includes a resonance point or a pole of the frequency response curve. The controller is configured to adjust the frequency response curve of the coupler, so that an odd quantity of phase inversion points is included between a bit frequency of the first superconducting bit circuit and a bit frequency of the second superconducting bit circuit. The controller further adjusts a frequency of the phase inversion point, so that an equivalent interaction of cross-resonance effect of the first superconducting bit circuit and the second superconducting bit circuit is zero.

TRAJECTORY SIMILARITY SEARCH

A computer-implemented method, a computer system, and a computer program product for trajectory similarity search is provided. The present invention may include, in response to receiving, by one or more processors, a search request for at least one trajectory similar to a query trajectory, determining, by one or more processors, a respective similarity between a query trajectory and a plurality of trajectories by calculating, in a synchronized way, a spatial distance measure and a time difference measure between the query trajectory and the plurality of trajectories. The present invention may further include, identifying, by one or more processors, the at least one trajectory from the plurality of trajectories based on the respective similarity between the query trajectory and the plurality of trajectories. 1. A computer-implemented method comprising:in response to receiving, by one or more processors, a search request for at least one trajectory similar to a query trajectory, determining, by one or more processors, a respective similarity between a query trajectory and a plurality of trajectories by calculating, in a synchronized way, a spatial distance measure and a time difference measure between the query trajectory and the plurality of trajectories; andidentifying, by one or more processors, the at least one trajectory from the plurality of trajectories based on the respective similarity between the query trajectory and the plurality of trajectories.2. The method of claim 1 , wherein determining the respective similarity between the query trajectory and the plurality of trajectories further comprises:simplifying, by one or more processors, the query trajectory.3. The method of claim 2 , wherein the query trajectory includes a plurality of locations associated with a moving object at different time points claim 2 , and simplifying the query trajectory further comprises:dividing, by one or more processors, the query trajectory into a plurality of line segments by ...

Mounting apparatus for data storage devices

A mounting apparatus for mounting a data storage device that has a protrusion protruding from a sidewall thereof includes a mounting board, and a bracket. The mounting board includes a depressed portion for holding the data storage device. The depressed portion includes a first side wall. The bracket includes a leg member with an end pivotably mounted to the first side wall of the depressed portion of the mounting board. A first receiving slot for receiving the protrusion of the data storage device is defined in a bottom of the leg member. A drive portion is formed at a side of the receiving slot away from the end of the leg member, for cooperating with a corresponding protrusion of the data storage device when installing the data storage device.

In-service and trenchless repair method for disconnection of drainage pipeline

A in-service trenchless repair method for disconnection of a drainage pipe includes steps of: detecting the disconnection by a pipe sonar, and making a traction rope; pulling a hollowed cylindrical airbag to the disconnection according to the mark on the traction rope; controlling an airbag valve by an air compressor on the ground to inflate the hollowed cylindrical airbag, so that the hollowed cylindrical airbag is in close contact with pipeline wall after inflation; drilling a grouting hole on the ground surface directly above and on both sides of the disconnection until reaching the disconnection, and inserting a grouting pipe into the grouting hole; then injecting a double-slurry quick-curing repair material into the disconnection through a grouting system on the ground and waiting for curing; deflating the hollowed cylindrical airbag and pulling out by the traction rope.

COMPILER METHOD OF EXPLOITING DATA VALUE LOCALITY FOR COMPUTATION REUSE

A compiler method for exploiting data value locality for computation reuse. When a code region having single entry and exit points and in which a potential computation reuse opportunity exists is identified during runtime, a helper thread is created separate from the master thread. One of the helper thread and master thread performs a computation specified in the code region, and the other of the helper thread and master thread looks up a value of the computation previously executed and stored in a lookup table. If the value of the computation previously executed is located in the lookup table, the other thread retrieves the value from the table, and ignores the computation performed by the thread. If the value of the computation is not located, the other thread obtains a result of the computation performed by the thread and stores the result in the lookup table for future computation reuse.

METHOD TO EXPLOIT SUPERWORD-LEVEL PARALLELISM USING SEMI-ISOMORPHIC PACKING

A computer program product is provided for extracting SIMD parallelism. The computer program product includes instructions for providing a stream of input code comprising basic blocks; identifying pairs of statements that are semi-isomorphic with respect to each other within a basic block; iteratively combining into packs, pairs of statements that are semi-isomorphic with respect to each other, and combining packs into combined packs; collecting packs whose statements can be scheduled together for processing; and generating SIMD instructions for each pack to provide for extracting the SIMD parallelism.

Circuit and method for preventing screen flickering, drive circuit for display panel, and display apparatus

Circuit and method for preventing screen flickering, a drive circuit for a display panel, and a display apparatus are provided, relating to the field of display technology. The circuit for preventing screen flickering includes a control sub-circuit configured to control a gate drive circuit of the display panel to output a gate cut-off level during a power-on period of the display panel. The gate drive circuit of the display panel is controlled to output the gate cut-off level during the power-on period, the gate cut-off level is provided to gate lines of the display panel such that TFTs connected to the gate lines are in cut-off state during the power-on period.

Method and apparatus for optimizing code with artificial statements

A method, apparatus, and computer instructions for facilitating optimization of code. An artificial statement is placed into the code. The artificial statement encodes information. The code is optimized with a compiler. The compiler performs an action based on the artificial statement in the code.

Multi-Device Wireless Connection Method and Device

A multi-device wireless connection method and a device. The method includes obtaining device information corresponding to a first account, selecting a second device according to a user-triggered selection instruction and the device information corresponding to the first account, where the second device is a device to which the first account is logged in, sending a pairing request to the server, where the pairing request comprises identification information of the second device, receiving pairing information sent by the server, where the pairing information is used for pairing between the first device and the second device, where the pairing information comprises a first random number which is generated by the server, or by the second device and sent to the server, and performing, by the first device, pairing with the second device according to the pairing information, and implementing a wireless connection between the first device and the second device. 128-. (canceled)29. A multi-device wireless connection method , comprising:obtaining, by a first device, from a server, device information corresponding to a first account;selecting a second device according to a user-triggered selection instruction and according to the device information corresponding to the first account, wherein the second device is a device to which the first account is logged in;sending a pairing request to the server, wherein the pairing request comprises identification information of the second device;receiving pairing information sent by the server, wherein the pairing information is used for pairing between the first device and the second device, wherein the pairing information comprises a first random number which is generated by the server, or is generated by the second device and sent to the server; and generating a second random number and determining first authentication information according to the first random number and the second random number; and', 'sending the second random ...

MAGNETIC WRITER HAVING CONVEX TRAILING SURFACE POLE AND CONFORMAL WRITE GAP

A magnetic write apparatus has a media-facing surface (MFS), a pole, a write gap, a top shield and coil(s). The pole includes a yoke and a pole tip. The pole tip includes a bottom, a top wider than the bottom and first and second sides. The pole tip has a height between the top and the bottom. At least part of the top of the pole tip is convex in a cross-track direction between the first and second sides such that the height at the MFS is larger between the first and second sides than at the first and second sides. The height increases in a yoke direction perpendicular to the MFS. The write gap is adjacent to and conformal with the top of the pole at the MFS and is between part of the top shield and the pole. The top shield is concave at the MFS.

Portable electronic device

DYNAMIC CHECKOUT BUTTON APPARATUSES, METHODS AND SYSTEMS

The DYNAMIC CHECKOUT BUTTON APPARATUSES, METHODS AND SYSTEMS (DCB) transforms product page checkout request input and user identification input via DCB components such as offer/discount determination component and checkout button embedding component, into dynamic checkout button outputs. 1. A computer system for generating graphical user interfaces comprising at least one central processor physically configured according to computer executable instructions , a memory for storing computer executable instructions and an input output circuit , the central processor being physically configured for:receiving, using one or more processors, a checkout request from a computing device having a display;generating, using the one or more processors, data to be embedded into a wallet-associated checkout button wherein the wallet-associated checkout button occupies an area within the display, wherein the data comprises one or more dynamic images that represent one or more financial accounts and wherein the dynamic images are displayed within the area of the display occupied by the wallet-associated checkout button;receiving, using the one or more processors, a payment request; and,morphing, using the one or more processors, the wallet-associated checkout button into an additional graphical user interface to receive password data associated with the one or more financial accounts.2. The computer system of claim 1 , wherein morphing the wallet-associated checkout button into an additional graphical user interface includes: expanding the wallet-associated checkout button into the additional graphical user interface which is displayed in at least one of the wallet-associated checkout button claim 1 , a linear extension of the wallet-associated checkout button claim 1 , or a user defined location.3. (canceled)4. (canceled)5. The computer system of claim 1 , wherein the additional graphical user interface includes a look and feel defined by one of the wallet-associated checkout button ...

ASSISTANCE SYSTEM AND METHOD FOR SUSPENSION DEVICE, AND X-RAY IMAGING SYSTEM

Provided in the present application are an assistance system and method for a suspension device, and an X-ray imaging system. The suspension device includes a tube device, a tube controller, a motion driving device and an assistance system. The motion driving device is capable of driving the suspension device to move along a first coordinate system. The assistance system includes a measurement device and a control device. The measurement device is disposed between the tube device and the tube controller so as to obtain an initial force of an operator, wherein the initial force includes the magnitude and direction of a force along a second coordinate system in which the measurement device is located. The control device includes a calibration unit and a calculation unit. The calibration unit is used for calibrating the initial force to obtain a calibrated force. The calculation unit is used for performing a coordinate transformation on the calibrated force to obtain a torque value corresponding ...

Method and device for driving display panel and display device

A method for driving a display panel, a device for driving a display panel and a display device are provided. The method for driving a display panel includes: acquiring a GOA signal corresponding to a current frame of image, where the GOA signal includes a plurality of clock signals; determining a transmission channel corresponding to each of the plurality of clock signals, and generating a correspondence relationship between the clock signals and respective transmission channels, where the transmission channels are used to deliver the clock signals from a GOA control signal generator to a GOA circuit of the display panel, the current frame of image is different from at least one frame of image previous to the current frame of image with respect to the correspondence relationship between the clock signals and respective transmission channels; and transmitting the clock signals by using the determined transmission channels.

Display screen or portion thereof with animated graphical user interface

Online fault detection and avoidance framework for distributed factory control systems

An on-line fault detection and avoidance method is provided for industrial control systems that include multiple interacting process controllers. The method addresses the problem that not all faults can be determined and removed at the time of system design and testing. When a fault translates into a time-out condition in one or more controllers, symptoms are identified, persistence is measured, other involved controllers are identified, the fault condition is identified and control laws are reconfigured to avoid the fault condition in the future.

Beverage maker

Method for establishing classic Bluetooth connection between dual-mode Bluetooth devices, and dual-mode Bluetooth device

Embodiments of the present disclosure provide, for example, a Bluetooth connection method, the example method including sending, by a first terminal, a Bluetooth low energy BLE advertising message, where the BLE advertising message includes device information. A second terminal receives the BLE advertising message, and then obtains the device information. The second terminal then matches the device information with prestored device information and, if the device information successfully matches the prestored device information, initiates a classic Bluetooth connection request to the first terminal, where the first terminal then establishes a classic Bluetooth connection to the second terminal. Power consumption of BLE is low.

Pipeline radar and television inspection robot

The present application discloses a pipeline radar and television inspection robot which includes a robot body, a directional drilling lifting device, a directional drilling rotary device, a directional drilling swing device, a radar, cameras and a driving apparatus; wherein the directional drilling lifting device is on a front part of the robot body; the directional drilling rotary device is on the directional drilling lifting device; the directional drilling swing device is on the directional drilling rotary device; the radar and the cameras are on the directional drilling swing device; the driving apparatus are on a bottom of the robot body. The directional drilling lifting device, the radar and the cameras are plugged in the robot body. The robot body electrically connects to cables which electrically connect to a control system. The cameras and the radar are able to be adjusted and the components are connected as modules.

Keyboard application with third party engagement selectable items

Embodiments of the invention are directed to an embodiment of a keyboard application in which a plurality of selectable items (representing keys) are associated with transactions. The keyboard application may be imported into any application that utilizes text input, and replaces a default keyboard used to provide the text input. Upon selection of one of the plurality of selectable items, a transaction is initiated by a service provider computer. In some embodiments, the transaction may result in the engagement of a third party entity. Once completed, an access credential associated with the completion of the transaction is generated. The access credential may be entered into the text input field of the application that utilizes text input.

Generating three-dimensional façade models from images

The subject disclosure relates to generating three-dimensional façade models from images. In one aspect, a systematic decomposition schema is disclosed for a façade structured into a Direct Acyclic Graph and implemented as a top-down recursive subdivision and bottom-up merging. In a further aspect, optimization of façade depth operating in a façade surface and in the super-pixel level of a whole subdivision region is described.

Method and broadband device for modem dial-up

A method and a broadband device for modem dial-up terminal which relate the communication with an evolved high rate packet data (eHRPD) network by using an existing protocol by receiving, by a broadband device, a first link control protocol (LCP) request message of a wireless network side device; processing an extensible authentication protocol (EAP) authentication field of the first LCP request message into an authentication field supported by a dial-up terminal; sending the processed first LCP request message to the dial-up terminal; receiving a first LCP response message returned by the dial-up terminal; processing an authentication field of the first LCP response message into an authentication field supported by the wireless network side device; sending the processed first LCP response message to the wireless network side device; and acquiring an Internet Protocol (IP) address from the wireless network side device, and sending the IP address to the dial-up terminal.

RISK-BASED ROOT CAUSE IDENTIFICATION METHODS AND RELATED AUTOBUILD SYSTEMS

Database systems and methods are provided for identifying a change associated with an update to executable code resulting in test failure. One method involves calculating risk scores for different changes associated with the update based on change characteristics associated with the respective changes, identifying a change from among the different changes associated with the update based on the risk scores associated with the respective changes, generating a modified update to the executable code that includes the identified change and excludes remaining changes of the update from the modified update, and initiate execution of one or more tests with respect to a compiled version of the modified update to the executable code. When execution of the one or more tests against the modified update results in a test failure, the change is identified as a potential root cause of the test failure associated with the update.

Sensor device for plants having a spectroscopy vegetation index and height of the target plant determination

To provide a plant sensor device capable of obtaining a parameter to determine a growth status other than a spectroscopy vegetation index without increasing its configuration. The plant sensor device includes a light emission part for emitting a measurement light to irradiate a target plant, a light receiving part for receiving a reflected light from the target plant, and a control section for controlling the light emission part and light receiving part. The control section determines a spectroscopy vegetation index of the target plant by obtaining a reflection rate of the target plant based on the measurement light and reflected light. The control section calculates a distance from the target plant to the light emission part in accordance with the measurement light and reflected light, and determines a plant height of the target plant based on the distance.

Sparse vectorization without hardware gather / scatter

A target operation in a normalized target loop, susceptible of vectorization and which may, after compilation into a vectorized form, seek to operate on data in nonconsecutive physical memory, is identified in source code. Hardware instructions are inserted into executable code generated from the source code, directing a system that will run the executable code to create a representation of the data in consecutive physical memory. A vector loop containing the target operation is replaced, in the executable code, with a function call to a vector library to call a vector function that will operate on the representation to generate a result identical to output expected from executing the vector loop containing the target operation. On execution, a representation of data residing in nonconsecutive physical memory is created in consecutive physical memory, and the vectorized target operation is applied to the representation to process the data.

Immune tolerant elastin-like peptide tetramer guided nanoparticles and methods of use

Disclosed herein, are nanoparticles comprising one or more immune-tolerant elastin-like polypeptide tetramers and one or more immune-tolerant elastin-like fusion molecules. Also, disclosed herein are pharmaceutical compositions including the nanoparticles; methods of administering the nanoparticles to patients for the treatment of cancer; and methods of making the nanoparticles.

Data sending method and apparatus, and terminal

A data sending method and apparatus, and a terminal. The method includes determining, when a low energy short range wireless communication protocol is used to run a data transmission service, and according to at least one of a service type of the data transmission service or a user indication, a data sending mode for running the data transmission service, and running the data transmission service in the determined data sending mode.

Composite slotting equipment combined static pressure and vibration of polymer anti-seepage wall and using method thereof

A pressing-pulling device, a polymer anti-seepage wall static pressure vibration composite slotting equipment and a using method include: a pressing-pulling bracket, wherein slotting oil cylinders are symmetrically and vertically mounted on the pressing-pulling bracket, and a piston rod of each of the slotting oil cylinders faces downwardly; a bottom end of the piston rod is connected to a connecting plate, and a through-hole is provided in a middle of the connecting plate; a continuous lifting mechanism is installed in a middle of the pressing-pulling bracket, and a slotting rod is vertically inserted into the continuous lifting mechanism; a lifting ring is installed at a top end of the slotting rod; a bottom end of the slotting rod extends downwardly through the through-hole to connect to a slotting cutter; a locking device is fixed on the connecting plate near the through-hole for fixing the slotting rod. 126232325926896881924258. A pressing-pulling device , comprising: a pressing-pulling bracket () , on which slotting oil cylinders () are symmetrically and vertically installed; wherein a piston rod of the slotting oil cylinders () faces down; a bottom end of the piston rod is connected to a connecting plate () with a through-hole in a center; a continuous lifting mechanism () is installed in a middle of the pressing-pulling bracket () , and a slotting rod () is vertically inserted into the continuous lifting mechanism (); a lifting ring () is installed at a top end of the slotting rod (); a bottom end of the slotting rod () extends down through the through-hole to connect to a slotting cutter (); a locking device () is fixed on the connecting plate () near the through-hole for fixing the slotting rod ().2248258. The pressing-pulling device claim 1 , as recited in claim 1 , wherein the locking device () is an annular locking iron ring and is made of two half rings a left half iron ring and a right half iron ring; both of the two half rings are installed in the ...

Service processing method and system, and policy control and charging rules function

A service processing method, a service processing system, and a PCRF entity are disclosed to overcome this defect in the prior art: The prior art is unable to handle services discriminatively according to the policy context information when different services require the same QoS level. The method includes: receiving bearer priority information from a PCRF entity, where the bearer priority information includes: bearer priority information of a service data stream, bearer priority information of an IP-CAN session, and/or bearer priority information of an IP-CAN bearer; and handling services according to the bearer priority information. In the embodiments of the present disclosure, the policy context information is converted into bearer priority information so that the PCEF handles services according to the bearer priority information. In this way, different services that require the same QoS level are handled discriminatively according to the policy context information.

Systems and methods to reduce the impact of short bits in phase change memory arrays

A memory device includes a memory array comprising a plurality of memory elements and a memory controller coupled to the memory array. The memory controller when in operation receives an indication of a defect in the memory array determines a first location of the defect when the defect is affecting only one memory element of the plurality of memory elements, determines a second location of the defect when the defect is affecting two or more memory elements of the plurality of memory elements, and performs a blown operation on a defective memory element at the second location when the defect is affecting two or more memory elements of the plurality of memory elements.

Node synchronization method and apparatus, device and storage medium

A node synchronization method and apparatus, an electronic device, and a computer-readable storage medium, include: acquiring node data sent by each slave node; obtaining a target cluster parameter from each piece of node data, and obtaining a standard cluster parameter by using the target cluster parameter based on an event queue length; determining an authorized slave node according to the standard cluster parameter, and judging whether a quantity of authorized slave nodes is greater than a quantity threshold; and if the quantity is greater than the quantity threshold, performing event playback on the authorized slave node by using a cluster event based on the standard cluster parameter; or if the quantity is not greater than the quantity threshold, controlling the authorized slave node to perform status synchronization on an unauthorized slave node, and performing event playback on the authorized slave node by using a cluster event after status synchronization.

Method for manufacturing superior 13Cr friction-welded drillrod

The present invention provides a method for manufacturing a superior 13Cr friction-welded drillrod, the method comprising the following steps: manufacturing a superior 13Cr tube body; manufacturing a superior 13Cr internally threaded coupler and a superior 13Cr externally threaded coupler, respectively; connecting the superior 13Cr internally threaded coupler and the superior 13Cr externally threaded coupler respectively to the two ends of the superior 13Cr tube body by means of frictional butt welding; after heating seam areas to 950° C.-1000° C., cooling same to below 200° C. by ejecting compressed air onto the surfaces of the seam areas, and then cooling the seam areas to room temperature by spraying water; and tempering the seam areas by heating same to 640° C.-700° C. By the present method, a superior 13Cr friction-welded drillrod can be manufactured, which, in the case of the exploration of a gas filed containing a relatively high level of CO2, can be not only used as a drillrod in ...

Generating three-dimensional models from images

The subject disclosure relates to generating models from images. In an aspect, multi-view semantic segmentation is provided to recognize and segment images at the pixel level into semantically meaningful areas, and which can provide labels with a specific object class. In further aspects, a partition scheme is provided that can separate objects into independent blocks using major line structures of a scene. In addition, an inverse patch-based orthographic composition and structure analysis on a block is provided that can regularize noisy and missing reconstructed 3D data to facilitate image-based modeling.

