Compositions and Methods for Treating Aging and Age-Related Diseases and Symptoms
This application claims the benefit of U.S. 61/939,092, filed Feb. 12, 2014, and U.S. 61/955,463, filed Mar. 19, 2014, which are herein incorporated by reference in their entirety. This invention was made with Government support under CA124974 and CA149774, awarded by the National Institutes of Health. The Government has certain rights in the invention. The content of the ASCII text file of the sequence listing named “20150211_034044_100WO1_seq_ST25” which is 1.74 kb in size was created on Feb. 8, 2015, and electronically submitted via EFS-Web herewith the application is incorporated herein by reference in its entirety. The present invention relates to treating aging and age-related diseases. Metabolism and aging are intimately linked. Compared to ad libitum feeding, dietary restriction (DR) or calorie restriction (CR) consistently extends lifespan and delays age-related diseases in evolutionarily diverse organisms. Similar conditions of nutrient limitation and genetic or pharmacological perturbations of nutrient or energy metabolism also have longevity benefits. Several compounds that modulate aging with largely undefined molecular mechanisms have been identified. However, a need still exists for treatments for age-related diseases including cancer, diabetes, and cardiovascular disease, and extending the lifespans of subjects. In some embodiments, the present invention is directed to a method for inhibiting, reducing, slowing, or preventing, the aging of a subject which comprises administering to the subject one or more compounds that bind the beta subunit of the catalytic core of an ATP synthase, e.g., ATP5B, in the subject. In some embodiments, the present invention is directed to a method for inhibiting, reducing, slowing, or preventing, the aging of a subject which comprises administering to the subject one or more compounds that inhibit or reduces the activity of an ATP synthase in the subject. In some embodiments, the present invention is directed to a method for treating, inhibiting, reducing, or preventing an age-related disease in a subject which comprises administering to the subject one or more compounds that bind the beta subunit of the catalytic core of an ATP synthase, e.g., ATP5B, in the subject and/or inhibits or reduces the activity of the ATP synthase in the subject. In some embodiments, the present invention is directed to a method for inhibiting, reducing, slowing, or preventing, the aging of a subject which comprises administering to the subject one or more glutarate compound, one or more glutamate compounds, or both. In some embodiments, the present invention is directed to a method for increasing the lifespan of a subject which comprises administering to the subject one or more compounds that bind the beta subunit of the catalytic core of an ATP synthase, e.g., ATP5B, in the subject and/or inhibits or reduces the activity of the ATP synthase in the subject. In some embodiments, the lifespan of the subject is extended by up to about 60% or up to about 70% as compared to untreated subjects. In some embodiments, the subject is an animal, which may or may not be an animal model of aging or an age-related disease. In some embodiments, the subject is a nematode, a rodent, or a non-human primate. In some embodiments, the subject is a human. In some embodiments, the ATP synthase is mammalian ATP synthase, human ATP synthase, mammalian mitochondrial ATP synthase, or human mitochondrial ATP synthase. In some embodiments, the compound administered to the subject is a glutarate compound or a glutamate compound. In some embodiments, at least one glutarate compound and at least one glutamate compound are administered to the subject. In some embodiments, the compound administered to the subject is an alpha-ketoglutarate (α-KG) compound. In some embodiments, the compound administered to the subject is a 2-hydroxyglutarate (2-HG) compound. In some embodiments, at least one α-KG compound and at least one 2-HG compound are administered to the subject. In some embodiments, the one or more compounds are administered in an effective amount or a therapeutically effective amount. In some embodiments, the effective amount or the therapeutically effective amount of the one or more compounds is administered as several doses over a given period of time, e.g., a daily dose for a week or more. In some embodiments, the amount of the one or more compounds administered to the subject increases the α-ketoglutarate levels in the subject by about 30-60%, preferably about 45-55%, more preferably about 50%. In some embodiments, the compound is administered as a daily dose of about 0.25-2, preferably about 0.5-2, more preferably about 1-2, most preferably about 