System and method allowing advertisers to manage search listings in a pay for placement search system using grouping

A system for advertisers to efficiently manage their search listings in placement database search system includes grouping means for managing multiple categories for the search listings and query means for searching search listings. The system further includes quick-fill means for modifying an attribute in plurality of search listings by specifying the modification at single location.

Method For Growing Multiple Layers of Source Drain Epitaxial Silicon in FDSOI Process

The application provides a method for growing multiple layers of source drain epitaxial silicon in an FDSOI process, forming a buried oxide layer on the substrate, and then forming an SOI layer on the buried oxide layer; forming a gate on the SOI layer, wherein a source drain region is provided on two sides of the gate; forming an undoped epitaxial layer on the SOI layer of the source drain region; forming a first doped epitaxial layer on the undoped epitaxial layer; forming a second doped epitaxial layer on the first doped epitaxial layer; and cleaning the substrate with deionized water. In the present application, the epitaxial silicon is changed from a single layer structure to a multilayer structure, wherein undoped epitaxial silicon can effectively prevent ion diffusion, and middle-highly doped epitaxial silicon and highly doped epitaxial silicon can significantly reduce source drain resistance and improve device performance.

Reagent for exploiting natural gas hydrates and application method thereof

The present invention relates to a reagent for exploiting natural gas hydrates, which includes a regent A and a regent B. The reagent A is PEG400-polyurethane prepolymer; the reagent B includes PEG400 and an initiator; and a volume ratio of the PEG400-polyurethane prepolymer, the PEG400 and the initiator is (1-3000):(1-1000):(1-2000). The reagent of the present invention has excellent performance and high stability, and can effectively “replace” the “water” of the natural gas hydrate; and moreover, the reaction is exothermic reaction to effectively increase the reaction rate, which reduces the energy loss on the one hand, and reduces the blockage of a gas passage caused by the secondary generation of the natural gas hydrates in a low-temperature high-pressure pipeline during transferring on the other hand.

Thin-slotting lifting synchronous grouting device and its usage method

A thin-slotting lifting synchronous grouting device and its usage method are provided. The device includes a hollow force-bearing column through which a feeding pipe passes; wherein: left and right cutting plates are respectively fixedly arranged on each side of the hollow force-bearing column; a left connecting plate is fixedly arranged on an outside of the left cutting plate; a right guiding column is fixedly arranged on an outside of the right cutting plate; center lines of the left connecting plate, the right guiding column and the hollow force-bearing column are in a same plane; a top end of to the feeding pipe is connected to a grouting device, and a bottom end is connected to a spraying device; a spraying nozzle of the spraying device stretches out along the hollow force-bearing column; and a lower end of the hollow force-bearing column is connected with a disposable conical head.

POLYOLEFIN COMPOSITE SEPARATOR, METHOD FOR MAKING THE SAME, AND LITHIUM ION BATTERY USING THE SAME

A method for making a polyolefin composite separator is disclosed. Methyl methacrylate and γ-(triethoxysilyl)propyl methacrylate are polymerized to form a copolymer. The copolymer is dissolved in a first solvent to form a copolymer solution. The copolymer solution is applied to a surface of a polyolefin porous film, and dried to form a gel polymer electrolyte precursor layer on the surface of the polyolefin porous film. The polyolefin porous film having the gel polymer electrolyte precursor layer applied thereon is fumigated in an atmosphere of hydrochloric acid gas. A polyolefin composite separator and a lithium ion battery are also disclosed. 2. The method of claim 1 , wherein the polymerizing comprises:mixing the methyl methacrylate and the γ-(triethoxysilyl)propyl methacrylate to form a mixture;adding an initiator to the mixture, stirring and heating the mixture having the initiator to a reaction temperature to polymerize the methyl methacrylate and the γ-(triethoxysilyl)propyl methacrylate to form a copolymer preform; andpurifying the copolymer preform.3. The method of claim 2 , wherein a molar ratio of the methyl methacrylate to the γ-(triethoxysilyl)propyl methacrylate is m:n.4. The method of claim 3 , wherein m:n=1.5. The method of claim 2 , wherein the reaction temperature is in a range from about 70° C. to about 90° C.6. The method of claim 2 , wherein the initiator is an azo initiator.7. The method of claim 2 , wherein the purifying comprises:dissolving the copolymer preform in a second solvent to form a copolymer preform solution; andproviding a mixed solvent of ethanol and water, and adding the copolymer preform solution to the mixed solvent to precipitate the copolymer.8. The method of claim 7 , wherein claim 7 , a volume ratio of the ethanol to the water is in a range from 1:2 to 2:1.9. The method of claim 1 , wherein a concentration of the copolymer in the copolymer solution is in a range from about 5% to about 15%.10. The method of claim 1 , wherein ...

Method, apparatus and system for transmitting user equipment information in a multimedia subsystem

The present disclosure discloses a method, apparatus and system for transmitting UE information in a multimedia subsystem. The method includes: a call session control function entity obtains capability information of UE, and transmits the capability information of the UE to an AS; the AS obtaining the capability information of the UE sent from the call session control function entity. The solution of the present disclosure ensures that the AS in the IMS can obtain the capability information of the UE. Therefore, services based on the capability information of the UE can be implemented on the AS successfully.

Rapid-hardening underground pipeline grouting repair polymer and preparing method

The present invention provides a rapid-hardening underground pipeline grouting repair polymer and a preparing method thereof for underground pipes. The rapid-hardening underground pipeline grouting repair polymer comprises the base resin and the hardener, weight ratio of which is 2:1-1:1. The base resin comprises 50 to 160 parts by weight of an isocyanate; 20 to 100 parts of a chlorophosphate mixture with a density over 1400 kg/m3; a parts by weight ratio of the isocyanate and chlorophosphate is 1:1-4:1. The hardener comprises 30 to 60 parts by weight of a chlorophosphate mixture with a density over 1400 kg/m3, 5 to 15 parts of a propyl formate, a methyl propionate or a mixture of a propyl formate and a methyl propionate, 15 to 55 parts of a polyol, 1 to 3 parts of a surfactant, 2 to 6 parts of a catalyst, 0 to 0.5 parts of water and 0 to 1 parts of a colorant.

Bluetooth pairing method and terminal device

A Bluetooth pairing method includes: performing, by a terminal device, encryption computation on a first Bluetooth parameter to generate first pairing information; sending, by the terminal device, the first pairing information to a peer device; and when the terminal device determines that the first Bluetooth parameter is the same as a second Bluetooth parameter, and the peer device determines that the first Bluetooth parameter is the same as the second Bluetooth parameter, determining, by the terminal device, that Bluetooth pairing between the terminal device and the peer device is successful.

METHOD FOR MANUFACTURING SUPERIOR 13CR TOOL COUPLER

The present invention discloses a method for manufacturing a superior 13Cr tool coupler, which method comprises the following steps: manufacturing a blank; 2. The method of claim 1 , wherein the 13Cr tool coupler consists essentially of 0.01-0.05 wt % carbon claim 1 , ≦0.5 wt % silicon claim 1 , 0.2-1.0 wt % manganese claim 1 , 12-14 wt % chromium claim 1 , 1-3 wt % molybdenum claim 1 , 4-6 wt % nickel claim 1 , and a balance of iron (Fe) and other impurities.3. The method of claim 1 , wherein the manufactured blank is forged at a temperature ranging from 1150-1200° C.4. The method of claim 1 , wherein the annealed blank is quenched at a temperature ranging from 950-1000° C.5. The method of claim 1 , wherein the annealed blank is quenched with oil.6. The method of claim 1 , wherein the quenched blank is tempered at a temperature ranging from 600-650° C.7. The method of claim 1 , further comprising rough machining the annealed blank before quenching the annealed blank. The present invention relates to a method for manufacturing a coupler, and in particular a method for manufacturing a high alloy coupler.Drillrods for use in oil and natural gas exploration are manufactured according to the API SPEC 5DP standards. The structure thereof has an externally threaded drillrod coupler and an internally threaded drillrod coupler which are respectively frictionally butt-welded at the two ends of the drillrod tube body. Drillrods in compliance with the API SPEC 5DP standards are of a low alloy steel material.With the development of the oil industry, the conditions in which drillrods operate become more and more severe, drillrods of the low alloy steel material as per the API SPEC 5DP standards now fail to fulfill the increasingly harsh requirements of well drilling operation, and there exists an urgent need for a high alloy drillrod. To this end, aluminum alloy drillrods and titanium alloy drillrods appeared on the market. The aluminum alloy drillrods are manufactured as per ...

System and method allowing advertisers to manage search listings in a pay for placement search system using grouping

A system for advertisers to efficiently manage their search listings in placement database search system includes grouping means for managing multiple categories for the search listings and query means for searching search listings. The system further includes quick-fill means for modifying an attribute in a plurality of search listings by specifying the modification at a single location.

Method For Regulating The Output Power Of A Radio Access Point

A radio communication system has a first and a second radio access point and a plurality of radio stations. The first radio access point broadcasts signals having an increasing output power. The first radio access point stops increasing the output power based on a message by at least one radio station located within the radio coverage range of the second radio access point. The message of the at least one radio station located within the radio coverage range of the second radio access point relates to at least one signal of the first radio access point and/or at least one signal of a radio station located within the radio coverage range of the first radio access point.

Trenchless methods for forming curved hole channel with steel sleeve and pipeline lifting

Trenchless methods for forming a curved hole channel with a steel sleeve and pipeline lifting are provided, including steps of: (T1) drilling a straight hole channel, and inserting the steel sleeve into the straight hole channel; (T2) inserting a guiding pipe into the steel sleeve, and determining a bending direction of a hole channel to be formed; and (T3) inserting a flexible steel-wire pipe into the guiding pipe, and punching to form the curved hole channel. With applying the creative trenchless method for forming the curved hole channel, a specially-made grouting pipe is accurately inserted to a bottom of a subsiding pipeline section, so that a polymer material is conveniently injected to a bottom of a disease position. Though utilizing an expansion force generated by the polymer material, the subsiding pipeline section is uplifted, so as to realize trenchless repairing.

LATCH MECHANISM

A latch mechanism includes a latching member, a button, and an elastic member for restoring the latching member. The latching member is rotatably installed in a cover unit. The latching member includes a latching portion for engaging with a base unit. The button is movably fixed to the cover unit. The button includes a slanted pushing portion for driving the latching member to rotate for disengaging the latching portion from the base unit.

Workflow modeling using an acyclic directed graph data structure

A process for modeling at least a portion of a workflow includes accessing a computer data structure to represent an acyclic directed graph (10) including multiple nodes (12) and one or more edges (14), each edge (14) linking two adjacent nodes (12). The value of a function at a selected node (12) is requested, the value of the function at the selected node (12) depending on values of the function at one or more adjacent nodes (12) lying in a first direction from the selected node (12). If a cached value of the function at the selected node (12) is not assured to be valid, then the value of the function at the selected node (12) is recomputed based on the values of the function at the one or more adjacent nodes (12) and then returned. If the cached value is assured to be valid, then the cached value is returned without recomputing the value of the function at the selected node (12).

METHODS AND SYSTEMS TO PROVIDE INTERACTIVE MARKETPLACE WITH TIME-LIMITED NEGOTIATION

Systems and methods to provide a live video-based marketplace negotiation platform in the context of time limited online trading and commerce is described. Embodiments may include an interactive market place where transactions may be negotiated between buyers and sellers in a secure and entertaining manner. In an example, an online trading platform may match potential sellers and buyers based on any of a variety of criteria, and allow sellers and buyers to negotiate a deal in a limited time frame. Negotiations may be performed in real-time over a text, voice, or video communication interface that may include descriptions, images, or videos of a product offered by a seller.

Method and apparatus for global bandwidth management

A satellite communication system includes a global bandwidth enforcer that allocates bandwidth from the global bandwidth pool in accordance with a group service plan having a predetermined geographic scope. The system further includes an allocation of bandwidth from the one or more channels of the one or more beams of a first satellite in accordance with the group service plan. The system further includes a second satellite access station that receives an allocation of bandwidth from the one or more channels of the one or more beams of the second satellite in accordance with the group service plan. The system further includes a first sub-network associated with the first satellite access having a coverage area in the predetermined geographic scope of the group service plan, where the first sub-network receives an allocation of bandwidth from the first satellite access station in accordance with the group service plan.

IMMUNE TOLERANT AND NON-IMMUNE TOLERANT ELASTIN-LIKE RECOMBINANT PEPTIDES AND METHODS OF USE

Disclosed herein, are recombinant polypeptides comprising one or more homologous amino acid repeats; and, non-immunogenic bioconjugates comprising recombinant polypeptides comprising one or more homologous amino acid repeats and one or more therapeutic agents. Also, disclosed herein are pharmaceutical compositions including the recombinant polypeptides; and methods of administering the recombinant polypeptides to patients for the treatment of cancer or infections.

PYRAZOLOPYRIMIDINE COMPOUNDS AND USES THEREOF

Disclosed are compounds of Formula (I), methods of using the compounds for inhibiting ALK2 activity and/or FGFR activity, and pharmaceutical compositions comprising such compounds. The compounds are useful in treating, preventing or ameliorating diseases or disorders associated with ALK2 activity and/or FGFR activity, such as cancer.

Use of extensible markup language in a system and method for influencing a position on a search result list generated by a computer network search engine

A database search apparatus and method for generating a search result list which responds to Extensible Markup Language (XML) requests from a client to a server of an on-line marketplace. A bid management tool is operable on a client computer to manage search listings and account information of one or more advertisers. The client application communicates with the server via an XML-based application program interface. The bid management tool provides functions for reporting account activity, modifying accounts and manual, timed or event-driven changes to search listings including listings of several advertisers.

Grouting double-locking pressure real-time sensing system and method for operating the same

A grouting double-locking pressure real-time sensing system includes: a positioning structure fixed to a ground; wherein an expandable positioning structure passes through the positioning structure, and an input end of the expandable positioning structure is connected to the grouting structure; the pressure real-time monitoring component is connected to the expandable positioning structure; the expandable positioning structure comprises a hollow conduit, an expandable assembly, an upper positioning member, and a lower positioning member; wherein the upper positioning member and the lower positioning member are respectively connected to two ends of the expandable assembly; the hollow conduit passes through the upper positioning member and the lower positioning member, and is threaded to the the lower positioning member; the upper positioning member is fixed to the positioning structure; when rotating the hollow conduit, the lower positioning member moves up and down, so as to expand or contract ...

Method for testing glycidol in air and waste gas

The invention relates to a method for testing glycidol in air and waste gas. According to the method, the glycidol in the air and the waste gas is tested through solvent desorption-gas phase chromatography; a low-toxicity strong-base alcoholic solution is used as desorption solvents for sample processing, and green and environment-friendly effects are achieved; an analysis method is simple, convenient and fast; the quantitation result is accurate; the recovery rate is high; the detection limit reaches 0.04mg/m<3>. The method fills the technical blank of the glycidol in the air and the waste gas, and the basis can be provided for the profession health and environment protection.

Method, system, and entity for exercising policy control

A method and a system for exercising policy control, a policy and charging enforcement function (PCEF), and a policy control and charging rules function (PCRF) are provided, which can solve the problem that no policy control can be exercised over application service flows without an application function (AF). The method includes of the following steps: a PCRF receiving information about an application event sent by a PCEF; and the PCRF generating a control policy for a service flow of the application according to the information about the application event, and delivering the control policy to the PCEF. In the present invention, the PCEF sends the obtained information about the application event to the PCRF, so that even when no AF is involved, the PCRF can still generate a control policy according to policy contexts including the information about the application event and the like, so as to exercise an effective policy control over the QoS guarantee, charging and gating of the service ...

Display device

A display device includes a frame defining an opening, a shell, and a display panel installed between the frame and the shell. The display panel is viewable via the opening of the frame. A latch is formed on the frame. A fixing portion is formed on the shell and slidably engaged with the latch of the frame for slidably fixing the shell to the frame. A plurality of fasteners extends through the frame to engage with the shell to thereby fasten the frame and the shell together.

Track-type jet grouting integrated system

A track-type shotcrete integrated system includes: a proportioner working bin, a storage bin, a power bin, and load-bearing legs, wherein bottom sections of the load-bearing legs are equipped with a track chassis for moving, and the track chassis is electrically connected to a track controller; the storage bin contains a storage tank I and a storage tank II for storing different raw materials; a feed pump I is installed on a top of the storage tank I, and a feed pump II is installed on a top of the storage tank II; inlet pipes of the feed pump I and the feed pump II insert into the storage tank I and storage tank II respectively, and outlet pipes of the feed pump I and the feed pump II are connected to a feed pipe I and a feed pipe II respectively.

Trenchless methods for forming curved hole channel with steel sleeve and pipeline lifting

Trenchless methods for forming a curved hole channel with a steel sleeve and pipeline lifting are provided, including steps of: (T1) drilling a straight hole channel, and inserting the steel sleeve into the straight hole channel; (T2) inserting a guiding pipe into the steel sleeve, and determining a bending direction of a hole channel to be formed; and (T3) inserting a flexible steel-wire pipe into the guiding pipe, and punching to form the curved hole channel. With applying the creative trenchless method for forming the curved hole channel, a specially-made grouting pipe is accurately inserted to a bottom of a subsiding pipeline section, so that a polymer material is conveniently injected to a bottom of a disease position. Though utilizing an expansion force generated by the polymer material, the subsiding pipeline section is uplifted, so as to realize trenchless repairing.

METHODS OF MANUFACTURING A GLASS RIBBON

A method of manufacturing a glass ribbon can comprise flowing a glass-forming ribbon along a travel path. The glass-forming ribbon can comprise a first major surface and a second major surface opposite the first major surface. A thickness can be defined between the first major surface and the second major surface. The method can comprise heating the first major surface of the glass-forming ribbon at a target location of the travel path while the glass-forming ribbon is travelling along the travel path. The heating can increase a temperature of the glass-forming ribbon at the target location to a heating depth of about 250 micrometers or less from the first major surface. The method can comprise cooling the glass-forming ribbon into the glass ribbon. Prior to the heating, the glass-forming ribbon at the target location can comprise an average viscosity in a range from about 1,000 Pascal-seconds to about 1011 Pascal-seconds.

Systems and Methods for Customizing Optimization/Transformation/ Processing Strategies

A method for tailored compiler optimization is provided. The method includes extracting kernels from an application program, performance tuning the kernels to determine a tailored optimization strategy for each of the kernels, the tailored optimization strategy different than a default optimization strategy of a compiler for each of the kernels, and annotating the application program, using a computer, to identify the tailored optimization strategy determined for each of the kernels. In an embodiment, the method also includes the design and implementation for adjusting a compiler to customize optimization strategies for different kernels. 1. A method for tailored compiler optimization , comprising:extracting kernels from an application program;performance tuning the kernels to determine a tailored optimization strategy for each of the kernels, the tailored optimization strategy different than a default optimization strategy of a compiler for each of the kernels; andannotating the application program, using a computer, to identify the tailored optimization strategy determined for each of the kernels.2. The method of claim 1 , further comprising determining claim 1 , prior to extracting the kernels claim 1 , which of the kernels to extract from the application program based on a performance criteria.3. The method of claim 1 , wherein the tailored optimization strategy for each of the kernels is based on a performance criteria.4. The method of claim 1 , further comprising saving the kernels to a memory after the kernels are extracted from the application program.5. The method of claim 1 , wherein at least one of the kernels extracted from the application program is at least one of a control construct claim 1 , a straight-line code snippet claim 1 , and a function in the application program.6. The method of claim 1 , wherein the application program is annotated by embedding a compiler hint corresponding to each of the kernels into the application program.7. The method ...

ILLUSTRATION TO CONDUCT AN EXPEDITED ELECTRONIC TRANSACTION

A method to display an illustration to conduct an expedited electronic transaction is provided. Consumer identification information identifying a consumer is received. The consumer identification information is stored in association with a web browser of a consumer's device. A customized illustration is displayed based on the received consumer identification information on the consumer's device. A request is received for the expedited electronic transaction by swiping the customized illustration across a portion of the display of the consumer's device. Transaction data sufficient to complete the electronic transaction is sent to the merchant based on the swipe of the customized illustration across display of the consumer's device. 1. A processor executed method of displaying an illustration to conduct an expedited electronic transaction , the method comprising:receiving consumer identification information identifying a consumer at a processor, wherein the consumer identification information is stored in association with a web browser of a device of a consumer;displaying, via the processor, a customized illustration based on the received consumer identification information on a display of the device of the consumer;receiving, via the processor, a request for an expedited electronic transaction by activating the customized illustration on a portion of the display of the device of the consumer;illustrating, by the processor, the customized illustration in a movement from a first position on the display to a second position on the display; the movement defining an entry portion between the first position and the second position;displaying, via the processor, an indicator for the entry of a password in the entry portion; andreceiving, via the processor, password information from the consumer in the entry portion of the display adjacent to the customized illustration.2. The method of claim 1 , wherein the consumer identification information is stored as a cookie of the ...

Keyboard application with third party engagement selectable items

Embodiments of the invention are directed to an embodiment of a keyboard application in which a plurality of selectable items (representing keys) are associated with transactions. The keyboard application may be imported into any application that utilizes text input, and replaces a default keyboard used to provide the text input. Upon selection of one of the plurality of selectable items, a transaction is initiated by a service provider computer. In some embodiments, the transaction may result in the engagement of a third party entity. Once completed, an access credential associated with the completion of the transaction is generated. The access credential may be entered into the text input field of the application that utilizes text input.

Code generation for complex arithmetic reduction for architectures lacking cross data-path support

A computer implemented method, apparatus, and computer usable program code for compiling source code for performing a complex operation followed by a complex reduction operation. A method is determined for generating executable code for performing the complex operation and the complex reduction operation. Executable code is generated for computing sub-products, reducing the sub-products to intermediate results, and summing the intermediate results to generate a final result in response to a determination that a reduced single instruction multiple data method is appropriate.

ADAMTS INHIBITORS, PREPARATION METHODS AND MEDICINAL USES THEREOF

Compounds of formula (I) useful as inhibitors of ADAMTS-5 and/or ADAMTS-4, pharmaceutical compositions thereof, and use of them as therapeutic agents for the treatment of diseases involving degradation of cartilage or disruption of cartilage homeostasis, in particular osteoarthritis and/or rheumatoid arthritis, are disclosed.

USE OF EXTENSIBLE MARKUP LANGUAGE IN A SYSTEM AND METHOD FOR INFLUENCING A POSITION ON A SEARCH RESULT LIST GENERATED BY A COMPUTER NETWORK SEARCH ENGINE

A database search apparatus and method for generating a search result list which responds to Extensible Markup Language (XML) requests from a client to a server of an on-line marketplace. A bid management tool is operable on a client computer to manage search listings and account information of one or more advertisers. The client application communicates with the server via an XML-based application program interface. The bid management tool provides functions for reporting account activity, modifying accounts and manual, timed or event-driven changes to search listings including listings of several advertisers.

GENERATING THREE-DIMENSIONAL MODELS FROM IMAGES

The subject disclosure relates to generating models from images. In an aspect, multi-view semantic segmentation is provided to recognize and segment images at the pixel level into semantically meaningful areas, and which can provide labels with a specific object class. In further aspects, a partition scheme is provided that can separate objects into independent blocks using major line structures of a scene. In addition, an inverse patch-based orthographic composition and structure analysis on a block is provided that can regularize noisy and missing reconstructed 3D data to facilitate image-based modeling. 1. A method that facilitates image-based modeling , comprising:receiving input image data representing a façade;reconstructing input image data with a computing device to compute three-dimensional (3D) points, lines, and camera positions associated with the façade; andperforming a multi-view semantic segmentation on reconstructed input image data to recognize façade structure and segment the façade.2. The method of claim 1 , further comprising:receiving a segmentation instruction to interactively refine the multi-view semantic segmentation.3. The method of claim 1 , further comprising:block partitioning reconstructed input image data to produce at least one individual building block associated with the segmented façade.4. The method of claim 3 , further comprising:performing an inverse orthographic composition on reconstructed input image data associated with the at least one individual building block to produce composed orthographic depth map and texture for the at least one individual building block.5. The method of claim 4 , further comprising:receiving an inpainting instruction to interactively edit at least one of the composed orthographic depth map or texture.6. The method of claim 4 , further comprising:performing structural analysis and regularization of the composed orthographic depth map and texture to identify structural elements at different façade ...

PLANT SENSOR

A plant sensor includes a first light emitter to emit first measuring light with a first wavelength to irradiate a growing condition measurement target therewith; a second light emitter to emit second measuring light with a second wavelength to irradiate the growing condition measurement target therewith; a light receiver to receive reflected light of each of the first and second measuring light from the growing condition measurement target and output a received light signal; a controller to control light emission; a light path merging unit to merge a first outgoing light path of the first measuring light from the first light emitter and a second outgoing light path of the second measuring light from the second light emitter; and a common outgoing light path connecting the light path merging unit to a light exit portion emitting the first measuring light and the second measuring light. 1. A plant sensor comprising:a first light emitter configured to emit first measuring light with a first wavelength to irradiate a growing condition measurement target with the first measuring light;a second light emitter configured to emit second measuring light with a second wavelength to irradiate the growing condition measurement target with the second measuring light;a light receiver configured to receive reflected light of each of the first and second measuring light from the growing condition measurement target and output a received light signal;a controller configured to control light emission such that the first light emitter emits the first measuring light and the second light emitter emits the second measuring light at timings different from each other;a light path merging unit configured to merge a first outgoing light path of the first measuring light from the first light emitter and a second outgoing light path of the second measuring light from the second light emitter; anda common outgoing light path connecting the light path merging unit to a light exit portion from ...

ARCHITECTURAL PATTERN DETECTION AND MODELING IN IMAGES

Systems and methods are provided to facilitate architectural modeling. In one aspect, repetitive patterns are automatically detected and analyzed to generate modeled structural images such as building facades. In another aspect, structural symmetry is analyzed to facilitate architectural modeling and enhanced image generation. 1. A method , comprising:extracting initial sample portions from images as potential repetitive patterns;retaining selected patterns from the potential repetitive patterns that are determined to be actual repetitive patterns;clustering the actual repetitive patterns from sub-group domains into aggregated group domains by using information from a transformation domain and a spatial domain; andextracting one or more shapes for the actual repetitive patterns based in part on the information from the transformation domain and the spatial domain.2. The method of claim 1 , further comprising determining a similarity map between a width portion centered on a corner point and at least one pixel to facilitate determining repetitive image patterns.3. The method of claim 2 , further comprising determining stationary points from the similarity map and modes of a density map to facilitate determining repetitive image patterns claim 2 , where the stationary points are potential similar points related to a sampling point.4. The method of claim 1 , further comprising determining a bounding box and constructing a grid in image space to facilitate determining repetitive image patterns.5. The method of claim 1 , further comprising classifying lattices into multiple groups having associated sub-groups claim 1 , wherein regions of each sub-group are segmented to estimate a shape of a foreground object.6. The method of claim 5 , wherein the classifying includes classifying the lattices according to a hierarchical cluster claim 5 , and further comprising translating between spatial domains before determining distances between lattices or determining an inter-cluster ...

Control method, system and function entity for reporting bearer event of signaling ip flow

A control method, system and function entity for reporting a bearer event of a signaling IP flow are provided. Flow identifier information may be generated for a signaling IP flow and a media IP flow, to unify a mechanism for reporting a signaling path status and a mechanism for reporting a bearer event of a media IP flow. In the method, the mechanism for reporting a signaling path status is not limited by the parameter of Flow Usage.

METHOD FOR PRODUCING THIN LAYERS

The invention relates to a method for providing organic, semi-organic, mineral, inorganic and hybrid thin layers and thin layers containing nanoparticles, by simultaneous or alternate spraying of solutions of reactive partners (that is polymer/polymer interacting by hydrogen bonding, polyelectrolyte/small oligo-ion, inorganic compounds, etc.) on the surface of a solid substrate. 1. Method for the continuous deposition on a substrate of a thin homogeneous layer of a product obtained from at least two reactive partners , characterised in that it involves the simultaneous or alternate continuous spraying , on said substrate , using separate sprayers , of at least two liquids each containing one of the reactive partners or a mixture thereof , such that they interact together mainly at the level of a liquid film of controlled thickness comprised between 0.1 μm and 100 μm that forms on contact with the free surface of the substrate , and in that the thickness of said thin homogeneous layer of product , formed from said liquid film , is mainly controlled by the duration of said continuous spraying , to the exclusion nevertheless of the case where two reactive partners of polymer nature , each of identical chemical nature , interact by electrostatic interactions and are deposited by simultaneous spraying , and to the exclusion also of the case where all of the reactive partners are deposited by alternate spraying , except for the case where at least the two partners are of inorganic nature.2. Method according to claim 1 , characterised in that one at least of the reactive partners is of complementary inorganic nature.3. Method according to claim 1 , characterised in that said reactive partners lead to the product to be deposited by chemical reaction.4. Method according to claim 1 , characterised in that said reactive partners lead to the product to be deposited by physical or physical-chemical interaction.5. Method according to claim 1 , characterised in that the reactive ...

ANTI-SHOCK METHOD FOR HEAD STACK ASSEMBLY

The present invention directs an anti-shock method for head stack assembly which carries a slider for flying on a disk for operation, and the anti-shock method includes: inputting a constant current to a head disk interface sensor which is deposited in the slider; obtaining a changing voltage of the head disk interface sensor, which is changed with the temperature of the head disk interface sensor as the slider is shocked; outputting the changing voltage to a controller with a threshold set therein; if the changing voltage is bigger than the threshold for a specified number of times, the controller is triggered to control the head stack assembly to stop operating and load on a ramp beside the disk; while if the changing voltage is small than the threshold for said specified number of times, the controller is not be triggered and the head stack assembly still operates. 1. An anti-shock method for head stack assembly , with the head stack assembly carrying a slider for flying on a disk for operation , comprising:inputting a constant current to a head disk interface sensor which is deposited in the slider;obtaining a changing voltage of the head disk interface sensor, which is changed with the temperature of the head disk interface sensor as the slider is shocked;outputting the changing voltage to a controller with a threshold set therein;if the changing voltage is bigger than the threshold for a specified number of times, the controller is triggered to control the head stack assembly to stop operating and load on a ramp beside the disk; while if the changing voltage is small than the threshold for said specified number of times, the controller is not be triggered and the head stack assembly still operates.2. The anti-shock method for head stack assembly according to claim 1 , wherein after the step of obtaining a changing voltage of the head disk interface sensor claim 1 , which is changed with the temperature of the head disk interface sensor as the slider is shocked ...

ELECTROMOTIVE FORCE GENERATOR AND ELECTRIC POWER GENERATING MODULE USING THE SAME

An electric power generating module includes an electromotive force (EMF) generator and a circuit unit. The EMF generator has a shell having two opposite plates, a coil unit mounted to one of the plates, first and second stationary magnets disposed in the shell with different magnetic pole, and a moveable magnet having a magnetic pole opposite to that of the first stationary magnet. The moveable magnet is moveable between a first position adjacent to a first side of the second stationary magnet and a second position adjacent to a second side of the second stationary magnet along a circumference of the first stationary magnet across a space defined between the coil unit and the other one of the plates. The circuit unit is electrically connected with the coil unit. When the EMF generator is shaken, electric power is produced by the electric power generating module. 1. An electromotive force generator comprising:a shell having two plates oppositely and spacedly arranged with each other, and a receiving space between the two plates;at least one coil unit mounted to one of the plates of the shell;a first stationary magnet fixedly disposed in the receiving space;a second stationary magnet fixedly disposed in the receiving space and provided with a first side, a second side opposite to the first side, and a magnetic pole opposite to that of the first stationary magnet; anda moveable magnet provided with a magnetic pole opposite to that of the first stationary magnet and located in the receiving space, the moveable magnet being moveable between a first position adjacent to the first side of the second stationary magnet and a second position adjacent to the second side of the second stationary magnet along a circumference of the first stationary magnet across a space defined between the at least one coil unit and the other one of the plates.2. The electromotive force generator of claim 1 , wherein the moveable magnet has a thickness smaller than that of the first stationary ...

Photovoltaic Connector

Embodiments of the present invention provide a photovoltaic (PV) connector, comprising a first connecting unit and a second connecting unit detachably connected with the first connecting unit, wherein the first connecting unit includes a first conductor, a first stop ring, a first housing and a first conductor core provided inside and detachably connected to the first housing; the first conductor is electrically connected with a pressing end of the first conductor core; the first stop ring is detachably connected with the first housing; the second connecting unit includes a second conductor, a second housing, a second stop ring and a second conductor core provided inside and detachably connected to the second housing; the second conductor is electrically connected with a pressing end of the second conductor core; the second stop ring is detachably connected with the second housing.

SERVICE PROCESSING METHOD AND SYSTEM, AND POLICY CONTROL AND CHARGING RULES FUNCTION

A service processing method, a service processing system, and a PCRF entity are disclosed to overcome this defect in the prior art: The prior art is unable to handle services discriminatively according to the policy context information when different services require the same QoS level. The method includes: receiving bearer priority information from a PCRF entity, where the bearer priority information includes: bearer priority information of a service data stream, bearer priority information of an IP-CAN session, and/or bearer priority information of an IP-CAN bearer; and handling services according to the bearer priority information. In the embodiments of the present disclosure, the policy context information is converted into bearer priority information so that the PCEF handles services according to the bearer priority information. In this way, different services that require the same QoS level are handled discriminatively according to the policy context information. 1. A service processing method , comprising:obtaining by a Policy Control and Charging Rules Function (PCRF) entity, policy context information of a service data stream, wherein the policy context information of the service data stream comprises at least one of: service type, service priority, user priority, and custom-defined priority;generating by the PCRF entity, bearer priority information on the service data stream according to the policy context information, wherein the bearer priority information designates a priority level of the service data stream within a bearer layer at a QoS level; andsending by the PCRF entity, the bearer priority information to a Policy and Charging Enforcement Function (PCEF) entity for discriminative handling the service data stream within the bearer layer along with other service data streams which are at the same QoS level; wherein the bearer priority information is set in a bearer priority information element; wherein the bearer priority information element is set ...

ISLANDING DETECTION METHOD AND SYSTEM

The present invention provides an islanding detection method and an islanding detection system. The method includes: acquiring a voltage signal at a grid-connected node of a power generation system, and extracting phase information of the voltage signal; constructing a slip-mode frequency shift islanding detection curve in the form of a quadratic function according to the phase information; and generating a disturbance signal according to the slip-mode frequency shift islanding detection curve, and sending the disturbance signal to an inverter of the power generation system. The method and system can avoid a non-detection zone, and can perform an inverter islanding detection in a fast and accurate manner under simple control. 1. An islanding detection method , comprising:acquiring a voltage signal at a grid-connected node of a power generation system, and extracting phase information of the voltage signal;constructing a slip-mode frequency shift (SMS) islanding detection curve in the form of a quadratic function based on the phase information; andgenerating a disturbance signal based on the SMS islanding detection curve, and sending the disturbance signal to an inverter of the power generation system.2. The method of claim 1 , wherein the SMS islanding detection curve constructed in the form of the quadratic function is as follows:{'br': None, 'i': f', 'a|Δf|+b', 'M≦θ≦M, 'θ=Δ(),−'}{'sub': g', 'g, 'wherein θ is the phase of the disturbance signal, Δf=f−f, fis a rated frequency of a power grid, f is the frequency of a currently acquired voltage signal, M is the preset maximum amplitude of the disturbance signal, a and b are preset parameters.'}3. The method of claim 2 , wherein a generated disturbance signal is as follows:{'br': None, 'i': t', 't+θ, '(ω)′=ω'}wherein ωt is the extracted phase information, (ωt)′ is the generated disturbance signal, θ is the phase of the disturbance signal.4. The method of claim 2 , wherein f=50 Hz.5. The method of claim 1 , further ...

METHODS AND SYSTEMS FOR EXTRACTING BLOOD VESSEL

A method for extracting a blood vessel may include acquiring an image relating to a blood vessel, the image including multiple slices; determining a region of interest in the image; establishing a blood vessel model; and extracting the blood vessel from the region of interest based on the blood vessel model. 1. A method for extracting a blood vessel implemented on at least one machine each of which has at least one processor and storage , the method comprising:acquiring an image relating to a blood vessel, the image including multiple slices;determining a region of interest in the image;establishing a blood vessel model; andextracting the blood vessel from the region of interest based on the blood vessel model.2. The method of claim 1 , wherein the determining a region of interest in the image comprises:identifying slice information relating to the multiple slices of the image;determining a slice range of the multiple slices corresponding to a sub-image based on the slice information;determining the sub-image in the slice range;acquiring a template based on the sub-image;registering the sub-image based on the template to determine a registered result;identifying the region of interest based on the registered result.3. The method of claim 1 , wherein the determining a region of interest in the image comprises performing machine learning.4. The method of claim 1 , further comprising determining a seed point of the blood vessel including:performing an enhancement operation on the image to obtain an enhanced image;determining gradients of grey values relating to the image to obtain a gradient image;constructing a feature function of the blood vessel based on the enhanced image and the gradient image; anddetermining the seed point of the blood vessel based on the feature function of the blood vessel.5. The method of claim 1 , further comprising determining a centerline of the blood vessel.6. The method of claim 5 , wherein the determining a centerline of the blood vessel ...

Pipeline radar and television inspection robot

The present application discloses a pipeline radar and television inspection robot which includes a robot body, a directional drilling lifting device, a directional drilling rotary device, a directional drilling swing device, a radar, cameras and a driving apparatus; wherein the directional drilling lifting device is on a front part of the robot body; the directional drilling rotary device is on the directional drilling lifting device; the directional drilling swing device is on the directional drilling rotary device; the radar and the cameras are on the directional drilling swing device; the driving apparatus are on a bottom of the robot body. The directional drilling lifting device, the radar and the cameras are plugged in the robot body. The robot body electrically connects to cables which electrically connect to a control system. The cameras and the radar are able to be adjusted and the components are connected as modules. 1. A pipeline radar and television inspection robot , comprising: a robot body , a directional drilling lifting device , a directional drilling rotary device , a directional drilling swing device , a radar , cameras and a driving apparatus; wherein the directional drilling lifting device is on a front part of the robot body; the directional drilling rotary device is on the directional drilling lifting device; the directional drilling swing device is on the directional drilling rotary device; the radar and the cameras are on the directional drilling swing device; the driving apparatus are on a bottom of the robot body;wherein the directional drilling lifting device is plugged in the robot body by a first quick disconnect waterproof aviation female plug and male panel socket;wherein the radar and the cameras are plugged in the robot body by a second quick disconnect waterproof aviation female plug and male panel socket; the robot body electrically connects to cables which electrically connect to a control system.2. The pipeline radar and ...

Wireless Communication Connection Method and Terminal

A wireless communication coupling method and a terminal, where the method includes selecting, by a first terminal, a wireless coupling mode in a target application, determining a target identifier in an identifier list of the target application, sending, using a wireless network, a wireless coupling request for the wireless coupling mode to a second terminal corresponding to the target identifier, and establishing a wireless communication coupling in the wireless coupling mode to the second terminal when receiving an acknowledgement response to the wireless coupling request. 112.-. (canceled)13. A wireless communication coupling method , implemented by a first terminal , comprising:selecting a wireless coupling mode in a target application;determining a target identifier in an identifier list of the target application;sending, using a wireless network, a wireless coupling request for the wireless coupling mode to a second terminal, wherein the second terminal corresponds to the target identifier;receiving a coupling acknowledgement response to the wireless coupling request; andestablishing a wireless communication coupling in the wireless coupling mode to the second terminal.14. The wireless communication coupling method of claim 13 , wherein the coupling acknowledgement response comprises a random number generated by the second terminal in the wireless coupling mode claim 13 , and wherein establishing the wireless communication coupling comprises:performing local coupling interaction for the wireless coupling mode with the second terminal using the random number to obtain an encryption key of the second terminal in the wireless coupling mode; andestablishing the wireless communication coupling in the wireless coupling mode to the second terminal based on the encryption key.15. The wireless communication coupling method of claim 13 , wherein the coupling acknowledgement response comprises an encryption key of the second terminal in the wireless coupling mode claim ...

METHOD OF MEASURING STATE OF CONCRETE

To provide a method of measuring a state of concrete capable of easily determining or measuring deterioration of the concrete without using a spectroscopy while maintaining the estimation accuracy. The method of the present disclosure emits an irradiation light to the concrete, the irradiation light including a wavelength range of near infrared light related to concrete measurement; and receives a reflection light of the irradiation light P reflected on the concrete. The method determines at least five wavelengths λ to λ to λ, different from each other by PLS regression analysis within a wavelength range of 900 nm to 2500 nm of absorption spectrum, and estimates a degree of neutralization of the concrete caused by calcium hydroxide and a concentration of chloride ion. 1. A method of measuring a state of concrete , comprising:emitting an irradiation light to concrete, the irradiation light including a wavelength range of near infrared light;receiving a reflection light of the irradiation light reflected on the concrete;determining at least five wavelengths different from each other by PLS regression analysis within a wavelength range of 900 nm to 2500 nm of absorption spectrum; andestimating a degree of neutralization of the concrete caused by calcium hydroxide and a concentration of chloride ion.2. The method according to claim 1 , wherein the degree of neutralization caused by the calcium hydroxide is estimated in accordance with two wavelengths within the wavelength range of 900 nm to 2500 nm of the absorption spectrum and three wavelengths within the wavelength range of 1700 nm to 2500 nm claim 1 , andthe concentration of the chloride ion is estimated in accordance with one wavelength within the wavelength range of 900 nm to 1700 nm of the absorption spectrum and four wavelengths within the wavelength range of 1700 nm to 2500 nm.3. The method according to claim 1 , wherein the degree of neutralization caused by the calcium hydroxide is estimated in accordance ...