2, grams per kilogram weight of the subject per day. In some embodiments, the subject is an animal, which may or may not be an animal model of aging or an age-related disease. In some embodiments, the subject is a nematode, a rodent, or a non-human primate. In some embodiments, the subject is a human. In some embodiments, the ATP synthase is mammalian ATP synthase, human ATP synthase, mammalian mitochondrial ATP synthase, or human mitochondrial ATP synthase. In some embodiments, the present invention provides use of at least one compound that binds the beta subunit of the catalytic core of an ATP synthase or inhibits or reduces the activity of an ATP synthase for the manufacture of a medicament for (a) inhibiting, reducing, slowing, or preventing, the aging of a subject, (b) for treating, inhibiting, reducing, or preventing an age-related disease in the subject, and/or (c) for increasing the lifespan of the subject. In some embodiments, the present invention provides a glutarate compound or a glutamate compound for use in inhibiting, reducing, slowing, or preventing the aging of a subject; treating, inhibiting, reducing, or preventing an age-related disease in the subject; and/or increasing the lifespan of the subject. In some embodiments, the compound is a glutarate compound or a glutamate compound. In some embodiments, the compound is a glutarate compound and a glutamate compound. In some embodiments, the compound is an α-KG compound. In some embodiments, the compound is a 2-HG compound. In some embodiments, the compound is an α-KG compound and a 2-HG compound. In some embodiments, the compound is provided in an effective amount or a therapeutically effective amount. In some embodiments, the medicament is provided as divided doses. In some embodiments, the effective amount or the therapeutically effective amount is provided as divided doses. In some embodiments, the subject is an animal, which may or may not be an animal model of aging or an age-related disease. In some embodiments, the subject is a nematode, a rodent, or a non-human primate. In some embodiments, the subject is a human. In some embodiments, the ATP synthase is mammalian ATP synthase, human ATP synthase, mammalian mitochondrial ATP synthase, or human mitochondrial ATP synthase. In some embodiments, the present invention provides a method of treating a subject for a cancer which comprises administering to the subject a therapeutically effective amount of one or more glutarate compounds, one or more glutamate compounds, or both. In some embodiments, the compound administered to the subject is a glutarate compound or a glutamate compound. In some embodiments, at least one glutarate compound and at least one glutamate compound are administered to the subject. In some embodiments, the compound administered to the subject is an alpha-ketoglutarate (α-KG) compound. In some embodiments, the compound administered to the subject is a 2-hydroxyglutarate (2-HG) compound. In some embodiments, at least one α-KG compound and at least one 2-HG compound are administered to the subject. In some embodiments where the cancer is a glioma, the subject is administered one or more α-KG compounds and is not administered any 2-hydroxyglutarate compounds. In some embodiments, the one or more compounds are administered in an effective amount or a therapeutically effective amount. In some embodiments, the therapeutically effective amount of the one or more compounds is administered as several doses over a given period of time, e.g., a daily dose for a week or more. In some embodiments, the amount of the one or more compounds administered to the subject increases the α-ketoglutarate levels in the subject by about 30-60%, preferably about 45-55%, more preferably about 50%. In some embodiments, the compound is administered as a daily dose of about 0.25-2, preferably about 0.5-2, more preferably about 1-2, most preferably about 2, grams per kilogram weight of the subject per day. In some embodiments, the subject is an animal, which may or may not be an animal model of aging or an age-related disease. In some embodiments, the subject is a nematode, a rodent, or a non-human primate. In some embodiments, the present invention provides a method of treating, inhibiting, reducing, or preventing an age-related heart condition in a subject, which comprises administering to the subject a therapeutically effective amount of one or more glutarate compounds, one or more glutamate compounds, or both. In some embodiments, at least one glutarate compound and at least one glutamate compound are administered to the subject. In some embodiments, the compound administered to the subject is an alpha-ketoglutarate (α-KG) compound. In some embodiments, the compound administered to the subject is a 2-hydroxyglutarate (2-HG) compound. In some embodiments, at least one α-KG compound and at least one 2-HG compound are administered to the subject. In some embodiments, the therapeutically effective amount of the one or more compounds is administered as several doses over a given period of time, e.g., a daily dose for a week or more. In some embodiments, the amount of the one or more compounds administered to the subject increases the α-ketoglutarate levels in the subject by about 30-60%, preferably about 45-55%, more preferably about 50%. In some embodiments, the compound is administered as a daily dose of about 0.25-2, preferably about 0.5-2, more preferably about 1-2, most preferably about 2, grams per kilogram weight of the subject per day. In some embodiments, the subject is an animal, which may or may not be an animal model of aging or an age-related disease. In some embodiments, the subject is a nematode, a rodent, or a non-human primate. Both the foregoing general description and the following detailed description are exemplary and explanatory only and are intended to provide further explanation of the invention as claimed. The accompanying drawings are included to provide a further understanding of the invention and are incorporated in and constitute part of this specification, illustrate several embodiments of the invention, and together with the description serve to explain the principles of the invention. This invention is further understood by reference to the drawings wherein: Color versions of several of these drawings may be found in Chin, et al., (2014) Nature 510:397-401 and the Extended Data Figures related thereto, which is herein incorporated by reference in its entirety. In some embodiments, the present invention is directed to methods for treating or inhibiting aging and age-related diseases in a subject which comprises administering the subject at least one glutarate compound, at least one glutamate compound, or both. In some embodiments, the present invention is directed to methods for increasing the lifespan of a subject which comprises administering the subject at least one glutarate compound, at least one glutamate compound, or both. In some embodiments, the present invention is directed to compositions for treating or inhibiting aging and age-related diseases in a subject, said compositions comprise at least one glutarate compound, at least one glutamate compound, or both. In some embodiments, the present invention is directed to compositions for increasing the lifespan of a subject, said compositions comprise at least one glutarate compound, at least one glutamate compound, or both. In some embodiments, the subject is an animal, which may or may not be an animal model of aging or an age-related disease. In some embodiments, the subject is a nematode, a rodent, or a non-human primate. In some embodiments, the subject is a human. As used herein, “age-related diseases” refers to diseases and disorders often associated with aging and includes cancers (e.g., gliomas, leukemia, lymphoma, breast cancer, prostate cancer, lung cancer, and the like), neurodegenerative diseases (e.g., Parkinson's disease, Alzheimer's disease, Huntington's disease, dementia, and the like), sarcopenia, osteopenia, osteoporosis, arthritis, atherosclerosis, cardiovascular disease, hypertension, cataracts, presbyopia, glaucoma, type 2 diabetes, metabolic syndrome, alopecia, chronic inflammation, immunosenescence, age-related visual decline, age-related hair loss, thinning, and/or graying, and the like. As used herein, an “age-related heart condition” refers to cardiac hypertrophy, cardiomyopathy, heart failure, cardiac hypertrophy, cardiomyopathy, heart failure, and cardiovascular disease. As used herein, methods and compositions that treat or inhibit “aging” in subjects are those that treat or inhibit symptoms related to aging. Symptoms related to aging include cancers, cholesterol build-up, stiffening of arterial wall, increased blood pressure, immunosenescence, muscle loss, bone loss, arthritis, osteoporosis, memory loss, hearing loss, visual decline, increased wrinkles, hair loss/thinning/graying, decreased stress resistance, dementia, loss of hearing, loss of vision, loss of mobility, loss of muscle strength and stamina, frailty, fatigue, increased susceptibility to infection, dry and/or wrinkled skin, and altered sleep patterns and circadian cycles. As used herein, a “glutarate compound” refers to α-KG compounds, 2-HG compounds, and compounds having the following structural formula I: wherein Ra and Rb are each independently a negative charge, H, a straight or branched C1-C10 alkyl, or a straight or branched C1-C10 alkenyl, and Rc is optionally present, and if present, Rc is H, a straight or branched C1-C10 alkyl, or a straight or branched C1-C10 alkenyl, and if absent, Z is a double bond, and pharmaceutically acceptable solvates, salts, prodrugs, and metabolites thereof. As used herein, a “glutamate compound” refers to compounds having the following structural formula II: wherein Ra and Rb are each independently a negative charge, H, a straight or branched C1-C10 alkyl, or a straight or branched C1-C10 alkenyl, and