DISPLAY METHOD AND ELECTRONIC DEVICE

A display method and device, related to the field of electronic terminals. The electronic device includes a first display and a second display. The first display and the second display jointly display first display content if the first display is disposed on the electronic device; or the first display and the second display separately display content if the first display is not disposed on the electronic device, where the first display displays second display content, the second display content is related to first display content, and the second display displays third display content. The first display may be detachable, and the second display may be non-detachable. Embodiments are applied to scenarios in which displays of the electronic device jointly and separately display content, to improve display utilization of the electronic device or display flexibility, optimize a display function and/or an interaction function of the electronic device, and improve user experience. 122-. (canceled)23. A display method , applied to an electronic device , wherein the electronic device comprises a first display apparatus and a second display apparatus , the method comprising:jointly displaying, by the first display apparatus and the second display apparatus, first display content if the first display apparatus is disposed on the electronic device;displaying, by the first display apparatus, partial content of the first display content, and sending remaining content of the first display content to the second display apparatus so that the second display apparatus displays the remaining content of the first display content; or separately displaying content, by the first display apparatus and the second display apparatus, if the first display apparatus is not disposed on the electronic device, wherein the first display apparatus displays second display content, the second display content is related to the first display content, and the second display apparatus displays third ...

MOWER SYSTEM, METHOD FOR SETTING ROTATING SPEED OF CUTTER AND MOWER SYSTEM MANAGEMENT METHOD

The disclosure provides a mower system, a method for setting the rotating speed of a cutter and a mower system management method. The system comprises: a vehicle control unit for controlling the mower to operate; a walking unit for receiving a control signal of the vehicle control unit to control the walking of the mower and perform state feedback to the vehicle control unit; a cutter unit for receiving a control signal sent by the vehicle control unit to control the cutter to run and carrying out state feedback to the vehicle control unit; and a battery management system for performing state feedback on the working state of the battery to the vehicle control unit. The cutter rotating speed can be adjusted instantly according to the vehicle speed, and when the cutter motor enters limit state, the speed can be limited. 1. A mower system comprising:a vehicle control unit, which is used for controlling a mower to operate;a walking unit, including a walking motor controller and a walking motor, which are used for receiving a control signal from the vehicle control unit to control the walking of the mower and provide a state feedback to the vehicle control unit;a cutter unit, including at least one cutter, a cutter motor used for driving the cutter to operate, and a cutter motor control unit used for controlling the cutter motor, wherein the cutter motor control unit receives a control signal sent by the vehicle control unit to control the cutter to operate and carries out a state feedback to the vehicle control unit; anda battery management system, which is used for performing a state feedback on the working state of a battery to the vehicle control unit, whereina rotating speed of the cutter is adjusted by the vehicle control unit according to a vehicle speed to reduce an energy consumption of the mower.2. The mower system according to claim 1 , whereinthe vehicle control unit adjusts the rotating speed of the cutter based on a fixed ratio to the vehicle speed.3. The ...

AUGMENTED REALITY FOR SHIPPING

A system, computer-readable storage medium storing at least one program, and computer-implemented method for providing augmented reality shipping features is provided. A parcel is identified based on input received from a user. Presentation data including content having interactive elements specific to the parcel is generated. The presentation data is transmitted to a client device. The client device is instructed to overlay the presentation data on an image of the parcel. 1. A system comprising:an identification module to identify a parcel based on an input received from a user device;a generation module to generate presentation data specific to the parcel, the presentation data including one or more interactive elements;a transmission module to transmit presentation data to the user device and to instruct the user device to overlay the presentation data over a real time image of the parcel.2. The system of claim 1 , wherein the one or more interactive elements are indicated on a shipping label on the parcel.3. The system of claim 2 , wherein the input received from the user is an image of the shipping label.4. The system of claim 3 , wherein the identifying of the parcel is based on recognition of an object contained on the shipping label.5. The system of claim 1 , wherein the input received from the user is an alpha numeric sequence.6. The system of claim 1 , wherein the interactive element allows the user to confirm the receipt of the parcel.7. The system of claim wherein the interactive element is a message.8. The system of claim 7 , wherein the message is specific to an intended recipient of the parcel.9. The system of claim 7 , wherein the message includes an advertisement claim 7 , special promotion claim 7 , or coupon of a merchant.10. The system of claim 7 , wherein the message is an electronic greeting card.11. A method comprising:identifying a parcel based on input received from a user device;generating presentation data specific to the parcel, the ...

ENERGY-SAVING SWITCHING METHOD AND A SMART WATCH WITH HEART RATE DETECTION FUNCTION

A method and a smart watch for detecting and prompting abnormal heart rate data, and the start watch comprises a main processor and an auxiliary processor. When the main processor is in a dormancy state, the auxiliary processor collects heart rate data and analyzes whether the heart rate data is abnormal. When it is determined that the heart rate data is abnormal, the auxiliary processor is interrupted and the main processor is woken up, and the abnormal data is submitted to the main processor for processing. When the processing is completed, the main processor returns to the dormancy state, so that the main processor does not need to participate in the heart rate data collection and analysis process. The power consumption during running of the auxiliary processor is one quarter of the power consumption of the main processor in the dormancy state. 1. A method for detecting and prompting abnormal heart rate data , the method comprising:collecting detected heart rate data;analyzing the collected heart rate data by an auxiliary processor;determining whether the collected data is in a threshold range;triggering to wake up a main processor and the main processor switching from a dormancy state to an operation state when the auxiliary processor detects that the collected heart rate data is abnormal for over a predetermined time period;establishing communication with a mobile terminal via Bluetooth and transmitting abnormal heart rate and providing an alert prompt by the main processor;wherein after determining whether the collected data is in the threshold range, detecting the duration of the abnormal heart rate data; if the duration of the abnormal heart rate data exceeds a predetermined time period, determining wearing condition of a watch; if the watch is being worn by a user, determining whether the user is in exercise; if the user is not in exercise, interrupting the auxiliary processor in a low power state and triggering to wake up the main processor to establish ...

SHIPPING CONFIRMATION SYSTEM AND METHOD

Aspects of the present application involve a system and method for shipment delivery confirmation. In example embodiments, a recipient of a parcel uses a mobile application executing on a client device and in communication with a server to engage with enhanced user interfaces that facilitate delivery confirmation of the parcel. The user interfaces may include display of presentation data overlaid on a real time image of the parcel. Initially, the presentation data displayed in the user interface may include a first element (e.g., a button) that allows the user to confirm delivery of the parcel, and in response to user interaction with the first element, the user interface may be updated to include a second element indicating delivery of the parcel has been confirmed. Further, a delivery confirmation notification may be transmitted to an additional device in response to the user interaction with the first element. 1. A system for confirming delivery of a parcel , the system comprising: an image capture device;', 'one or more processors; and', generating image data using the image capture device, the image data including a real time image of the parcel;', 'transmitting the image data to the server over the network;', 'presenting a user interface including presentation data overlayed on the real time image of the parcel, the presentation data including a first interactive element to facilitate delivery conformation of the parcel; and', 'updating the user interface based on user interaction with the first interactive element, the updating of the user interface including presenting a second interactive element indicating confirmed delivery of the parcel; and, 'a first machine-readable medium to store a mobile application, the mobile application, when executed by the one or more processors, cause the one or more processors to perform operations comprising], 'a client device communicatively coupled to a server over a network, the client device comprising an additional one ...

Method and system for extracting lower limb vasculature

The present disclosure relates to systems and methods for extracting a vessel of a lower limb. The methods may include obtaining an original image including a plurality of image data, in some embodiments, each of the plurality of image data may correspond to a pixel (or a voxel), the plurality of image data may include a target data set, the target data set may represent a first structure; extracting a first reference data set from the plurality of image data, in some embodiments, the first reference data set may include the target data set and a second reference data set, the second reference data set may include data of a second structure; extracting the second reference data set from the plurality of image data; and obtaining the target data set based on the first reference data set and the second reference data set.

NEURAL NETWORK TRAINING METHOD AND APPARATUS, COMPUTER DEVICE, AND STORAGE MEDIUM

A neural network training method, apparatus, a storage medium, and a computer device are provided. The method includes: obtaining a training sample set, each training sample including a standard label; inputting the each training sample into a neural network model including n attention networks, the n attention networks respectively mapping the each training sample to n subspaces, each of the n subspaces including a query vector sequence, a key vector sequence, and a value vector sequence; calculating a space difference degree between the n subspaces by using the neural network model; calculating an output similarity degree according to an output of the neural network model and the standard label corresponding to the each training sample; and adjusting a model parameter of the neural network model according to the space difference degree and the output similarity degree until a convergence condition is satisfied to obtain a target neural network model. 1. A neural network training method , performed by a computer device , the method comprising:obtaining a training sample set, each training sample in the training sample set including a corresponding standard label;inputting the each training sample in the training sample set into a neural network model, the neural network model comprising n attention networks, the n attention networks respectively mapping the each training sample to n different subspaces, each subspace of the n subspaces comprising a corresponding query vector sequence, a corresponding key vector sequence, and a corresponding value vector sequence, and n being an integer greater than 1;calculating a space difference degree between the n subspaces by using the neural network model;calculating an output similarity degree according to an output of the neural network model and the standard label corresponding to the each training sample; andadjusting a model parameter of the neural network model according to the space difference degree and the output ...

DYNAMIC CHECKOUT BUTTON APPARATUSES, METHODS AND SYSTEMS

The DYNAMIC CHECKOUT BUTTON APPARATUSES, METHODS AND SYSTEMS (DCB) transforms product page checkout request input and user identification input via DCB components such as offer/discount determination component and checkout button embedding component, into dynamic checkout button outputs. 1. A computer system for generating graphical user interfaces comprising at least one central processor physically configured according to computer executable instructions , a memory for storing computer executable instructions and an input output circuit , the central processor being physically configured for:receiving, using one or more processors, a product page checkout request;querying, using the one or more processors, for information associated with a merchant and a user;generating, using the one or more processors, data to be embedded into a wallet-associated checkout button wherein the data comprises one or more dynamic images and wherein the one or more dynamic images represent one or more financial accounts;receiving, using the one or more processors, a payment request; and,generating, using the one of more processors, an additional graphical user interface to receive password data wherein the additional graphical user interface is related to the wallet-associated checkout button.2. The computer system of claim 1 , wherein the additional graphical user interface is displayed in the checkout button.3. The computer system of claim 1 , wherein the addition graphical user interface is displayed in a linear extension of the checkout button.4. The computer system of claim 1 , wherein the additional graphical user interface is displayed in a user defined location.5. The computer system of claim 1 , wherein the additional graphical user interface includes a look and feel defined by one of the checkout button claim 1 , an account issuer claim 1 , and the user.6. The computer system of claim 1 , wherein in response to the password data being accepted claim 1 , providing acceptance ...

WATERPROOF ELECTRICAL CONNECTOR

An electrical receptacle connector includes an insulative housing, a plurality of terminals retained in the housing, a metallic shell enclosing the housing and defining a mating cavity forwardly communicating with an exterior in a front-to-back direction, a compressible gasket surrounding a front edge region of the shell, and a metallic mounting bracket positioned upon the shell in the vertical direction perpendicular to the front-to-back direction wherein the mounting bracket includes a flange located at the front edge thereof and extending in a vertical direction perpendicular to the front-to-back direction to forwardly abut against the compressible gasket for preventing rearward movement of the compressible gasket. 1. An electrical connector comprising:an insulative housing;a plurality of terminals retained in the housing;a metallic shell enclosing the housing and defining a mating port forwardly communicating with an exterior in a front-to-back direction;a compressible waterproof gasket attached upon a front end region of the shell; anda metallic mounting bracket positioned upon an exterior surface of the shell;whereinthe mounting bracket forms flanges at a front edge thereof to efficiently abut forwardly against the waterproof gasket so as to prevent rearward movement of the waterproof gasket over the flange when said waterproof gasket is rearwardly pushed and compressed by a panel.2. The electrical connector as claimed in claim 1 , wherein the mounting bracket is unitarily formed with the shell.3. The electrical connector as claimed in claim 2 , wherein said mounting bracket unitarily extends from a rear edge of the shell via folded structures.4. The electrical connector as claimed in claim 3 , wherein the shell defines a capsular cross-section with a pair of long sides and a pair of short sides claim 3 , and the folded structures are formed on the long sides only.5. The electrical connector as claimed in claim 4 , wherein the mounting bracket includes a first ...

Task scheduling method and apparatus

Data contention caused by multiple threads accessing one data block at the same time when used to execute tasks concurrently may be avoided, and difficulty in detecting and debugging a concurrent error may be reduced. A solution is: adding, according to correspondences between multiple tasks and M data blocks that are accessed by the multiple tasks, each of the multiple tasks to a task queue of a data block corresponding to the task; using N threads to execute tasks in N task queues of M task queues concurrently, where each of the N threads executes a task in a task queue of the N task queues, different threads of the N threads execute tasks in different task queues, and 2≤N≤M.

SPEAKER INTERACTION METHOD, SPEAKER, AND SPEAKER SYSTEM

A method includes: receiving, by a mother speaker, a first data packet sent by a child speaker; parsing the first data packet to obtain the identifier of the child speaker; when determining, based on the identifier of the child speaker, that the child speaker meets permission, sending, to a cloud server, a third data packet that carries an identifier of the mother speaker, the identifier of the child speaker and voice data; receiving a fourth data packet that is sent by the cloud server and that carries the identifier of the mother speaker, the identifier of the child speaker, and reply data responding to the voice data; and parsing the fourth data packet to send a second data packet that carries the identifier of the child speaker and the reply data responding to the voice data to the child speaker. 135-. (canceled)36. A speaker interaction method , applied to a speaker system , the speaker system comprising one mother speaker and at least one child speaker , and the method comprises:receiving, by the mother speaker, a first data packet sent by the child speaker, wherein the first data packet comprises an identifier of the child speaker and voice data, and the voice data is data of a voice input by a user;parsing, by the mother speaker, the first data packet to obtain the identifier of the child speaker;sending, by the mother speaker, a third data packet to a cloud server when determining, based on the identifier of the child speaker, that the child speaker meets permission, wherein the third data packet carries an identifier of the mother speaker, the identifier of the child speaker, and the voice data;receiving, by the mother speaker, a fourth data packet sent by the cloud server, wherein the fourth data packet carries the identifier of the mother speaker, the identifier of the child speaker, and reply data responding to the voice data; andparsing, by the mother speaker, the fourth data packet to obtain a second data packet, and sending the second data packet to ...

METHOD OF MANUFACTURING SUPERIOR 13CR THICKENED DRILLROD

A method for manufacturing a superior 13Cr thickened drillrod comprises the following steps: firstly, thickening the ends of a steel tube with a composition so as to obtain a drillrod with thickened ends, the composition in percentage by weight being: C: 0.01-0.05%, Si≦0.5%, Mn: 0.2-1.0%, Cr: 12-14%, Mo: 1-3%, Ni: 4-6%, and a balance of Fe and inevitable impurities; after heating the tube as a whole to 950-1000° C., air cooling same and tempering same at 600-650° C.; and machining the two thickened ends respectively into an externally threaded drillrod coupler and an internally threaded drillrod coupler; wherein the tube end thickening is an external thickening, including three rounds of heating and three rounds of thickening, with at least one pass of deformation for each round, and the heating temperature being 1150-1200° C. for each round; and the upsetting pressure for the first round of external thickening is 180-220 bars, the upsetting pressure for the second round of external thickening is 180-220 bars, and the upsetting pressure for the third round of external thickening is 140-180 bars. The drillrod according to the present invention can be used not only as a drillrod but also as an oil tube, fulfilling requirements of the exploration operation of a CO-containing gas field of compact sandstone with a high yield. 1. A method for manufacturing a superior 13Cr thickened drillrod according to the present invention , comprising the following steps: firstly thickening the ends of a steel tube with a composition so as to obtain a drillrod with thickened ends , the composition in percentage by weight being: C:0.01-0.05% , Si:≦0.5% , Mn: 0.2-1.0% , Cr: 12-14% , Mo: 1-3% , Ni: 4-6% , and a balance of Fe and inevitable impurities; after heating the tube as a whole to a temperature of 950-1000° C. , air cooling same and finally tempering same at 600-650° C. , with the drillrod tube body and the thickened ends achieving a mechanic feature of 110 ksi; after the heating ...

KEYBOARD APPLICATION WITH THIRD PARTY ENGAGEMENT SELECTABLE ITEMS

Embodiments of the invention are directed to an embodiment of a keyboard application in which a plurality of selectable items (representing keys) are associated with transactions. The keyboard application may be imported into any application that utilizes text input, and replaces a default keyboard used to provide the text input. Upon selection of one of the plurality of selectable items, a transaction is initiated by a service provider computer. In some embodiments, the transaction may result in the engagement of a third party entity. Once completed, an access credential associated with the completion of the transaction is generated. The access credential may be entered into the text input field of the application that utilizes text input. 120.-. (canceled)21. A method comprising:maintaining, at a service provider computer, a mapping between a plurality of selectable product images and a plurality of retail establishment computers, wherein each selectable product image of the plurality of selectable product images is associated with a transaction to be completed with an associated retail establishment computer of the plurality of retail establishment computers;receiving, by the service provider computer from a keyboard application installed on a user device, a selection of a product image;determining, by the service provider computer based on the received selection, a transaction to be completed with a retail establishment computer associated with the selected product image;identifying, based on the user device, a payment account to be used in completing the transaction;conducting the transaction using the payment account to receive an access credential from the retail establishment computer; andproviding the access credential to the keyboard application installed on the user device.22. The method of claim 21 , wherein the access credential is further transmitted to a second user device by the user device.23. The method of claim 22 , wherein the access credential ...

RESOURCE AUTHORIZATION METHOD FOR DEPLOYMENT OF VIRTUAL NETWORK FUNCTION, VIRTUAL NETWORK FUNCTION MANAGER, AND NETWORK FUNCTION VIRTUALIZATION ORCHESTRATOR

The present disclosure provides a resource authorization method for deployment of a VNF, a VNFM, an NFVO, a storage medium and a device. The resource authorization method includes steps of: determining, by the VNFM, whether or not there is a resource request; in the case that there is the resource request, transmitting, by the VNFM, a resource authorization request to the NFVO; receiving, by the VNFM, a resource authorization response from the NFVO, the resource authorization response containing a resource authorization result; and processing, by the VNFM, the resource authorization result. 1. A resource authorization method for deployment of a Virtual Network Function (VNF) , comprising steps of:determining, by a Virtual Network Function Manager (VNFM), whether or not there is a resource request;in the case that there is the resource request, transmitting, by the VNFM, a resource authorization request to a Network Function Virtualization Orchestrator (NFVO);receiving, by the VNFM, a resource authorization response from the NFVO, the resource authorization response containing a resource authorization result; andprocessing, by the VNFM, the resource authorization result.2. The resource authorization method according to claim 1 , wherein the resource authorization request carries an indicator of a resource pool indication parameter claim 1 , the indicator comprises a resource pool indication parameter of resource pools of a first type or a second type claim 1 , the resource pools of the first type represent resource pools to be authorized claim 1 , and the resource pools of the second type represent resource pools incapable of being authorized claim 1 ,wherein the resource authorization result is used to indicate whether or not the resource pools designated by the VNFM are authorized or indicate the resource pools meet a request condition.3. The resource authorization method according to claim 1 , wherein the resource authorization request does not carry an indicator ...

ACTIVE CONTROL ALTERNATING-DIRECT FLOW HYBRID MECHANICAL CRYOGENIC SYSTEM

The disclosed subject matter includes an active control alternating-direct flow hybrid mechanical cryogenic system, and relates to the field of cryogenic refrigeration technologies. The active control alternating-direct flow hybrid mechanical cryogenic system includes a main compressor, a Stirling cold finger, an intermediate heat exchanger, a pulse tube cold finger, a first dividing wall type heat exchanger, a final precooled heat exchanger, a second dividing wall type heat exchanger, and an evaporator that are communicated successively, where the second dividing wall type heat exchanger is connected to the evaporator through a second connecting pipeline, and a throttling element is disposed on the second connecting pipeline; a pulse tube cold head of the pulse tube cold finger is communicated with the final precooled heat exchanger through a cold chain; and a check valve is disposed on the intermediate heat exchanger. 1. An active control alternating-direct flow hybrid mechanical cryogenic system , comprising a main compressor , a Stirling cold finger , an intermediate heat exchanger , a pulse tube cold finger , a first dividing wall type heat exchanger , a final precooled heat exchanger , a second dividing wall type heat exchanger , and an evaporator that are communicated successively , wherein the second dividing wall type heat exchanger is connected to the evaporator through a second connecting pipeline , and a throttling element is disposed on the second connecting pipeline; wherein a pulse tube cold head of the pulse tube cold finger is communicated with the final precooled heat exchanger through a cold chain; and wherein a check valve is disposed on the intermediate heat exchanger.2. The active control alternating-direct flow hybrid mechanical cryogenic system according to claim 1 , wherein the main compressor is connected to the Stirling cold finger through a first connecting pipeline.3. The active control alternating-direct flow hybrid mechanical cryogenic ...