As used herein, a “C1-C10 alkyl” refers to an alkyl having 1-10 carbon atoms, and a “C1-C10 alkenyl” refers to an alkenyl having 1-10 carbon atoms. As used herein, an “α-KG compound” refers to α-ketoglutarate (α-ketoglutarate), derivatives of α-ketoglutarate (e.g., the derivatives set forth in MacKenzie, et al. (2007) Mol Cell Biol 27(9):3282-3289)), analogues of α-ketoglutarate (e.g., phosphonate analogues (e.g., those recited in Bunik, et al. (2005) Biochemistry 44(31):10552-61), esters of α-ketoglutarate (e.g., dimethyl α-ketoglutarate and octyl α-ketoglutarate), and various species specific analogues, e.g., human α-ketoglutarate, porcine α-ketoglutarate, murine α-ketoglutarate, bovine α-ketoglutarate, and the like. As used herein, the abbreviation “KG” may be used to refer to the term “ketoglutarate”, e.g., α-ketoglutarate is abbreviated as α-KG. As used herein, a “2-HG compound” refers to 2-hydroxyglutaric acid, 2-hydroxypentanedioate, and compounds having 2-hydroxypentanedioate as part of its backbone structure and includes 1-alkyl-(S)-2-hydroxypentanedioate, 1-alkyl-(R)-2-hydroxypentanedioate, 1-alkenyl-(S)-2-hydroxypentanedioate, 1-alkenyl-(R)-2-hydroxypentanedioate, 5-alkyl-(S)-2-hydroxypentanedioate, 5-alkyl-(R)-2-hydroxypentanedioate, 5-alkenyl-(S)-2-hydroxypentanedioate, and 5-alkenyl-(R)-2-hydroxypentanedioate, wherein alkyl is a straight or branched C1-C10 alkyl and alkenyl is a straight or branched C1-C10 alkenyl. In some embodiments, the 2-HG compound is 1-octyl-(S)-2-hydroxypentanedioate, 1-octyl-(R)-2-hydroxypentanedioate, 5-octyl-(S)-2-hydroxypentanedioate, or 5-octyl-(R)-2-hydroxypentanedioate. As used herein, the abbreviation “HG” may be used to refer to the term “hydroxypentanedioate”, e.g., 2-hydroxypentanedioate is abbreviated as 2-HG. A “pharmaceutically acceptable solvate” refers to a solvate form of a specified compound that retains the biological effectiveness of such compound. Examples of solvates include compounds of the invention in combination with water, isopropanol, ethanol, methanol, dimethyl sulfoxide, ethyl acetate, acetic acid, ethanolamine, or acetone. Those skilled in the art of organic chemistry will appreciate that many organic compounds can form complexes with solvents in which they are reacted or from which they are precipitated or crystallized. These complexes are known as “solvates”. For example, a complex with water is known as a “hydrate”. Solvates of compounds of formulas I and II are within the scope of the invention. It will also be appreciated by those skilled in organic chemistry that many organic compounds can exist in more than one crystalline form. For example, crystalline form may vary from solvate to solvate. Thus, all crystalline forms of the compounds of formulas I and II or the pharmaceutically acceptable solvates thereof are within the scope of the present invention. The term “pharmaceutically acceptable salts” refers to salt forms that are pharmacologically acceptable and substantially non-toxic to the subject being treated with the compound of the invention. Pharmaceutically acceptable salts include conventional acid-addition salts or base-addition salts formed from suitable non-toxic organic or inorganic acids or inorganic bases. Exemplary acid-addition salts include those derived from inorganic acids such as hydrochloric acid, hydrobromic acid, hydroiodic acid, sulfuric acid, sulfamic acid, phosphoric acid, and nitric acid, and those derived from organic acids such as p-toluenesulfonic acid, methanesulfonic acid, ethane-disulfonic acid, isethionic acid, oxalic acid, p-bromophenylsulfonic acid, carbonic acid, succinic acid, citric acid, benzoic acid, 2-acetoxybenzoic acid, acetic acid, phenylacetic acid, propionic acid, glycolic acid, stearic acid, lactic acid, malic acid, tartaric acid, ascorbic acid, maleic acid, hydroxymaleic acid, glutamic acid, salicylic acid, sulfanilic acid, and fumaric acid. Exemplary base-addition salts include those derived from ammonium hydroxides (e.g., a quaternary ammonium hydroxide such as tetramethylammonium hydroxide), those derived from inorganic bases such as alkali or alkaline earth-metal (e.g., sodium, potassium, lithium, calcium, or magnesium) hydroxides, and those derived from non-toxic organic bases such as basic amino acids. “A pharmaceutically acceptable prodrug” is a compound that may be converted under physiological conditions or by solvolysis to the specified compound or to a pharmaceutically acceptable salt of such compound. “A pharmaceutically active metabolite” refers to a pharmacologically active product produced through metabolism in the body of a specified compound or salt thereof. Prodrugs and active metabolites of a compound may be identified using routine techniques known in the art. See, e.g., Bertolini, G. et al., (1997) J. Med. Chem. 40:2011-2016; Shan, D. et al., J. Pharm. Sci., 86(7):765-767; Bagshawe K., (1995) Drug Dev. Res. 34:220-230; Bodor, N., (1984) Advances in Drug Res. 13:224-331; Bundgaard, H., Design of Prodrugs (Elsevier Press, 1985) and Larsen, I. K., Design and Application of Prodrugs, Drug Design and Development (Krogsgaard-Larsen et al., eds., Harwood Academic Publishers, 1991). In some embodiments, the amount of the glutarate compound administered to the subject is a therapeutically effective amount or an effective amount. As used herein, an “effective amount” is a dose that results in an observable difference as compared to a placebo. A “therapeutically effective amount”, refers to an amount of one or more compounds of the present invention that, when administered to a subject, (i) treats or inhibits the particular disease, condition, or disorder, (ii) attenuates, ameliorates, or eliminates one or more symptoms of the particular disease, condition, or disorder, and/or (iii) inhibits or delays the onset of one or more symptoms of the particular disease, condition, or disorder, as compared to a control. A therapeutically effective amount of one or more compounds of the present invention will vary depending upon factors such as the given compound(s), the pharmaceutical formulation, route of administration, the type of disease or disorder, the degree of the disease or disorder, and the identity of the subject being treated, but can nevertheless be readily determined by one skilled in the art. For example, a “therapeutically effective amount” of a glutarate compound, a glutamate compound, or both is one that delays or inhibits the onset of age-related symptoms and/or extends the lifespan of a given subject as compared to one or more control subjects. In some embodiments, a therapeutically effective amount of the one or more glutarate compounds and/or the one or more glutamate compounds is administered as a daily dose of about 0.25-2, about 0.5-2, about 1-2, or about 2 grams, per kilogram weight of the subject per day. The skilled artisan will appreciate that certain factors may influence the dosage required to effectively treat a subject, including but not limited to the severity of the disease or disorder, previous treatments, the general health and/or age of the subject, and other diseases present. As shown herein, doses that increased α-KG levels in subjects by about 50% resulted in the largest increases in lifespan (up to about 70%). Therefore, in some embodiments, the amount of the one or more glutarate compounds and/or the one or more glutamate compounds administered to a subject is one that results in about a 50% increase in α-KG levels in the subject. The therapeutically effective amount may be administered as a single dose or as multiple doses over a period of time. For example, a subject may be treated with one or more glutarate compounds and/or one or more glutamate compounds at least once. However, the subject may be treated with the one or more glutarate compounds and/or the one or more glutamate compounds from about one time per week to about once daily for a given treatment period. The length of the treatment period will depend on a variety of factors such as the severity of the disease or disorder, the concentration and activity of the one or more compounds of the present invention, or a combination thereof. It will also be appreciated that the effective dosage of the one or more compounds used for treatment may increase or decrease over the course of a particular treatment. The one or more glutarate compounds and/or the one or more glutamate compounds to be administered to a subject may be provided as a pharmaceutical formulation. Pharmaceutical formulations may be prepared in a unit-dosage form appropriate for the desired mode of administration. The pharmaceutical formulations of the present invention may be administered by any suitable route including oral, rectal, nasal, topical (including buccal and sublingual), vaginal, and parenteral (including subcutaneous, intramuscular, intravenous, and intradermal). It will be appreciated that the route of administration may vary with the condition and age of the recipient, the nature of the condition to be treated, and the given compound(s) of the present invention. In some embodiments, the route of administration is oral. In some embodiments, the one or more glutarate