METHOD FOR MANUFACTURING SUPERIOR 13CR FRICTION-WELDED DRILLROD

The present invention provides a method for manufacturing a superior 13Cr friction-welded drillrod, the method comprising the following steps: manufacturing a superior 13Cr tube body; manufacturing a superior 13Cr internally threaded coupler and a superior 13Cr externally threaded coupler, respectively; connecting the superior 13Cr internally threaded coupler and the superior 13Cr externally threaded coupler respectively to the two ends of the superior 13Cr tube body by means of frictional butt welding; after heating seam areas to 950° C.-1000° C., cooling same to below 200° C. by ejecting compressed air onto the surfaces of the seam areas, and then cooling the seam areas to room temperature by spraying water; and tempering the seam areas by heating same to 640° C.-700° C. By the present method, a superior 13Cr friction-welded drillrod can be manufactured, which, in the case of the exploration of a gas filed containing a relatively high level of CO2, can be not only used as a drillrod in an earlier stage of nitrogen well-drilling operation, but also used as an oil tube in a later stage of well completion with oil tube. 1. A method for manufacturing a 13Cr friction-welded drillrod , the method comprising:a) manufacturing a 13Cr tube body having two opposing ends;b) manufacturing a 13Cr internally threaded coupler and a 13Cr externally threaded coupler, respectively;c) connecting the 13Cr internally threaded coupler and the 13Cr externally threaded coupler respectively to the two opposing ends of the 13Cr tube body;d) heating seam areas between the coupler and tube ends to 950° C.-1000° C;e) cooling the heated seam areas to below 200° C.;f) cooling the seam areas to room temperature; andg) tempering the seam areas by heating the seam areas to 640° C.-700° C.2. The method of claim 1 , wherein the 13Cr tube body claim 1 , 13Cr internally threaded coupler and 13Cr externally threaded coupler comprise 0.01%-0.05 wt % carbon (C) claim 1 , ≦0.5 wt % silicon (Si) claim 1 , 0 ...

MANUFACTURING METHOD FOR SEMICONDUCTOR DEVICE

The present application relates to the field of semiconductor technologies, and discloses a manufacturing method for a semiconductor device. The method may include: providing a substrate structure, the substrate structure including: a substrate which includes a first region and a second region; and a first gate structure which is positioned on the first region and used for a first device; forming an etching protection layer on the surface of the substrate structure; forming a mask layer on the etching protection layer above the second region, the mask layer comprising a polymer; performing dry etching, so that the first region on both sides of the first gate structure is etched to form first indentations and that the etching protection layer on the surface of the first gate structure is removed; removing the mask layer to form a semiconductor structure; illuminating the semiconductor structure with light; and performing wet etching, so that the first indentations become second indentations. The present application can reduce an impact of a polymer residue on device performance. 1. A manufacturing method for a semiconductor device comprising: a substrate which comprises a first region and a second region; and', 'a first gate structure which is positioned on the first region and is used for a first device;, 'providing a substrate structure, the substrate structure comprisingforming an etching protection layer on a surface of the substrate structure;forming a mask layer on the etching protection layer above the second region, the mask layer comprising a polymer;performing dry etching, so that the first region on both sides of the first gate structure is etched to form first indentations and so that the etching protection layer on a surface of the first gate structure is removed;removing the mask layer to form a semiconductor structure;illuminating the semiconductor structure with light; andperforming wet etching, so that the first indentations become second ...

POLYOLEFIN COMPOSITE SEPARATOR, METHOD FOR MAKING THE SAME, AND LITHIUM ION BATTERY USING THE SAME

A method for making a polyolefin composite separator is disclosed. Methyl methacrylate and γ-(triethoxysilyl) propyl methacrylate are polymerized to form a copolymer. The copolymer and polyvinylidene fluoride are dissolved in a first solvent to form a first solution. A polyolefin porous film is immersed in a second solvent to soak the polyolefin porous film. The first solution is applied to a surface of the second solvent soaking polyolefin porous film. The polyolefin porous film having the first solution applied thereon is immersed in a third solvent to form holes, thereby forming a gel polymer electrolyte precursor layer on the surface of the polyolefin porous film. The polyolefin porous film having the gel polymer electrolyte precursor layer formed thereon is fumigated in an atmosphere of hydrochloric acid gas. A polyolefin composite separator and a lithium ion battery are also disclosed. 2. The method of claim 1 , wherein the polymerizing comprises:mixing the methyl methacrylate and the γ-(triethoxysilyl)propyl methacrylate to form a mixture;adding an initiator to the mixture, and stirring and heating the mixture having the initiator to a reaction temperature to polymerize the methyl methacrylate and the γ-(triethoxysilyl)propyl methacrylate to form a copolymer preform; andpurifying the copolymer preform.3. The method of claim 2 , wherein a molar ratio of the methyl methacrylate to the γ-(triethoxysilyl)propyl methacrylate is m:n.4. The method of claim 3 , wherein m:n=1.5. The method of claim 2 , wherein the reaction temperature is in a range from about 70° C. to about 90° C.6. The method of claim 2 , wherein the initiator is an azo initiator.7. The method of claim 2 , wherein the purifying comprises:dissolving the copolymer preform in a fourth solvent to form a copolymer preform solution; andproviding a mixed solvent of ethanol and water, and adding the copolymer preform solution to the mixed solvent to precipitate the copolymer.8. The method of claim 7 , ...

Trenchless rehabilitation system for deformation of large diameter HDPE pipelines and method thereof

The application provides a system comprising a water blocking device, a support structure, an injection machine, a resin impregnated lining hose and a light curing machine. The water blocking device blocks water and creates space for repairing. The support structure jacks up the deformation of pipelines. The injection machine injects polymer into the gap between the support structure and the HDPE pipes and the defective soil. A resin impregnated lining hose is inflated to attach to the support structure before being cured by UV lights. A CIPP (Cured-in-place pipe) liner is formed. The application carries out the trenchless rehabilitation of deformation of HDPE pipelines by integrating the method of the lining steel ring supporting, polymer injection and CIPP process. The defective soils are stabilized and further defects after repairing is avoided. The application is advantageous to the trenchless rehabilitation for double wall corrugated pipeline (diameter over 800 mm). 1: A trenchless rehabilitation system for deformation of large diameter HDPE (high-density polyethylene) pipelines , comprising: a water blocking device , a support structure , an injection machine , a resin impregnated lining hose and a light curing machine;wherein the water blocking device blocks water and creates a space for repairing the deformation of the lame diameter HDPE pipeline; the water blocking device comprises an airbag and an air compressor; the air compressor is connected to an air inlet of the airbag; the airbag is placed on an upstream access point;wherein the support structure jacks up the deformation of the large diameter HDPE pipeline wherein the support structure comprises an upper arc support steel plate, a lower arc support steel plate and a telescopic support rod; injecting holes are at a top center of the upper arc support steel plate and the lower arc support steel plate respectively; the injection machine injects polymer through the injection holes deep into the upper arc ...

BIARYL AMIDE COMPOUNDS, PREPARATION METHODS AND MEDICAL APPLICATIONS THEREOF

This application discloses RAF inhibitors of the general formula (I) and analogs thereof, pharmaceutical compositions containing these compounds, methods of preparing them, and use of these compounds as therapeutic agents for the treatment of various disorders related to the excessive RAF activity, including cancers.

Keyboard Application With Third Party Engagement Selectable Items

Embodiments of the invention are directed to an embodiment of a keyboard application in which a plurality of selectable items (representing keys) are associated with transactions. The keyboard application may be imported into any application that utilizes text input, and replaces a default keyboard used to provide the text input. Upon selection of one of the plurality of selectable items, a transaction is initiated by a service provider computer. In some embodiments, the transaction may result in the engagement of a third party entity. Once completed, an access credential associated with the completion of the transaction is generated. The access credential may be entered into the text input field of the application that utilizes text input.

CHANNEL SWITCHING METHOD, APPARATUS, AND DEVICE

Embodiments of the present invention provide a channel switching method, apparatus, and device. The method includes: obtaining, by a mobile Wi-Fi device, a channel switching instruction sent by a Wi-Fi access point, where the channel switching instruction carries a destination channel identifier; and switching, by the mobile Wi-Fi device according to the channel switching instruction, a communication channel between the mobile Wi-Fi device and the Wi-Fi access point, and a communication channel between the mobile Wi-Fi device and a terminal that accesses the mobile Wi-Fi device to a destination communication channel corresponding to the destination channel identifier carried in the channel switching instruction. In this way, a Wi-Fi client and a Wi-Fi access end of a mobile Wi-Fi device still work on a same communication channel after performing channel switching, thereby improving compatibility, a throughput, and stability of the mobile Wi-Fi device. 1. A channel switching method , comprising:obtaining, by a mobile Wi-Fi device, a channel switching instruction sent by a Wi-Fi access point, wherein the channel switching instruction carries a destination channel identifier; andswitching, by the mobile Wi-Fi device according to the channel switching instruction, a communication channel between the mobile Wi-Fi device and the Wi-Fi access point, and a communication channel between the mobile Wi-Fi device and a terminal that accesses the mobile Wi-Fi device to a destination communication channel corresponding to the destination channel identifier.2. The method according to claim 1 , wherein the switching claim 1 , by the mobile Wi-Fi device according to the channel switching instruction claim 1 , a communication channel between the mobile Wi-Fi device and the Wi-Fi access point claim 1 , and a communication channel between the mobile Wi-Fi device and a terminal that accesses the mobile Wi-Fi device to a destination communication channel corresponding to the destination ...

Method and Apparatus for Providing Matching Information of Business Object

Methods and apparatuses for providing matching information of a business object are disclosed in the embodiments of the present disclosure. A method includes pre-establishing a matching information database of business objects of a fashion category by a server, the matching information database storing respective one or more matching proposals corresponding to first business objects, and the matching proposals including respective second business objects that matches with the first business objects and corresponding matching degree information; receiving a request for obtaining matching information of a specific first business object from a first user client; and providing information of a matching proposal of the specific first business object according to the matching information database. The embodiments of the present disclosure can save resources used by user operations such as switching between categories, and help reducing the access pressure and workload of a server. 1. A method comprising:determining one or more second business objects that are selectable when matching a first business object;determining one or more information dimensions that are referable when matching the first business object;determining matching degree information between the one or more second business objects and the first business object based on respective property information of the one or more second business objects and the first business object with respect to the one or more information dimensions; andgenerating and storing one or more matching proposals corresponding to the first business object in a matching information database, the one or more matching proposals including respective second business objects that matches the first business object and respective matching degree information.2. The method of claim 1 , wherein determining the one or more second business objects that are selectable comprises determining the one or more second business objects based on preset ...

METHOD FOR ACCESSING INTERNET VIA A VEHICLE NETWORK

The present invention provides a method for accessing internet via a vehicle network. Vehicle terminal equipment can access OBU by means of the wireless AP on OBU, and realize the mutual communication with internet with the help of VANET network composed by OBU and RSU. Not only the normal communication between the OBU and RSU is guaranteed, but also the communication between vehicle terminal equipment and internet can be realized. Moreover, the present invention has the characteristics of anti-interference, convenience and real-time performance, and can adapt to the demand of the current network. 1. A method for accessing internet via a vehicle network , comprising the following steps:(1). assigning a IPv4 address to a vehicle terminal equipment through the DHCP(Dynamic Host Configuration Protocol), wherein:OBU (On-Board Unit) is configured as a DHCP server, and a static IPv4 address, a subnet mask and a default gateway are set up for it; when a vehicle terminal equipment apply to the DHCP server for a IPv4 address, DHCP server selects an IPv4 address which has not been used, from a set of IPv4 addresses for dynamic allocating; thus, different IPv4 address is assigned to different vehicle terminal equipment on OBU;(2). sending a packet from the vehicle terminal equipment to internet;2.1). a vehicle terminal equipment sends a IPv4 packet to OBU, OBU receives and processes the IPv4 packet, wherein: after receiving an IPv4 packet, OBU will inquire the destination address of the IPv4 packet to determine how to process the IPv4 packet, if the destination address is an external internet address, the IPv4 packet will be sent to and processed by Roadside Unit (RSU), if the destination address is an internal IPv4 address, i.e. an address of OBU, the IPv4 packet will be processed by the upper layer protocol of OBU, otherwise, the IPv4 packet will be discarded;2.2). wherein, the destination address of the IPv4 packet is an external internet address, the IPv4 packet will be ...

METHOD FOR MAKING POLYIMIDE MICROPOROUS SEPARATOR

A method for making a polyimide microporous separator comprising: using a flexible monomer to prepare a soluble polyimide by a one-step method, and forming a polyimide liquid solution; providing an inorganic template of inorganic nanoparticles, and surface treating the inorganic template with a surface treatment agent in an organic solvent to dissolve the inorganic template in the organic solvent, thereby forming an inorganic template liquid dispersion; mixing the polyimide liquid solution with the inorganic template liquid dispersion and agitation to form a film forming liquid; coating the film forming liquid on a substrate to form an organic-inorganic composite film; and disposing the organic-inorganic composite film into a template removing agent, the inorganic template in the organic-inorganic composite film reacting with the template removing agent to remove the inorganic template from the organic-inorganic composite film. 1. A method for making a polyimide microporous separator comprising: in a protective gas, adding a dianhydride monomer and a diamine monomer into an organic solvent to form a mixed liquid;', 'stirring the mixed liquid to dissolve the dianhydride monomer and the diamine monomer in the organic solvent, and after that, adding a catalyst to fully react at 160° C. to 200° C. to form a polyimide; and', 'dissolving the polyimide in an organic solvent to form the polyimide liquid solution;, 'using a flexible monomer to prepare a soluble polyimide by a one-step method, and forming a polyimide liquid solution, comprisingproviding an inorganic template being inorganic nanoparticles, and surface treating the inorganic template with a surface treatment agent in an organic solvent to dissolve the inorganic template in the organic solvent, thereby forming an inorganic template liquid dispersion;mixing the polyimide liquid solution with the inorganic template liquid dispersion and ultrasonically agitating to form a film forming liquid;coating the film ...

Immune Tolerant Elastin-Like Peptide Tetramer Guided Nanoparticles And Methods Of Use

Disclosed herein, are nanoparticles comprising one or more immune-tolerant elastin-like polypeptide tetramers and one or more immune-tolerant elastin-like fusion molecules. Also, disclosed herein are pharmaceutical compositions including the nanoparticles; methods of administering the nanoparticles to patients for the treatment of cancer; and methods of making the nanoparticles. 1. A nanoparticle comprising:a) one or more immune-tolerant elastin-like polypeptide (iTEP)-tetramers, wherein the one or more iTEP-tetramers comprise in amino terminal-to-carboxy terminal order (i) four MHC class I monomers, (ii) a first iTEP sequence, (iii) a second iTEP sequence and (iv) a cysteine containing tag; andb) one or more iTEP-fusion molecules, wherein the one or more iTEP-fusion molecules comprise (i) a HisTag; (ii) a linker; (iii) therapeutic agent; (iv) a first iTEP sequence; (v) a second iTEP sequence and (vi) a cysteine containing tag.2. The nanoparticle of claim 1 , wherein the one or more iTEP-tetramers are amphiphilic.3. The nanoparticle of claim 1 , wherein the therapeutic agent is a peptide.4. The nanoparticle of claim 3 , wherein the peptide is an antibody or a single chain variable fragment (scFv).5. The nanoparticle of claim 1 , wherein the first iTEP sequence in a) comprises amino acid sequence (Gly-Ala-Gly-Val-Pro-Gly)(SEQ ID NO: 20) or (Gly-Val-Leu-Pro-Gly-Val-Gly)(SEQ ID NO: 21).6. The nanoparticle of claim 1 , wherein the second iTEP sequence in a) comprises amino acid sequence (Gly-Ala-Gly-Val-Pro-Gly)(SEQ ID NO: 20) or (Gly-Val-Leu-Pro-Gly-Val-Gly)(SEQ ID NO: 21).7. The nanoparticle of claim 1 , wherein the first and second iTEP sequences in a) are different.8. The nanoparticle of claim 1 , wherein the cysteine containing tag comprises a tetracysteine motif.9. The nanoparticle of claim 8 , wherein the tetracysteine motif is Gly-Cys-Gly-Cys-Gly-Cys-Gly-Cys (SEQ ID NO: 22).10. The nanoparticle of claim 1 , wherein the cysteine containing tags of the one or more ...

ADDITIVE, ELECTROLYTE AND LITHIUM ION BATTERY USING THE SAME

An additive for a lithium ion battery is disclosed. The additive is a polymer obtained by polymerizing a maleimide type monomer with an organic diamine type compound. The maleimide type monomer comprises at least one of a maleimide monomer, a bismaleimide monomer, a multimaleimide monomer and a maleimide type derivative monomer. An electrolyte liquid and a lithium ion battery are also disclosed. 2. The additive of claim 1 , wherein Ris selected from the group consisting of —(CH)— claim 1 , —CH—O—CH— claim 1 , —CH(NH)—(CH)— claim 1 , phenylene claim 1 , diphenylene claim 1 , substituted phenylene claim 1 , substituted diphenylene claim 1 , and bivalent alicyclic group claim 1 , Ris selected from the group consisting of —(CH)— claim 1 , —O— claim 1 , —S— claim 1 , —S—S— claim 1 , —CH—O—CH— claim 1 , —CH(NH)—(CH)— claim 1 , and —CH(CN)(CH)— claim 1 , and n=1 to 12.3. The additive of claim 1 , wherein the organic diamine type compound is selected from the group consisting of ethylenediamine claim 1 , phenylenediamine claim 1 , diamino-diphenyl-methane claim 1 , diamino-diphenyl-ether claim 1 , and combinations thereof.5. The additive of claim 4 , wherein Ris selected from the group consisting of —R claim 4 , —RNHR claim 4 , —C(O)CH claim 4 , —CHOCH claim 4 , —CHS(O)CH claim 4 , —CH claim 4 , —CHCH claim 4 , —CH(CH)CH claim 4 , and monovalent alicyclic group; R is hydrocarbyl with 1 to 6 carbon atoms.6. The additive of claim 1 , wherein the maleimide monomer is selected from the group consisting of N-phenyl-maleimide claim 1 , N-(p-methyl-phenyl)-maleimide claim 1 , N-(m-methyl-phenyl)-maleimide claim 1 , N-(o-methyl-phenyl)-maleimide claim 1 , N-cyclohexane-maleimide claim 1 , maleimide claim 1 , maleimide-phenol claim 1 , maleimide-benzocyclobutene claim 1 , di-methylphenyl-maleimide claim 1 , N-methyl-maleimide claim 1 , ethenyl-maleimide claim 1 , thio-maleimide claim 1 , keto-maleimide claim 1 , methylene-maleimide claim 1 , maleimide-methyl-ether claim 1 , ...

Fertilization Map Generation Method, Fertilization Map Generation System, Fertilization Map Generation Device, and Fertilization Map Generation Program

A fertilization map creating system includes a growth sensor, a GPS device, and a growth information accumulating part that stores data, a fertilization map being created based on growth data and position data stored in the growth information accumulating part, and the growth information accumulating part storing the position data and the growth data while a tractor drives in a field. The system further includes a growth condition calculation part that obtains a growth condition of previously set each area in the field based on the data stored in the memory; a fertilization amount calculation part that obtains an amount of fertilization of each area based on the growth condition of each area; and a map creating part that creates the fertilization map showing the amount of fertilization of each area obtained by the fertilization calculation part.

CAVITY CREATION TOOL BY CRUSHING WITH MULTI-STAGE CONTROLLABLE WATER JET FOR NATURAL GAS HYDRATE DEVELOPMENT

Disclosed is a cavity creation tool by crushing with multi-stage controllable water jet, which is used in natural gas hydrate development. The tool mainly consists of an inner tube upper joint, an inner tube lower joint, an intermediate sleeve, an inner structure consisting of a coaxial throttle push rod, an outer layer sleeve, an outer layer structure consisting of a supporting ring, a jet head mounted to the intermediate sleeve and threading the outer layer sleeve, and a jet crushing structure consisting of a single stage telescopic jet head and a second stage telescopic jet head. 1110311042330130230730331230430830530930631031142231112131311121021222121012102210321012107210121052121012102210421210121022106210121022221012101210255307312308309698777698614151619182017171714151614191816. A cavity creation tool by crushing with multi-stage controllable water jet for natural gas hydrate development consisting of an inner layer structure , an outer layer structure and a jet crushing structure; wherein the inner layer structure consists of an inner tube upper joint () , an inner tube lower joint () , an intermediate sleeve () mounted between the inner tube upper joint () and the inner tube lower joint () through plug-in connection , a C-shaped ring () , a coaxial throttle push rod () and a sealing structure with an arrow valve end face; the intermediate sleeve () is provided with a plug-in female buckle I () , a 25° inclined slot () , circumferentially evenly distributed six threaded holes I () , a 30° inclined slot () , circumferentially evenly distributed six threaded holes II () , a 40° inclined slot () , circumferentially evenly distributed six threaded holes III () , a 50° inclined slot () , circumferentially evenly distributed six threaded holes IV () , a 60° inclined slot () , a sealing groove III () and a plug-in male buckle II (); the C-shaped ring () is mounted on the coaxial throttle push rod () to realize the axial and radial positioning of the coaxial ...

APPARATUS, SYSTEM AND METHOD FOR CHARGING A BATTERY

Disclosed is an apparatus for charging a battery comprising a first charging device configured to communicate with at least one second charging device, the first charging device and the at least one second charging device configured to charge the battery, and comprising a first controller configured to control the first charging device, wherein the first controller determines the number of the at least one second charging devices by communicating with a second controller. 1. A system for charging an electric vehicle , the system comprising:a plurality of charging devices;wherein each of the plurality of charging devices is operable to establish communication with the electric vehicle by exchanging handshake signals therewith via a respective charging port of the electric vehicle for the plurality of charging devices to identify a first charging device among the plurality of charging devices via which charging requirements of the electric vehicle is to be received and allocated among the plurality of charging devices that are available for charging the electric vehicle;wherein the first charging device is a charging device that successfully exchanges handshake signals with the electric vehicle; andat least one second charging device of the plurality of charging devices that unsuccessfully exchanges handshake signals with the electric vehicle indicates that it is available for charging the electric vehicle.23.-. (canceled)4. The system for charging an electric vehicle according to claim 1 , wherein the at least one second charging device is operable to indicate it is available for charging the electric vehicle by sending a message including its charging device identity (ID) to the first charging device claim 1 , and wherein the first charging device is operable to maintain a record of charging device IDs that it receives.5. The system for charging an electric vehicle according to claim 4 , wherein charging devices that are available for charging includes charging ...

Modified filler composition and papermaking process using the same

A modified filler composition used in papermaking is provided. The modified filler composition contains microfibrillated cellulose, filler, and latex having a glass transition temperature of less than 20° C. The dry weight of the microfibrillated cellulose is about 0.1% to about 10% that of the filler; the dry weight of the latex is about 0.1% to about 15% that of the filler.

IMMUNE TOLERANT ELASTIN-LIKE RECOMBINANT PEPTIDES AND METHODS OF USE

Disclosed herein, are recombinant polypeptides comprising one or more homologous amino acid repeats fused with an IgG binding domain The recombinant polypeptides can be bound to a therapeutic antibody and used a delivery vehicle to increase the retention time and reduce systemic-related side effects of the therapeutic antibodies. Also disclosed herein are pharmaceutical compositions including the recombinant polypeptides bound to a therapeutic antibody; and methods of administering the same to patients 2. (canceled)3. The recombinant polypeptide of claim 1 , wherein the homologous amino acid repeat sequence is repeated linearly.4. (canceled)5. The recombinant polypeptide of claim 1 , wherein the homologous amino acid repeat sequence is (Gly-Val-Leu-Pro-Gly-Val-Gly)28 (SEQ ID NO: 13); (Gly-Val-Leu-Pro-Gly-Val-Gly)(SEQ ID NO: 16); or (Gly-Val-Leu-Pro-Gly-Val-Gly)(SEQ ID NO: 17).6. (canceled)8. The recombinant polypeptide of claim 1 , further comprising one or more linker sequences.9. (canceled)10. (canceled)11. The recombinant polypeptide of claim 8 , wherein the recombinant polypeptide comprises the amino acid sequence (GVLPGVG)-GGGGS-TTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATK TFTVTE (SEQ ID NO: 36); (GVLPGVG)-GGGGS-TTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATK TFTVTE (SEQ ID NO: 37); (GVLPGVG)-GGGGS-TTYKLVINGKTLKGET TTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE (SEQ ID NO:38. ; (GVLPGVG)-(GGGGC)-GGGGS-TTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATK TFTVTE (SEQ ID NO: 41); (GVLPGVG)-(GGGGC)-GGGGS-TTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATK TFTVTE (SEQ ID NO: 42); or (GVLPGVG)-(GGGGC)-GGGGS-TTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATK TFTVTE (SEQ ID NO: 43).1218.-. (canceled)19. The recombinant polypeptide of claim 1 , further comprising and one or more therapeutic agents claim 1 , wherein the therapeutic agent is an anti-PD-1 antibody claim 1 , anti-PD-L1 antibody claim 1 , or an anti-CTLA-4 antibody.20. The recombinant polypeptide of claim 19 ...

CATHODE COMPOSITE MATERIAL AND LITHIUM ION BATTERY USING THE SAME

A cathode composite material is disclosed. The cathode composite material comprises a cathode active material and a maleimide type monomer composed with the cathode active material. The cathode active material is a lithium transition metal oxide. The maleimide type monomer comprises at least one of a maleimide monomer, a bismaleimide monomer, a multimaleimide monomer, a maleimide type derivative monomer, and combinations thereof. A lithium ion battery is also disclosed. 1. A cathode composite material comprising a cathode active material and a maleimide type monomer composited with the cathode active material , whereinthe cathode active material is a lithium transition metal oxide; andthe maleimide type monomer is selected from the group consisting of maleimide monomer, bismaleimide monomer, multimaleimide monomer, maleimide type derivative monomer, and combinations thereof.2. The cathode composite material of claim 1 , wherein the maleimide type monomer is mixed uniformly with the cathode active material.3. The cathode composite material of claim 1 , wherein the maleimide type monomer is coated on a surface of the cathode active material to form a core-shell structure.5. The cathode composite material of claim 1 , wherein the maleimide monomer is selected from the group consisting of N-phenyl-maleimide claim 1 , N-(p-methyl-phenyl)-maleimide claim 1 , N-(m-methyl-phenyl)-maleimide claim 1 , N-(o-methyl-phenyl)-maleimide claim 1 , N-cyclohexane-maleimide claim 1 , maleimide claim 1 , maleimide-phenol claim 1 , maleimide-benzocyclobutene claim 1 , di-methylphenyl-maleimide claim 1 , N-methyl-maleimide claim 1 , ethenyl-maleimide claim 1 , thio-maleimide claim 1 , keto-maleimide claim 1 , methylene-maleimide claim 1 , maleimide-methyl-ether claim 1 , maleimide-ethanediol claim 1 , 4-maleimide-phenyl sulfone claim 1 , and combinations thereof.7. The cathode composite material of claim 1 , wherein the bismaleimide monomer is selected from the group consisting of N claim ...

METHOD FOR ESTABLISHING CLASSIC BLUETOOTH CONNECTION BETWEEN DUAL-MODE BLUETOOTH DEVICES, AND DUAL-MODE BLUETOOTH DEVICE

Embodiments of the present disclosure provide, for example, a Bluetooth connection method, the example method including sending, by a first terminal, a Bluetooth low energy BLE advertising message, where the BLE advertising message includes device information. A second terminal receives the BLE advertising message, and then obtains the device information. The second terminal then matches the device information with prestored device information and, if the device information successfully matches the prestored device information, initiates a classic Bluetooth connection request to the first terminal, where the first terminal then establishes a classic Bluetooth connection to the second terminal. Power consumption of BLE is low. 116-. (canceled)17. A method for establishing a classic Bluetooth connection between dual-mode Bluetooth devices , comprising:receiving, by a first dual-mode Bluetooth device, a Bluetooth low energy (BLE) advertising packet sent by a second dual-mode Bluetooth device, wherein the BLE advertising packet comprises attribute information of classic Bluetooth of the second dual-mode Bluetooth device;determining, by the first dual-mode Bluetooth device, a status of the classic Bluetooth of the second dual-mode Bluetooth device according to the attribute information; andprompting, by the first dual-mode Bluetooth device according to the status of the classic Bluetooth of the second dual-mode Bluetooth device, a user to operate the first dual-mode Bluetooth device or the second dual-mode Bluetooth device, so as to establish a classic Bluetooth connection between the first dual-mode Bluetooth device and the second dual-mode Bluetooth device.18. The method according to claim 17 , wherein the attribute information comprises a Bluetooth address of a peer device to which the classic Bluetooth of the second dual-mode Bluetooth device was connected last time claim 17 , and wherein the determining claim 17 , by the first dual-mode Bluetooth device claim 17 , a ...

Method and device for driving display panel and display device

A method for driving a display panel, a device for driving a display panel and a display device are provided. The method for driving a display panel includes: acquiring a GOA signal corresponding to a current frame of image, where the GOA signal includes a plurality of clock signals; determining a transmission channel corresponding to each of the plurality of clock signals, and generating a correspondence relationship between the clock signals and respective transmission channels, where the transmission channels are used to deliver the clock signals from a GOA control signal generator to a GOA circuit of the display panel, the current frame of image is different from at least one frame of image previous to the current frame of image with respect to the correspondence relationship between the clock signals and respective transmission channels; and transmitting the clock signals by using the determined transmission channels.

LAWN MOWER

A lawn mower, wherein the cutter system of the lawn mower needs to judge whether the start pulse and the start signal of the cutter switch are valid at the same time under the condition that the seat switch is closed, and the cutter system will be started, only the two conditions are met at the same time, thus not only improving the safety when the cutter system is started, but also the startup of the cutter system can be completed automatically, saving time and labor, and reducing the operator's operation difficulty. 1. A lawn mower , comprising:a battery system, which is configured to provide power to said lawn mower;a walking system, comprising a walking wheel and a motor for driving the walking wheel;a cutter system, comprising at least one blade, at least one drive motor for driving said blade to rotate, a start switch for activating said cutter system, an seat switch, and a cutter switch;said cutter system starts to work when the seat switch is closed and both the start pulse and the start signal of the cutter switch are valid.2. The lawn mower according to claim 1 , wherein said start switch is closed claim 1 , and said cutter system is powered on when said seat switch is closed; said start switch is switched off claim 1 , and said cutter system is powered off when said seat switch is switched off.3. The lawn mower according to claim 2 , wherein said start switch is a contactor.4. The lawn mower according to claim 1 , wherein said cutter system further comprises a high-low speed cutter switch for controlling the rotational speed of said blade claim 1 , when the cutter system starts to work claim 1 , the blade rotates at a high speed if the high-low speed cutter switch is active and the blade rotates at a low speed if the high-low speed cutter switch is inactive.5. The lawn mower according to claim 1 , wherein the start pulse of said cutter switch comprises a rising edge and a falling edge claim 1 , and the start signal of the cutter switch comprises a low ...

SIMULATOR GENERATION METHOD AND APPARATUS

The present invention discloses a simulator generation method and apparatus, relating to the field of simulator generation, which are used to implement rapid portability and high efficiency of a simulator. The solutions in the present invention are applicable to simulator generation. 1. A simulator generation method , comprising:obtaining an instruction set configuration file;generating a decoding table and a decoding algorithm according to the instruction set configuration file, wherein the decoding table comprises: an instruction code table, an instruction description table, and a bit field table, and assembly instruction operation code is recorded in the instruction code table, detailed information of each piece of the assembly instruction operation code is recorded in the instruction description table, and a method for calculating a numerical value in each operand bit field is recorded in the bit field table; andgenerating a simulator according to the decoding table, the decoding algorithm, and module code, wherein the module code is code used to simulate an action of an assembly instruction and code of a non-decoding algorithm in a decoding process.2. The simulator generation method according to claim 1 , whereinthe instruction set configuration file comprises: an assembly output format, a type of an operand, and a coding format of each instruction, wherein the instruction comprises: an operand and operation code; and generating the instruction code table according to the operation code of each instruction;', 'generating the instruction description table according to the assembly output format, the type of the operand, and the coding format of each instruction; and', 'generating the bit field table according to the operand of each instruction., 'generating a decoding table according to the instruction set configuration file comprises3. The simulator generation method according to claim 2 , wherein generating the instruction code table according to the operation ...

DEVICE AND METHOD FOR PURIFYING GAS IN ENCLOSED SPACE

A device for purifying a gas in an enclosed space includes: a container containing a target gas with a content of α, content of the target gas in air being β ranging from 0% to 1%, and α>β; a sensor configured to detect the content of the target gas in the enclosed space; a first valve arranged in a gas path between the container and a first purification unit; the first purification unit with an output end in communication with the enclosed space; a second valve with an input end in communication with the air and an output end in communication with a second purification unit; the second purification unit with an output end in communication with the enclosed space; and a gas path switch module with an input end in communication with the enclosed space. Also, a method for purifying gas in an enclosed space is disclosed. 1. A device for purifying a gas in an enclosed space , comprising:a container containing a target gas with a content of α, wherein content of the target gas in air is β ranging from 0% to 1%, and α>β;a sensor configured to detect a content of the target gas in the enclosed space;a first valve arranged in a gas path between the container and a first purification unit;the first purification unit with an output end in communication with the enclosed space;a second valve with an input end in communication with the air and an output end in communication with a second purification unit;the second purification unit with an output end in communication with the enclosed space; anda gas path switch module with an input end in communication with the enclosed space.2. The device of claim 1 , wherein the gas path switch module is a pump with an input end in communication with the enclosed space claim 1 , and the input end of the second valve is in communication with an atmospheric environment.3. The device of claim 1 , wherein the first purification unit and the second purification are integrated into a purification unit claim 1 , and the first valve and the second ...

LAWN MOWER

The present invention provides a lawn mower comprising a battery system, a walking system and a cutter system. The lawn mower further comprises: a fault detection module, configured to detect if at least one of the battery system, walking system and cutter system has a fault; a fault determination module, configured to judge the fault level of the detected fault; and a control module, to control the current-limiting or outage of the corresponding battery system, the slowdown or stop of the walking system, as well as the slowdown or stop of the cutter system according to the fault level; compared with the prior art, the invention not only makes the fault detection more intelligent, but also the lawn mower can adjust the working state in real time according to the fault level, thereby improving the working efficiency. 1. A lawn mower , comprising a battery system , a walking system and a cutter system , wherein further comprising:a fault detection module, configured to detect if at least one of the battery system, walking system and cutter system has a fault respectively;a fault determination module, configured to judge the fault level of the detected fault;a control module, configured to control the current-limiting or outage of the corresponding battery system, the slowdown or stop of the walking system, as well as the slowdown or stop of the cutter system according to the fault level.2. The lawn mower according to claim 1 , wherein said lawn mower further comprises a main controller claim 1 , and said fault detection module comprises a plurality of fault detection module provided in the battery system claim 1 , the walking system and the cutter system respectively claim 1 , to detect faults thereof respectively.3. The lawn mower according to claim 2 , when said fault detection module detects that said walking system has a fault claim 2 , said fault detection module sends a fault code to the fault determination module through CAN communication to determine a fault ...

METHOD FOR SEARCHING NETWORK AT STARTUP, COMMUNICATION PROCESSOR AND TERMINAL EQUIPMENT

A method for searching network at startup, a Communication Processor (CP) and a terminal equipment are provided. The method includes: after the CP is powered on and initialized, determining characteristic information of networks supported by the CP; searching for available networks according to the network characteristic information, and obtaining available network information; and obtaining a network searching instruction transmitted from an Application Processor (AP), and determining a network searching result according to the available network information. The method reduces the time for searching network at startup. 1. A method for searching network at startup , which is applied to a Communication Processor (CP) of terminal equipment , comprising:after the CP is powered on and initialized, determining characteristic information of networks supported by the CP;searching for available networks according to the network characteristic information, and obtaining available network information; andobtaining a network searching instruction transmitted from an Application Processor (AP), and determining a network searching result according to the available network information.2. The method according to claim 1 , wherein determining characteristic information of networks supported by the CP comprises: determining network standards supported by the CP and frequency bands corresponding to the network standards; andwherein the available network information comprises: available frequency points of the frequency bands corresponding to the network standards supported by the CP.3. The method according to claim 2 , wherein searching for available networks according to the network characteristic information comprises: performing frequency search on the frequency bands corresponding to the network standards supported by the CP claim 2 , according to a predetermined network standard searching order.4. The method according to claim 3 , wherein the network searching result comprises a ...

BOOSTER CIRCUIT, SHUTDOWN CIRCUIT, METHODS FOR DRIVING THE SAME, AND DISPLAY APPARATUS

The embodiments of the present disclosure propose a booster circuit and a method for driving the same, a shutdown circuit and a method for driving the same, and a display apparatus. The booster circuit includes a first input sub-circuit coupled to a first input signal terminal, a first voltage signal terminal, and an output signal terminal, and configured to transmit a first voltage signal at the first voltage signal terminal to the output signal terminal under control of a first input signal at the first input signal terminal; a second input sub-circuit coupled to a second input signal terminal, the first voltage signal terminal and a first node, and configured to transmit the first voltage signal at the first voltage signal terminal to the first node under control of a second input signal at the second input signal terminal; and a first storage sub-circuit coupled to the output signal terminal and the first node, and configured to cause a level of an output signal at the output signal terminal to be raised to a level higher than the first voltage signal. 1. A booster circuit , comprising:a first input sub-circuit coupled to a first input signal terminal, a first voltage signal terminal, and an output signal terminal, and configured to transmit a first voltage signal at the first voltage signal terminal to the output signal terminal under control of a first input signal at the first input signal terminal;a second input sub-circuit coupled to a second input signal terminal, the first voltage signal terminal and a first node, and configured to transmit the first voltage signal at the first voltage signal terminal to the first node under control of a second input signal at the second input signal terminal; anda first storage sub-circuit coupled to the output signal terminal and the first node, and configured to cause a level of an output signal at the output signal terminal to be raised to a level higher than the first voltage signal.2. The booster circuit according ...

BATTERY SEPARATOR AND METHOD FOR MAKING THE SAME

A method for making a separator in a lithium ion battery which is less susceptible to high temperature shrinkage provides a polyolefin porous membrane. An oxidant is applied to surface of the polyolefin porous membrane. The polyolefin porous membrane and oxidant are heated in a liquid medium. The liquid medium includes a silicon-oxygen organic compound including a methacryloxy group and at least two alkoxy groups respectively joined to a silicon atom. The silicon-oxygen organic compound is polymerized and chemically grafted to the polyolefin porous membrane to form a grafted polyolefin porous membrane. A condensation reaction then occurs between silicon-oxygen groups in the grafted polyolefin porous membrane in an acidic environment or alkaline environment. 1. A method for making a separator of a lithium ion battery comprising:providing a polyolefin porous membrane;applying an oxidant to a surface of the polyolefin porous membrane;heating the polyolefin porous membrane having the oxidant adsorbed thereon in a liquid medium, the liquid medium comprising a silicon-oxygen organic compound comprising a methacryloxy group and at least two alkoxy groups, the at least two alkoxy groups and the methacryloxy group are respectively joined to a silicon atom, and the silicon-oxygen organic compound being polymerized and chemically grafted to the polyolefin porous membrane to form a grafted polyolefin porous membrane; andhaving a condensation reaction between silicon-oxygen groups in the grafted polyolefin porous membrane in an acidic environment or alkaline environment thereby forming a silicon-oxygen hybrid crosslinked network grafted to the polyolefin porous membrane.2. The method of claim 1 , wherein the silicon-oxygen organic compound is selected from the group consisting of 3-(triethoxysilyl)propyl methacrylate (TEPM) claim 1 , 3-(trimethoxysilyl)propyl methacrylate (TMPM) claim 1 , 3-methacryloxypropylmethyldimethoxysilane claim 1 , methacryloxypropylmethyldiethoxysilane ...

DYNAMIC TEST PHANTOM SIMULATING CARDIOVASCULAR MOTION FOR QUALITY EVALUATION OF CT IMAGING, AND ITS CONTROL PRINCIPLE AND QUALITY TESTING METHOD

The invention discloses a quality testing method dynamic test phantom simulating cardiovascular motion for quality evaluation of CT imaging, and its control principle and quality testing method. The dynamic test phantom includes: a control system, an electric cylinder unit, a piston pump unit, a fluid circuit unit and a cardiovascular phantom; the control system includes a control box and a control PC, wherein the control box includes a PLC control system and an electrocardiogram generator, and the PLC control system is connected with the control PC and the electrocardiogram generator respectively; the electric cylinder unit includes an electric cylinder drive unit and an electric cylinder transmission unit, wherein the electric cylinder drive unit is connected with the PLC control system, and the electric cylinder transmission unit is connected with the electric cylinder drive unit; the piston pump unit is connected with the electric cylinder transmission unit; the fluid circuit unit includes a fluid confluence module and fluid pipelines, which are connected with the piston pump unit and the cardiovascular phantom respectively; and the cardiovascular phantom includes a ventricular phantom, coronary artery phantoms and a water tank. The dynamic test phantom according to the invention can simulate ventricular strokes and multiple motion phases, and has standard models of normal heart rate, arrhythmis, coronary artery stenosis, etc. 13611. A dynamic test phantom simulating cardiovascular motion for quality evaluation of CT imaging , comprising: a control system , an electric cylinder unit () , a piston pump unit () , a fluid circuit unit and a cardiovascular phantom () , wherein{'b': 1', '2', '1', '2, 'the control system comprises a control box () and a control PC (), wherein the control box () comprises a PLC control system and an electrocardiogram (ECG) generator, and the PLC control system is electrically connected with the control PC () and the ECG generator ...