compounds and/or the one or more glutamate compounds are provided in the form of a foodstuff It will be appreciated that the actual dosages of the glutarate compounds and/or the glutamate compounds used in the pharmaceutical formulations will vary according to the particular compound(s) being used, the particular composition formulated, the mode of administration, and the particular site, subject, and disease being treated. Optimal dosages for a given set of conditions may be ascertained by those skilled in the art using dosage determination tests in view of the experimental data for a given compound. Administration of prodrugs may be dosed at weight levels that are chemically equivalent to the weight levels of the fully active forms. Pharmaceutical formulations of this invention comprise a therapeutically effective amount of one or more compounds of the present invention, and an inert, pharmaceutically acceptable carrier or diluent. As used herein the language “pharmaceutically acceptable carrier” is intended to include any and all solvents, dispersion media, coatings, antibacterial, and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. The pharmaceutical carrier employed may be either a solid or liquid. Exemplary of solid carriers are lactose, sucrose, talc, gelatin, agar, pectin, acacia, magnesium stearate, stearic acid, and the like. Exemplary of liquid carriers are syrup, peanut oil, olive oil, water, and the like. Similarly, the carrier or diluent may include time-delay or time-release material known in the art, such as glyceryl monostearate or glyceryl distearate alone or with a wax, ethylcellulose, hydroxypropylmethylcellulose, methylmethacrylate, and the like. The use of such media and agents for pharmaceutically active substances is known in the art. Toxicity and therapeutic efficacy of glutarate compounds and glutamate compounds can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50(the dose lethal to 50% of the population) and the ED50(the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD50/ED50. Compounds exhibiting large therapeutic indices are preferred. While compounds that exhibit toxic side effects may be used, care should be taken to design a delivery system that targets such compounds to the site of affected tissue in order to minimize potential damage to uninfected cells and, thereby, reduce side effects. The data obtained from the cell culture assays and animal studies can be used in formulating a range of dosage for use in humans. The dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50with little or no toxicity. The dosage may vary within this range depending upon the dosage form employed and the route of administration utilized. For any compound used in the method of the invention, the therapeutically effective dose can be estimated initially from cell culture assays. A dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50(i.e., the concentration of the test compound that achieves a half-maximal inhibition of symptoms) as determined in cell culture. Such information can be used to more accurately determine useful doses in humans. Levels in plasma may be measured, for example, by high performance liquid chromatography. α-KG Extends the Lifespan of Adult To gain insight into the regulation of aging by endogenous small molecules, normal metabolites and aberrant disease-associated metabolites were screened for their effects on the adult lifespan using the The dilution or killing of the bacterial food has been shown to extend worm lifespan, but the lifespan increase by α-KG is not due to altered bacterial proliferation, viability, or metabolism ( In the cell, α-KG is decarboxylated to succinyl-CoA and CO2by α-KG dehydrogenase (encoded by ogdh-1), a key control point in the TCA cycle. Increasing α-KG levels by ogdh-1 RNAi ( To investigate the molecular mechanism(s) of longevity by α-KG, the unbiased biochemical approach DARTS was used. A human cell line (Jurkat), which is easy to culture, was used as the protein source for DARTS ( α-KG inhibits the activity of Complex V, but not Complex IV, from bovine heart mitochondria ( To understand the mechanism of inhibition by α-KG, the enzyme inhibition kinetics of ATP synthase was studied. α-KG (released from octyl α-KG) decreases both the effective Vmaxand Kmof ATP synthase, indicative of uncompetitive inhibition ( To determine the significance of ATP-2 to the longevity by α-KG, the lifespan of atp-2(RNAi) adults given α-KG was measured. atp-2(RNAi) animals live longer than controls ( It was found that α-KG does not extend the lifespan of eat-2(ad1116) animals ( The inability of α-KG to further extend the lifespan of CeTOR(RNAi) animals indicates that α-KG treatment and TOR inactivation extend lifespan either through the same pathway (with α-KG acting on or upstream of TOR), or through independent mechanisms or parallel pathways that converge on a downstream effector. The first model predicts that the TOR pathway will be less active upon α-KG treatment, whereas if the latter model were true then TOR would be unaffected by α-KG treatment. In support of the first model, it was found that TOR pathway activity is decreased in human cells treated with octyl α-KG ( α-KG is not only a metabolite, but also a co-substrate for a large family of dioxygenases. The hypoxia inducible factor (HIF-1) is modified by one of these enzymes, the prolyl 4-hydroxylase (PHD) EGL-9, and thereafter degraded by the von Hippel-Lindau (VHL) protein. It was found that α-KG extends the lifespan of animals with loss-of-function mutations in hif-1, egl-9, and vhl-1 ( The protective effects of octyl α-KG against isoproterenol-induced hypertrophy in isolated neonatal rat cardiomyocytes was examined. Cardiomyocytes of neonatal rats were isolated by collagenase digestion and cultured overnight in DMEM containing 10% fetal calf serum (FCS), and then culture medium was changed to serum-free high glucose insulin-transferrin-sodium selenite (ITS). Hypertrophy of cardiomyocytes was induced by treating the cells with 1 mM isoproterenol (ISO) or phenylephrine (PE) for 48 hours. As shown in To test the bio- and oral availability of octyl α-KG in animals, animals were fed octyl α-KG and assessed whether the molecular and cellular effects of octyl α-KG could be recapitulated in vivo, particularly its inhibition of mitochondrial ATP synthase (Complex V) activity. Mice were fed a chow diet that was pre-mixed with either octyl α-KG (1.5 mg/g body weight) or octanol (control) for one week. The animals showed no abnormality either physiologically or behaviorally after 5 days feeding with octyl α-KG or octanol. The mice were sacrificed, hearts harvested, and mitochondria isolated. The oxygen consumption rate (OCR) was measured using a Seahorse XF-24 Analyzer (Seahorse Bioscience). As shown in The cardio-protective effect of α-KG in vivo was examined. Hypertrophy and heart failure were induced by chronic infusion of isoproterenol for 3 weeks at a dose of 30 μg per gram bodyweight per day using osmotic mini-pumps (Alzet, model 1004). DBA2/J female mice at 8 weeks old were used for this study. The mice were fed octyl α-KG at 0.5 mg/g body weight daily in chow during the three weeks of the study. ISO-induced cardiac hypertrophy and cardiomyopathy were determined at the end of experiment by assessing heart size and heart to body weight ratio. As shown in the left panel of More importantly, cardiac output was assessed and the cardiac ejection fractions were determined by echocardiography. The cardiac EF for the basal levels before the treatment is 55.1%±2.6 (n=14). As shown in the right panel of 2-HG Extends the Lifespan of Adult Although 2-HG exhibits structural similarity with α-KG ( DARTS analysis shows that 2-HG targets ATP5B. Specifically, it was found that both (R)-2-HG and (S)-2-HG bind to ATP5B ( At normal cellular concentrations of about 200 μM, (R)-2-HG is unlikely to cause significant inhibition of ATP synthase. However, in glioma patients with the IDH1 or IDH2 mutations where (R)-2-HG accumulates to 10-100 times natural endogenous levels, inhibition of ATP synthase would be possible. To test this idea, U87 cells stably expressing IDH1(R132H), the most common IDH mutation in glioma, were used. Similar to octyl 2-HG treated cells described above, the U87/IDH1(R132H) cells exhibit decreased ATP content and oxygen consumption rates compared to isogenic IDH1(WT)-expressing U87 cells ( The metabolite 2-HG is linked to the TCA cycle and related amino acid metabolic pathways ( As the end component (Complex V) of the mitochondrial electron transport chain (ETC), ATP synthase is a major source of cellular energy and the sole site for oxidative phosphorylation. When glycolysis is inhibited, such as under conditions of glucose insufficiency, cells are forced to rely on mitochondrial respiration as a source of ATP. The inherent inhibition of ATP synthase and mitochondrial respiration in mutant IDH1 cancer cells thus suggests a possible Achilles' heel for these cancers. Supporting this idea, when cultured in glucose-free, galactose-containing medium, e.g., when respiration is the primary source of energy, IDH1(R132H) cells exhibit drastically decreased cell viability ( In complex organisms, glucose limitation can be achieved through ketosis, wherein cells use ketone bodies (instead of glucose) for energy. Ketosis is naturally induced upon prolonged starvation (or fasting), in a survival mode for the body to derive energy from its relatively long-lasting fat reservoir while sparing protein in muscle and other tissues from