METHOD FOR MEASURING DENSITIES BASED ON CIRCULAR MAGNETIC LEVITATION

A sample to be measured is placed in a medium solution between two circular magnets to ensure that the sample to be measured is levitated in a set circular area between the two circular magnets, and a levitation position of the sample to be measured in the magnetic field is measured. The density of the sample is calculated according to formula (I): 2. The method of claim 1 , wherein the two circular magnets have the same specification and are arranged coaxially up and down; and like poles of the two circular magnets face each other; and the medium solution is arranged between the two circular magnets.4. The method of claim 1 , wherein an outer radius of each of the two circular magnets is 20-40 mm; an inner radius of each of the two circular magnets is 10-30 mm; a height of each of the two circular magnets is 10-30 mm; a magnetic induction intensity of each of the two circular magnets is 0.08-0.2 T; and a distance between the two circular magnets is 30-50 mm.5. The method of claim 2 , wherein an outer radius of each of the two circular magnets is 20-40 mm; an inner radius of each of the two circular magnets is 10-30 mm; a height of each of the two circular magnets is 10-30 mm; a magnetic induction intensity of each of the two circular magnets is 0.08-0.2 T; and a distance between the two circular magnets is 30-50 mm.6. The method of claim 3 , wherein an outer radius of each of the two circular magnets is 20-40 mm; an inner radius of each of the two circular magnets is 10-30 mm; a height of each of the two circular magnets is 10-30 mm; a magnetic induction intensity of each of the two circular magnets is 0.08-0.2 T; and a distance between the two circular magnets is 30-50 mm.7. The method of claim 1 , wherein before preparing the medium solution claim 1 , the density and the magnetic susceptibility of the medium solution are calibrated to obtain a relationship between the density and the magnetic susceptibility of the medium solution.8. The method of claim 1 , ...

DYNAMIC BIONIC HEART PHANTOM USED FOR MAGNETIC RESONANCE IMAGING SYSTEM, CONTROL METHOD AND TESTING METHOD THEREOF

The invention discloses a dynamic bionic heart phantom used for an MRI system, a control method and a testing method. The dynamic bionic heart phantom comprises a bionic heart phantom, a control system, positive pressure devices and a negative pressure device; the bionic heart phantom comprises a water tank and a heart phantom arranged in the water tank, and the heart phantom is connected to the control system through four air pipes; the control system comprises an antimagnetic control device and a control PC, and the antimagnetic control device is composed of a measurement and control module, four proportional flow values, a power module and a magnetic shielding box; the positive pressure devices, comprising gas, gas cylinders and pressure reducing valves, are connected to two gas inlet interfaces of the control system respectively; and the negative pressure device comprises a vacuum pump and a negative pressure container. 1. A dynamic bionic heart phantom used for an MRI system , comprising a bionic heart phantom , a control system , a negative pressure device and positive pressure devices , whereinthe bionic heart phantom comprises a water tank, and a heart phantom arranged in the water tank; the heart phantom has four chambers, respectively including, a left atrium chamber, a right atrium chamber, a left ventricular chamber and a right ventricular chamber, among them, the left atrium chamber is connected to the left ventricular chamber through a one-way valve, and the right atrium chamber is connected to the right ventricular chamber through another one one-way valve;the control system comprises an antimagnetic control device and a control PC; the antimagnetic control device comprises a magnetic shielding box, a measurement and control module, four proportional flow valves, a power module, an Ai1 interface, an Ai2 interface, a Vo1 interface, a Vo2 interface, an Ai1′ interface, an Ai2′ interface, a Vo1′ interface, a J1 interface, a J2 interface and an ECG ...

KEYBOARD APPLICATION WITH THIRD PARTY ENGAGEMENT SELECTABLE ITEMS

Embodiments of the invention are directed to an embodiment of a keyboard application in which a plurality of selectable items (representing keys) are associated with transactions. The keyboard application may be imported into any application that utilizes text input, and replaces a default keyboard used to provide the text input. Upon selection of one of the plurality of selectable items, a transaction is initiated by a service provider computer. In some embodiments, the transaction may result in the engagement of a third party entity. Once completed, an access credential associated with the completion of the transaction is generated. The access credential may be entered into the text input field of the application that utilizes text input. 1. A method comprising:rendering, on a display of a user device by a processor executing a keyboard application, a first keyboard comprising a plurality of characters that are capable of being repeatedly selected to create words;receiving, by the processor of the user device, a request to change the first keyboard to a second keyboard; andrendering, on the display of the user device, by the processor executing the keyboard application, a second keyboard comprising a plurality of selectable items, wherein selection of a selectable item in the plurality of selectable items initiates a transaction.2. The method of claim 1 , wherein the selectable items are not capable of being repeatedly selected to create words.3. The method of claim 1 , wherein the transaction is conducted with a party computer:receiving an indication from the party that the transaction has been conducted; andrendering, on the display of the user device, the received indication from the party computer, wherein the received indication includes a means of accessing a resource.4. The method of claim 3 , wherein the indication received from the party is transmitted to a second user device.5. The method of claim 1 , wherein selection of each selectable item in the ...

METHOD, SYSTEM, AND ENTITY FOR EXERCISING POLICY CONTROL

A method and a system for exercising policy control, a policy and charging enforcement function (PCEF) are provided, which can solve the problem that no policy control can be exercised over application service flows without an application function (AF). In the method, a PCRF receives information about an application event sent by a PCEF after subscribing the application event from the PCEF; and the PCRF generates a control policy for a service flow of the application according to the information about the application event. In the present invention, the PCEF sends the obtained information about the application event to the PCRF, so that even when no AF is involved, the PCRF can still generate a control policy according to policy contexts including the information about the application event and the like. 1. A method for exercising policy control over an application service flow , comprising:sending, by a Policy Control and Charging Rules Function (PCRF), an application event subscription to a Policy and Charging Enforcement Function (PCEF), wherein the application event subscription comprises an identifier of an application service and an event of the application service;detecting, by the PCEF, an application event according to the application event subscription and acquiring information about the application event, wherein the information about the application event comprises the identifier of the application service and the event of the application service;sending, by the PCEF, the information about the application event to the PCRF;generating, by the PCRF, a control policy of the application service flow according to the information about the application event; anddelivering, by the PCRF, the control policy to the PCEF.2. The method according to claim 1 , wherein the method further comprises:controlling, by the PCEF, the application service flow according to the control policy.3. The method according to claim 1 , wherein the application event subscription further ...

GLASS FILLER-CONTAINING POLYCARBONATE RESIN COMPOSITION, AND MOLDED BODY THEREOF

A polycarbonate-based resin composition including: an aliphatic polycarbonate-based resin (A) containing a specific repeating unit; and a glass filler (B) having specific composition and having a total content of LiO, NaO, KO, and CsO of 5 mass % or less, wherein the refractive index of the aliphatic polycarbonate-based resin (A) for light having a wavelength of 589.3 nm is 1.480 or more and 1.520 or less, wherein the refractive index of the glass filler (B) for light having a wavelength of 589.3 nm is 1.485 or more and 1.520 or less, and wherein a difference in refractive index between the aliphatic polycarbonate-based resin (A) and the glass filler (B) is 0.003 or less for light having a wavelength of 486.1 nm, is 0.001 or less for light having a wavelength of 589.3 nm, and is 0.001 or less for light having a wavelength of 656.3 nm. 2. The polycarbonate-based resin composition according to claim 1 , wherein the aliphatic polycarbonate-based resin (A) contains 1 mol % or more and 99 mol % or less of the repeating unit (A-1).4. The polycarbonate-based resin composition according to claim 3 , wherein a ratio of the repeating unit represented by the general formula (a-3) to the repeating unit (A-1) is 40 mol % or more.5. The polycarbonate-based resin composition according to claim 1 , wherein a total content of the silicon dioxide (SiO) and the aluminum oxide (AlO) in the glass filler (B) is 67.5 mass % or more and 77.5 mass % or less with respect to an entirety of the glass filler.6. The polycarbonate-based resin composition according to claim 1 , wherein the glass filler (B) comprises at least one kind selected from the group consisting of glass fibers claim 1 , glass powder claim 1 , a glass flake claim 1 , milled fibers claim 1 , a glass cloth claim 1 , and glass beads.7. The polycarbonate-based resin composition according to claim 1 , wherein the glass filler (B) has an Abbe number (v) of 52.5 or more and 62.5 or less.8. The polycarbonate-based resin composition ...

MASS SPECTROMETRY SYSTEM AND WORKING METHOD AND APPLICATION THEREOF, AND SAMPLING DEVICE

A mass spectrometry system and a working method and an application thereof, and a sampling device. The mass spectrometry system includes an ion source, a sampling device and a mass spectrometer. The sampling device includes: a guide rail; a support adapted to move on the guide rail; a bearing member made from a hydrophobic material with two ends being fixed to the support; a plurality of containers for containing samples arranged on the support; a plurality of transport members made from a hydrophilic material and including a first portion provided on the bearing member and a second portion connected to the first portion and extending into each container; adjacent transport members being not in contact; and a drive module configured to drive the support to move on the guide rail such that a central axis of an exit port of the ion source passes through the first portion. 1. A mass spectrometry system , comprising an ion source , a sampling device and a mass spectrometer;wherein the sampling device comprises:a guide rail;a support adapted to move on the guide rail;a bearing member made from a hydrophobic material; wherein two ends of bearing member are fixed to the support;a plurality of containers for containing samples arranged on the support;a plurality of transport members made from a hydrophilic material; wherein each of the transport members comprises a first portion provided on the bearing member and a second portion connected to the first portion and extending into each of the plurality of containers; and adjacent transport members are not in contact; anda drive module configured to drive the support to move on the guide rail such that a central axis of an exit port of the ion source passes through the first portion.2. The mass spectrometry system according to claim 1 , wherein the guide rail and the bearing member are horizontally provided claim 1 , and the plurality of transport members are vertically provided in a arrangement along a direction parallel to ...

MAGNETIC CONNECTOR ASSEMBLY

An electrical connector includes an insulative seat, a plurality of terminals fixed to the insulative seat and at least one magnetic element retained in the insulative seat. The insulative seat defines a vertical first mating surface and a mating portion extending forwardly from the first mating surface, the mating portion defines an inclined second mating surface. Each terminal defines a contacting portion disposed in the mating portion and a soldering portion extending outside of the insulative seat. The mating portion defines a shallow recess recessed from the second mating surface, and the contacting portion defines a free end exposed on the shallow recess and locating behind the second mating surface. 1. An electrical connector , comprising:an insulative seat defining a vertical first mating surface and a mating portion extending forwardly from the first mating surface, the mating portion defining an inclined second mating surface;a plurality of terminals fixed to the insulative seat and each defining a contacting portion disposed in the mating portion and a soldering portion extending outside of the insulative seat; andat least one magnetic element retained in the insulative seat; whereinthe mating portion defines a shallow recess recessed backwardly from the second mating surface, and the contacting portion defines a free end exposed in the shallow recess and locating behind the second mating surface.2. The electrical connector as described in claim 1 , wherein the shallow recess of the mating portion defines a vertical third mating surface claim 1 , the insulative seat defines a plurality of the terminal slots running through the third mating surface for receiving the terminals claim 1 , the rear portion of each terminal slot is semicircular shape to form a semicircular terminal slot claim 1 , and the soldering portion of the terminal is slat shape to be received in the semicircular terminal slot.3. The electrical connector as described in claim 1 , wherein ...

ILLUSTRATION TO CONDUCT AN EXPEDITED ELECTRONIC TRANSACTION

A method to display an illustration to conduct an expedited electronic transaction is provided. Consumer identification information identifying a consumer is received. The consumer identification information is stored in association with a web browser of a consumer's device. A customized illustration is displayed based on the received consumer identification information on the consumer's device. A request is received for the expedited electronic transaction by swiping the customized illustration across a portion of the display of the consumer's device. Transaction data sufficient to complete the electronic transaction is sent to the merchant based on the swipe of the customized illustration across display of the consumer's device. 1. A processor executed method to conduct an expedited electronic transaction , the method comprising:receiving consumer identification information identifying a consumer at a processor, wherein the consumer identification information is stored in association with a web browser of a device of a consumer;displaying, via the processor, a customized illustration based on the received consumer identification information, wherein the customized illustration is characterized as being a component of a checkout activation button displayed on a portion of the display of the device of the consumer;receiving, via the processor, a request for an expedited electronic transaction by activating the customized illustration; activation button;displaying, via the processor, an indicator for entry of a password in the entry portion; andreceiving, via the processor, password information from the consumer in the entry portion.2. The method of claim 1 , wherein the consumer identification information is stored as a cookie of the web browser.3. The method of claim 2 , wherein the consumer identification information is identified based on a status of the cookie.4. The method of claim 3 , wherein the status of the cookie is an active status and the customized ...

ULTRA-HIGH TOUGHNESS AND HIGH STRENGTH DRILL PIPE AND MANUFACTURING PROCESS THEREOF

The invention discloses a drill pipe having ultra-high toughness and high strength and comprising the following chemical elements in mass percentage: C: 0.24-0.30%, Si: 0.1-0.5%, Mn: 0.7-1.5%, Cr: 0.7-1.5%, Mo: 0.5-0.75%, V: 0.01-0.10%, Nb: 0.01-0.05%, P≦0.015% , S≦0.005%, and the balance of Fe and unavoidable impurities; and a process of manufacturing the drill pipe having ultra-high toughness and high strength, comprising: heating the drill pipe as a whole to 900-950° C.; subjecting the inner surface of the drill pipe to axial-flow water-spray cooling and the outer surface of the drill pipe to laminar-flow water-spray cooling while controlling the amount of the water sprayed at thickened ends of the drill pipe and that along the pipe body to be different from each other; and controlling the tempering temperature to be 650-675° C. The inventive drill pipe having ultra-high toughness and high strength has a longitudinal full-size impact toughness at −20° C. of at least 100 J and has a strength of 135 ksi. 1. A drill pipe having ultra-high toughness and high strength , and comprising the following chemical elements in mass percentage:C: 0.24-0.30%, Si: 0.1-0.5%, Mn: 0.7-1.5%, Cr: 0.7-1.5%, Mo: 0.5-0.75%, V: 0.01-0.10%, Nb: 0.01-0.05%, P<0.015%, S<0.005%, and the balance of Fe and unavoidable impurities.2. The drill pipe having ultra-high toughness and high strength according to claim 1 , wherein the mass percentages of the chemical elements are:C: 0.25-0.29%, Si : 0.24-0.38%, Mn : 0.92-1.17%, Cr : 0.95-1.22%, Mo : 0.6-0.75%, V : 0.05-0.09%, Nb : 0.02-0.04%, P<0.015%, S<0.005%, and the balance of Fe and unavoidable impurities.3. The drill pipe having ultra-high toughness and high strength according to claim 1 , wherein the mass percentages of the chemical elements are:C: 0.26-0.28%, Si: 0.27-0.36%, Mn: 0.70-1.17%, Cr: 0.95-1.22%, Mo: 0.61-0.72%, V: 0.05-0.08%, Nb: 0.02-0.04%, P<0.015%, S<0.005%, and the balance of Fe and unavoidable impurities.4. The drill pipe having ...

METHOD FOR ESTABLISHING CLASSIC BLUETOOTH CONNECTION BETWEEN DUAL-MODE BLUETOOTH DEVICES, AND DUAL-MODE BLUETOOTH DEVICE

Methods and devices are provided for establishing a classic Bluetooth connection between dual-mode Bluetooth devices. In one aspect, a method includes receiving, by a first dual-mode Bluetooth device, a Bluetooth low energy advertising packet sent by a second dual-mode Bluetooth device; determining, by the first dual-mode Bluetooth device, a status of the classic Bluetooth of the second dual-mode Bluetooth device according to the Bluetooth low energy advertising packet; and prompting, by the first dual-mode Bluetooth device according to the status of the classic Bluetooth of the second dual-mode Bluetooth device, a user to operate the first dual-mode Bluetooth device or the second dual-mode Bluetooth device to establish a classic Bluetooth connection between the first dual-mode Bluetooth device and the second dual-mode Bluetooth device. 1. A method for establishing a classic Bluetooth connection between dual-mode Bluetooth devices , comprising:receiving, by a first dual-mode Bluetooth device, a Bluetooth low energy advertising packet sent by a second dual-mode Bluetooth device;determining, by the first dual-mode Bluetooth device, a status of the classic Bluetooth of the second dual-mode Bluetooth device according to the Bluetooth low energy advertising packet; andprompting, by the first dual-mode Bluetooth device according to the status of the classic Bluetooth of the second dual-mode Bluetooth device, a user to operate the first dual-mode Bluetooth device or the second dual-mode Bluetooth device to establish a classic Bluetooth connection between the first dual-mode Bluetooth device and the second dual-mode Bluetooth device.2. The method according to claim 1 , wherein the status of the classic Bluetooth of the second dual-mode Bluetooth device comprises at least one of:a searchable status of the classic Bluetooth of the second dual-mode Bluetooth device;a connectable status of the classic Bluetooth of the second dual-mode Bluetooth device; ora status of a ...

Method and system for parking-site arrangement and reservation

A method for reserving a parking space may include steps of a user sending out a parking space reservation request to a remote control center through a communication network; the remote control center receiving and processing the parking space reservation request; the remote control center sending at least one graphical user interface (GUI) associated with at least one parking facility for the user to reserve a parking space; the user selecting a parking space from the GUI; and the remote control center reserving the parking space for the user by lifting a parking barrier thereon. The method for reserving a parking space may further include a step of the remote control center sending out a password to the user to restore the lifted parking barrier to the ground, so the user can park his/her vehicle into the reserved parking space.

AN ULTRASONIC METHOD AND DEVICE FOR INDIRECTLY MEASURING CAVITY PRESSURE OF INJECTION MOLDING MACHINE

The present invention discloses a ultrasonic method for indirectly measuring a pressure of a cavity of an injection molding machine, comprising: emitting ultrasonic wave to each pull rod along an axial direction of the pull rod respectively at the same time, detecting an ultrasonic wave echo time difference of each pull rod, and obtaining an average pressure inside a cavity of the injection molding machine. By the detection method and detection device of the present invention, the pressure inside the cavity may be detected in a certain state, the pressure inside the cavity in the injection molding process may be detected in real time, and the detection process is simple and the accuracy is high. 1. A ultrasonic method for indirectly measuring a pressure of a cavity of an injection molding machine , comprising: emitting ultrasonic wave to each pull rod along an axial direction of the pull rod respectively at the same time , detecting a time difference between an ultrasonic wave echo on each pull rod in an injection molding process and an ultrasonic wave echo when the pull rod is free , and obtaining an average pressure P inside the cavity of the injection molding machine according to the following formula:{'br': None, 'i': P=πR', '·W·Δt', '/A, 'sup': '2', 'sub': 'total'}{'sub': 'total', 'wherein R is the section radius of the pull rod; Δtis the sum of echo time differences of all the pull rods; W is a constant related to the material of the pull rod; and A is the projection area of the cavity on a plane perpendicular to the axial direction of the pull rod;'}wherein there are four pull rods; wherein an ultrasonic probe is arranged at the tail end of each pull rod;wherein the W may be acquired by the following method: before detection, for the pull rod with the same material, conducting detection by a mold locking force sensor under different mold locking forces to acquire multiple groups of σ-Δtdata, and fitting a straight line passing through the origin of σ-Δtdata, ...

SUPERHIGH TORSIONAL STRENGTH, METALLIC AND AIRTIGHT DRILLROD COUPLER

The present invention discloses a superhigh torsional strength, metallic and airtight drillrod coupler, which comprises: an externally threaded coupler, which has a radially outward outer shoulder at an end thereof in an axial direction and an inner end face at the other end thereof in the axial direction, with an externally threaded section and a first sealing face being provided in sequence in the axial direction of the externally threaded coupler from the outer shoulder to the inner end face; and an internally threaded coupler to be threadedly connected to said externally threaded coupler, the internally threaded coupler having a radially inward inner shoulder at an end thereof in an axial direction and an outer end face at the other end thereof in the axial direction, with a second sealing face and an internally threaded section to be engaged with the externally threaded section being provided in sequence in the axial direction of the internally threaded coupler from the inner shoulder to the outer end face; wherein said inner end face mates with a shoulder face of the inner shoulder, and the outer end face mates with a shoulder face of the outer shoulder; and the first sealing face and the second sealing face are both sloped faces, and are in an interference-fit sealed connection with each other. The drillrod coupler has a relatively high torsional strength, good airtight sealing performance, and good performance in terms of repeated threaded connection and disconnection. 1. a superhigh torsional strength , metallic and airtight drillrod coupler , comprising:an externally threaded coupler, which has a radially outward outer shoulder at an end thereof in an axial direction and an inner end face at the other end thereof in the axial direction, with an externally threaded section and a first sealing face being provided in sequence in the axial direction of the externally threaded coupler from the outer shoulder to the inner end face; andan internally threaded ...

DEVICE CONTROL METHOD AND DEVICE

This application relates to the field of communications technologies, and provides a device control method and a device, so that efficiency of controlling a wireless device to disable or enable a wireless transmit capability of the wireless device or to be powered off can be improved. One solution includes at least: establishing, by a first device, a wireless short-range communication connection to a second device, and sending, by the first device, a first control command to the second device through the wireless short-range communication connection. The first control command is used to instruct the second device to perform a control action, the control action includes disabling a wireless communication capability, enabling a wireless communication capability, powering on, or powering off, and the wireless communication capability includes a wireless transmit capability, or the wireless communication capability includes a wireless transmit capability and a wireless receive capability. 134-. (canceled)35. A device control method , comprising:establishing, by a first device, a wireless short-range communication connection to a second device;sending, by the first device, a first control command to the second device through the wireless short-range communication connection, wherein the first control command is used to instruct the second device to perform a control action; and displaying, by the first device, a first interface in response to a first input of a user, wherein the first interface comprises a device connection window, and the device connection window comprises an identifier of a device that has the wireless short-range communication connection to the first device; and', 'displaying, by the first device, a second interface in response to a second input of the user, wherein the second interface comprises a selection window, the selection window is used to set indication information in the first control command, and the indication information is used to ...

CIRCUIT AND METHOD FOR PREVENTING SCREEN FLICKERING, DRIVE CIRCUIT FOR DISPLAY PANEL, AND DISPLAY APPARATUS

Circuit and method for preventing screen flickering, a drive circuit for a display panel, and a display apparatus are provided, relating to the field of display technology. The circuit for preventing screen flickering includes a control sub-circuit configured to control a gate drive circuit of the display panel to output a gate cut-off level during a power-on period of the display panel. The gate drive circuit of the display panel is controlled to output the gate cut-off level during the power-on period, the gate cut-off level is provided to gate lines of the display panel such that TFTs connected to the gate lines are in cut-off state during the power-on period. 1. A circuit for preventing screen flickering , which is applicable to a drive circuit for a display panel , the drive circuit comprising a gate drive circuit , wherein the circuit for preventing screen flickering comprises:a control sub-circuit configured to control the gate drive circuit to output a gate cut-off level during a power-on period of the display panel.2. The circuit for preventing screen flickering according to claim 1 , wherein the gate drive circuit comprises a noise reduction module which is configured to pull an output level of the gate drive circuit to the gate cut-off level when a noise reduction voltage signal received by the noise reduction module is a turn-on level; andwherein the control sub-circuit is configured to control the noise reduction voltage signal outputted to the noise reduction module to be the turn-on level during the power-on period.3. The circuit for preventing screen flickering according to claim 2 , wherein the control sub-circuit is configured to output an external input voltage signal of the drive circuit as the noise reduction voltage signal to the noise reduction module during the power-on period.4. The circuit for preventing screen flickering according to claim 1 , wherein the gate drive circuit comprises a first noise reduction module and a second noise ...

METHOD FOR OBSERVING WILDLIFE POPULATION SIZE THROUGH REMOTE SENSING IMAGERY

The present invention relates to the field of wildlife protection, and particularly relates to a method for observing wildlife population size through a remote sensing imagery. The method specifically comprises: a proportion of orthogonal projection area of animals in each pixel to pixel area is computed and summed through a linear correlation between a gray value of a remote sensing imagery pixel and a proportion of the orthogonal projection area of individual animals to the pixel area, to obtain the total orthogonal projection area of target animal population; and population size is obtained on the basis of dividing by the orthogonal projection area of animals of measured individual animals, thereby solving the problem that it is difficult to observe the wildlife population size and a distribution pattern at the same time point. In the present invention, a satellite remote sensing imagery is used to observe the animal population to obtain the population size at the same time point, thereby avoiding errors caused by the pasting counting, estimation and other methods and increasing investigation accuracy and reliability. In the present invention, the remote sensing imagery is used to observe the animal population, thereby avoiding disturbance to animal behaviors and destruction to habitats of the wildlife due to short-distance observation of the wildlife, greatly enhancing safety and economy of field observation and realizing higher application value. 1. A method for observing wildlife population size through a remote sensing imagery , comprising: computing a proportion of orthogonal projection area of animals in each pixel to pixel area and summing the proportions through a linear correlation between a gray value of a remote sensing imagery pixel and a proportion of the orthogonal projection area of individual animals to the pixel area , to obtain the total orthogonal projection area of target animal population; and obtaining population size on the basis of ...

Method And Apparatus For Displaying Recommendation Result

A method for displaying a recommendation result and an apparatus for displaying a recommendation result are provided. The method includes: receiving a query; obtaining a mapping knowledge graph containing the query; and displaying the mapping knowledge graph in a preset recommendation area of a search result page. The method can display more sufficient and accurate recommended content, so as to improve the user experience. 1. A method for displaying a recommendation result , comprising:receiving a query;obtaining a mapping knowledge graph containing the query; anddisplaying the mapping knowledge graph in a preset recommendation area of a search result page.2. The method according to claim 1 , wherein the mapping knowledge graph is composed of nodes and a line connecting two nodes claim 1 , and an entity corresponding to a central node of the mapping knowledge graph is the query.3. The method according to claim 2 , further comprising:displaying details of the mapping knowledge graph when clicking the central node of the mapping knowledge graph.4. The method according to claim 2 , further comprising:restarting search with an entity corresponding to a non-central node as a new query when clicking the non-central node of the mapping knowledge graph.5. The method according to claim 1 , wherein the mapping knowledge graph is composed of nodes and a line connecting two nodes claim 1 , and the method further comprises:generating a new query according to entities corresponding to nodes at two ends of the line and restarting search according to the new query when clicking the line of the mapping knowledge graph; ordisplaying relationship between entities corresponding to nodes at two ends of the line when selecting the line of the mapping knowledge graph; ordisplaying other information of an entity corresponding to the node when selecting the node of the mapping knowledge graph.6. The method according to claim 5 , wherein generating a new query according to entities ...

A FUSION PROTEIN FOR TARGETED THERAPY OF AUTOIMMUNE DISEASE

Disclosed herein, are fusion proteins comprising a targeting moiety, a plasma protein binding domain, and a toxin or biological variant thereof. Also described herein, are methods of administering the fusion proteins to patients with an autoimmune disease. 1. A fusion protein comprising a targeting moiety , a plasma protein binding domain , and a toxin or biological variant thereof.2Pseudomonas. The fusion protein of claim 1 , wherein the targeting moiety is a single chain variable fragment (scFv) of an anti-PD-1 antibody or an anti-CTLA antibody claim 1 , the plasma protein binding domain is an albumin-binding protein domain and the toxin is a exotoxin or a biological variant thereof.3Pseudomonas. The fusion protein of claim 2 , wherein the fusion protein comprises claim 2 , from the N-terminus to the C-terminus claim 2 , a single chain variable fragment (scFv) of an anti-PD-1 antibody claim 2 , a peptide linker claim 2 , an albumin-binding protein domain claim 2 , a second peptide linker claim 2 , and a exotoxin or biological variant thereof.4Pseudomonas. The fusion protein of claim 3 , wherein the exotoxin or biological variant thereof comprises SEQ ID NO: 5.5. (canceled)6. (canceled)7. (canceled)8. (canceled)9. (canceled)10. (canceled)11. (canceled)12. (canceled)13. (canceled)14. The fusion protein of claim 2 , wherein the anti-PD-1 antibody is nivolumab claim 2 , pembrolizumab claim 2 , pidilizumab claim 2 , BMS-936559 claim 2 , MEDI0680 claim 2 , clone J116 or a biologically active variant thereof.15. (canceled)16. (canceled)17. (canceled)18. (canceled)19. (canceled)20. (canceled)21. (canceled)22. (canceled)23. The fusion protein of claim 2 , wherein the targeting moiety is an anti-CTLA antibody claim 2 , wherein the anti-CTLA-antibody is ipilimumab claim 2 , tremelimumab claim 2 , UC10-4F10 clone or a biologically active variant thereof.24. (canceled)25. (canceled)26. (canceled)27. (canceled)28. (canceled)29. (canceled)30. (canceled)31. The fusion protein of ...

Solid-state polymer lithium battery pack and preparation method thereof

A solid-state polymer lithium battery pack and a preparation method therefor are provided. The lithium battery pack includes: single batteries (), connecting sleeve members (), electric cables (), a battery box () and a pouring sealant, and has functions of power supply, power storage and multiple charging/discharging. The preparation method includes: connecting a plurality of single batteries in series by means of connecting sleeve members () to form combined batteries; connecting a plurality of combined batteries in series to form a lithium battery pack; and finally, assembling the lithium battery pack into a battery box (), filling a pouring sealant inside the battery box by means of a sealant pouring process for fixing the single batteries () and internal electric cables (), and discharging air in the battery box (), so that a final solid-state polymer lithium battery pack is obtained. 11234. A solid-state polymer lithium battery pack , comprising: single batteries () , connecting sleeve members () , electric cables () , a battery box () and pouring sealant;{'b': '1', 'wherein the single batteries () are high-specific-power solid-state polymer lithium-ion batteries composed of a lithium cobalt oxide positive electrode, a graphite negative electrode, a polymer separator, an aluminum alloy positive tab, a nickel-copper alloy negative tab and an Al compound packing film;'}{'b': 1', '2', '6, 'a plurality of the single batteries () are connected in series by a screw connection manner with the connecting sleeve members () to form assembled batteries ();'}{'b': 6', '7, 'a plurality of the assembled batteries () are connected in series to form a lithium battery pack ();'}{'b': 7', '4', '4', '1', '3', '4, 'and finally the lithium battery pack () is put into the battery box () made of a composite material, a potting process is utilized to fill the battery box () with sealant having good insulation and thermal conductivity, so as to fix the single batteries () and the ...

BLUETOOTH CONNECTION METHOD AND TERMINAL

Embodiments of the present invention provide a Bluetooth connection method, including: sending, by a first terminal, a Bluetooth low energy BLE advertising message, where the BLE advertising message includes device information; receiving, by a second terminal, the BLE advertising message; obtaining, by the second terminal, the device information; matching, by the second terminal, the device information with prestored device information; if the device information successfully matches the prestored device information, initiating, by the second terminal, a classic Bluetooth connection request to the first terminal; and establishing, by the first terminal, a classic Bluetooth connection to the second terminal. Power consumption of BLE is low. 130-. (canceled)31. A Bluetooth connection method , comprising:after a classic Bluetooth connection between a first terminal and a second terminal is released, sending, by the first terminal, a BLE advertising message, wherein both the first terminal and the second terminal support Bluetooth low energy (BLE) and classic Bluetooth, and the BLE advertising message comprises device information;receiving, by the second terminal, the BLE advertising message, and obtaining the device information;matching, by the second terminal, the device information with prestored device information;if the device information obtained by the second terminal successfully matches the prestored device information, initiating, by the second terminal, a classic Bluetooth connection request to the first terminal; andestablishing, by the first terminal, a classic Bluetooth connection to the second terminal.32. The method according to claim 31 , wherein before the initiating claim 31 , by the second terminal claim 31 , a classic Bluetooth connection request to the first terminal claim 31 , the method further comprises:measuring, by the second terminal, signal strength of the BLE advertising message, and determining that the measured signal strength is greater ...

LITHIUM METAL ELECTRODE, METHOD FOR PREPARING THE SAME, AND LITHIUM RECHARGEABLE BATTERY USING THE SAME

A lithium metal electrode includes a lithium metal plate and a protective layer coated on a surface of the lithium metal plate. The protective layer includes an organic-inorganic hybrid polymer comprising a repeating unit. The repeating unit includes a silicon atom, a methacryloyloxy group or an acryloyloxy group, and at least two alkoxy groups. The alkoxy groups and the methacryloyloxy group or the acryloyloxy group are respectively joined to the silicon atom. A method for preparing the lithium metal electrode and a lithium ion battery is also disclosed. 1. A lithium metal electrode comprising:a lithium metal plate; anda protective layer coated on a surface of the lithium metal plate,wherein the protective layer comprises an organic-inorganic hybrid polymer comprising a repeating unit, the repeating unit comprises a silicon atom, a methacryloyloxy group or an acryloyloxy group, and at least two alkoxy groups, the alkoxy groups and the methacryloyloxy group or the acryloyloxy group are respectively joined to the silicon atom.2. The lithium metal electrode of claim 1 , wherein an amount of the repeating unit in the organic-inorganic hybrid polymer is in a range from about 40 to about 5000.3. The lithium metal electrode of claim 1 , wherein the organic-inorganic hybrid polymer is selected from the group consisting of poly-γ-(triethoxysilyl)propyl methacrylate claim 1 , poly-γ-(trimethoxysilyl)propyl methacrylate claim 1 , poly-γ-methacryloxypropylmethyldimethoxysilane claim 1 , poly-(diethoxymethylsilyl)propyl methacrylate claim 1 , poly-γ-acryloxypropyltriethoxysilane claim 1 , poly-γ-acryloxypropyltrimethoxysilane claim 1 , poly-γ-acryloxypropylmethyldimethoxysilane claim 1 , poly-acryloxypropylmethyldiethoxysilane claim 1 , poly-acryloxypropylmethyldimethoxysilane claim 1 , and combinations thereof.4. The lithium metal electrode of claim 1 , wherein the organic-inorganic hybrid polymer is a polymerization product of a silicon-oxygen organic monomer claim 1 , and ...

COMPOSITE BINDER, CATHODE ELECTRODE OF LITHIUM RECHARGEABLE BATTERY USING THE SAME AND METHOD FOR MAKING THE SAME

A composite binder includes an organic-inorganic hybrid polymer and a fluorinated binder uniformly mixed with each other. A repeating unit of the organic-inorganic hybrid polymer includes a silicon atom, a methacryloyloxy group, or an acryloyloxy group, and at least two alkoxy groups. The alkoxy groups and the methacryloyloxy group or the acryloyloxy group are respectively joined to the silicon atom. A method for making a cathode electrode and the cathode electrode are also disclosed. 1. A composite binder comprising:an organic-inorganic hybrid polymer, a repeating unit of the organic-inorganic hybrid polymer comprising a silicon atom, a methacryloyloxy group or an acryloyloxy group, and at least two alkoxy groups, the at least two alkoxy groups and the methacryloyloxy group or the acryloyloxy group are respectively joined to the silicon atom; anda fluorinated binder uniformly mixed with each other.2. The composite binder of claim 1 , wherein a number of the repeating units in the organic-inorganic hybrid polymer is in a range from about 40 to about 5000.3. The composite binder of claim 1 , wherein the organic-inorganic hybrid polymer is selected from the group consisting of poly-γ-(triethoxysilyl)propyl methacrylate claim 1 , poly-γ-(trimethoxysilyl)propyl methacrylate claim 1 , poly-γ-methacryloxypropylmethyldimethoxysilane claim 1 , poly-(diethoxymethylsilyl)propyl methacrylate claim 1 , poly-γ-acryloxypropyltriethoxysilane claim 1 , poly-γ-acryloxypropyltrimethoxysilane claim 1 , poly-γ-acryloxypropylmethyldimethoxysilane claim 1 , poly-acryloxypropylmethyldiethoxysilane claim 1 , poly-acryloxypropylmethyldimethoxysilane claim 1 , and combinations thereof.4. The composite binder of claim 1 , wherein the fluorinated binder is selected from the group consisting of polyvinylidene fluoride claim 1 , hexafluoropropylene claim 1 , tetrafluoroethylene claim 1 , trichlorofluoroethylene claim 1 , and combinations thereof.5. The composite binder of claim 1 , wherein a ...

Polymer expanding material used in infiltration or seepage watery environment and preparation method thereof

The present invention relates to a polymer expanding material in infiltration or seepage multi-water environment and a preparation method thereof, belonging to a technical field of polymer expanding foam materials. The polymer expanding material includes the following parts of materials by weight: 20-30 parts of rosin polyester polyol, 20-50 parts of isocyanate, 20-40 parts of PhireGuard® MB-512, 5-10 parts of HFO-1233zd, 1-2 parts of surfactant, 0.01-1 part of catalyst, and 0.01 parts of benzoyl chloride. The present invention has high sand fixing body strength, fast curing speed, good elastoplasticity, good pouring property and permeability, and good expanding property, which is suitable for infiltration or seepage multi-water environment, especially for dam infiltration, piping, and other problems during construction and subsequent operation of water conservancy projects. 1. A polymer expanding material used in infiltration or seepage watery environment comprising the following materials by weight:20-30 parts of rosin polyester polyol, 20-50 parts of isocyanate, 20-40 parts of PhireGuard® MB-512, 5-10 parts of HFO-1233zd, 1-2 parts of surfactant, 0.01-1 part of catalyst, and 0.01 parts of benzoyl chloride.2. The polymer expanding material claim 1 , as recited in claim 1 , wherein the isocyanate is any one or a combination of two of polymethylene polyphenyl isocyanate claim 1 , diphenylmethane diisocyanate claim 1 , and toluene diisocyanate; the surfactant is sorbitan monooleate; or the surfactant is EMALEX® SPO-100; the catalyst is 4 claim 1 ,4′-(oxydi-2 claim 1 ,1-ethanediyl)bismorpholine.3. A preparation method of a polymer expanding material in infiltration or seepage watery environment claim 1 , comprising steps of:1) adding 20-30 parts of rosin polyester polyol, 20-50 parts of isocyanate, 20-40 parts of PhireGuard® MB-512 and 1-2 parts of surfactant into a reaction kettle, and stirring mixtures well;2) replacing air in the reaction kettle with nitrogen gas;3 ...

Composite slotting equipment combined static pressure and vibration of polymer anti-seepage wall and using method thereof

A pressing-pulling device, a polymer anti-seepage wall static pressure vibration composite slotting equipment and a using method include: a pressing-pulling bracket, wherein slotting oil cylinders are symmetrically and vertically mounted on the pressing-pulling bracket, and a piston rod of each of the slotting oil cylinders faces downwardly, a bottom end of the piston rod is connected to a connecting plate, and a through-hole is provided in a middle of the connecting plate; a continuous lifting mechanism is installed in a middle of the pressing-pulling bracket, and a slotting rod is vertically inserted into the continuous lifting mechanism; a lifting ring is installed at a top end of the slotting rod; a bottom end of the slotting rod extends downwardly through the through-hole to connect to a slotting cutter; a locking device is fixed on the connecting plate near the through-hole for fixing the slotting rod. 126232325926896881924258. A pressing-pulling device , comprising: a pressing-pulling bracket () , on which slotting oil cylinders () are symmetrically and vertically installed; wherein a piston rod of the slotting oil cylinders () faces down; a bottom end of the piston rod is connected to a connecting plate () with a through-hole in a center; a continuous lifting mechanism () is installed in a middle of the pressing-pulling bracket () , and a slotting rod () is vertically inserted into the continuous lifting mechanism (); a lifting ring () is installed at a top end of the slotting rod (); a bottom end of the slotting rod () extends down through the through-hole to connect to a slotting cutter (); a locking device () is fixed on the connecting plate () near the through-hole for fixing the slotting rod ().2248258. The pressing-pulling device claim 1 , as recited in claim 1 , wherein the locking device () is an annular locking iron ring and is made of two half rings a left half iron ring and a right half iron ring; both of the two half rings are installed in the ...

Thin-slotting lifting synchronous grouting device and its usage method

A thin-slotting lifting synchronous grouting device and its usage method are provided, The device includes a hollow force-bearing column through which a feeding pipe passes; wherein: left and right cutting plates are respectively fixedly arranged on each side of the hollow force-bearing column; a left connecting plate is fixedly arranged on an outside of the left cutting plate; a right guiding column is fixedly arranged on an outside of the right cutting plate; center lines of the left connecting plate, the right guiding column and the hollow force-bearing column are in a same plane; a top end of to the feeding pipe is connected to a grouting device, and a bottom end is connected to a spraying device; a spraying nozzle of the spraying device stretches out along the hollow force-bearing column; and a lower end of the hollow force-bearing column is connected with a disposable conical head.