catabolism. Ketosis can also be implemented through a low-carbohydrate-high-fat “ketogenic diet”, which has shown benefits against cancer. One reason for this may be that tumor cells largely depend on glucose for growth and survival. Since metabolism of ketone bodies depends entirely on mitochondrial oxidative phosphorylation, one prediction is that inhibiting ATP synthase (or other ETC components) in cancer cells would confer a survival disadvantage if ketone bodies were to be their only source of energy. Since U87 cells are unable to utilize ketone bodies for energy, in order to directly assess the effect of the IDH1 mutation HCT 116 cells expressing the mutant IDH1 were used. When cultured in ketogenic (glucose-free) medium containing the ketone body (R)-3-hydroxybutyrate, IDH1 mutant HCT 116 cells showed a profound decrease in viability compared to the parental cells ( Similar to treatment with ATP synthase inhibitors, octyl α-KG or oligomycin, which decreases TOR signaling, it was found that phosphorylation of mTOR Complex 1 substrates, including S6K and 4E-BP1, is decreased in ATP5B knockdown cells (FIG. 17, Panel G), in cells treated with octyl esters of 2-HG ( In summary, similar to α-KG, both enantiomers of 2-HG bind and inhibit ATP synthase and extend the lifespan of The following examples are intended to illustrate but not to limit the invention. Nematode strains and maintenance. U87 cells were cultured in glucose-free DMEM (Life technologies, 11966-025) supplemented with 10% fetal bovine serum (FBS) and 10 mM glucose, or in glucose-free DMEM supplemented with 10% FBS and 10 mM galactose when indicated. IDH1(R132H) mutant or IDH1(WT) expressing U87 cells were as reported (Li, et al. Neuro Oncol 15, 57-68). Normal human diploid fibroblasts WI-38 (ATCC, CCL-75) were cultured with EMEM (ATCC, 30-2003) supplemented with 10% FBS. HEK 293, A549, and HeLa cells were cultured with DMEM (Life technologies, 11966-065) supplemented with 10% FBS. Jurkat and HCT 116 cells were cultured in RPMI (Life technologies, 11875-093) supplemented with 10% FBS. All the cells were cultured at 37° C. and 5% CO2. Cells were transfected with indicated siRNA using Thermo Scientific DharmaFECT Transfection Reagent 1 by following the manufacturer's instructions. Knock down efficiency was confirmed by immunoblotting on the first and the last day of the growth inhibition assay. 1-octyl α-KG, octyl (S)-2-HG, and octyl (R)-2-HG were synthesized using methods known in the art. See Jung & Deng, J Org Chem 77, 11002-11005 (2012); Albert et al. Synthesis-Stuttgart, 635-637 (1987); and Cancer Cell 19, 17-30 (2011). Modifications to synthetic methods are as follows: Synthesis of octyl α-KG Briefly, 1-octanol (0.95 ml, 6.0 mmol), DMAP (37 mg, 0.3 mmol), and DCC (0.743 g, 3.6 mmol) were added to a solution of 1-cyclobutene-l-carboxylic acid (0.295 g, 3.0 mmol) in dry CH2Cl2(6.0 ml) at 0° C. After it had stirred for 1 hour, the solution was allowed to warm to room temperature and stirred for another 8 hours. The precipitate was filtered and washed with ethyl acetate (3×100 ml). The combined organic phases were washed with water and brine, and dried over anhydrous Na2SO4. Flash column chromatography on silica gel eluting with 80/1 hexane/ethyl acetate gave octyl cyclobut-1-enecarboxylate as a clear oil (0.604 g, 96%). To a −78° C. solution of this oil (0.211 g, 1.0 mmol) in CH2Cl2(10 ml) was bubbled O3/O2until the solution turned blue. The residual ozone was discharged by bubbling with O2and the reaction was warmed to room temperature and stirred for another 1 hour. Dimethyl sulfide (Me2S, 0.11 ml, 1.5 mmol) was added to the mixture and it was stirred for another 2 hours. The CH2Cl2was removed in vacuo and the crude product was dissolved in a solution of 2-methyl-2-butene (0.8 ml) in t-BuOH (3.0 ml). To this was added drop-wise a solution containing sodium chlorite (0.147 g, 1.3 mmol) and sodium dihydrogen phosphate monohydrate (0.179 g, 1.3 mmol) in H2O (1.0 ml). The mixture was stirred at room temperature overnight, and then extracted with ethyl acetate (3×50 ml). The combined organic phases were washed with water and brine, and dried over anhydrous Na2SO4.Flash column chromatography on silica gel eluting with 5/1 hexane/ethyl acetate gave octyl α-KG, which became a pale solid when stored in the refrigerator (0.216 g, 84%). Synthesis of 5-octyl L-Glu ((S)-2-amino-5-(octyloxy)-5-oxopentanoic acid) L-Glutamic acid (0.147 g, 1.0 mmol) and anhydrous sodium sulfate (0.1 g) was dissolved in octanol (2.0 ml), and then tetrafluoroboric acid-dimethyl ether complex (0.17 ml) was added. The suspended mixture was stirred at 21° C. overnight Anhydrous THF (5 ml) was added to the mixture and it was filtered through a thick pad of activated charcoal. Anhydrous triethylamine (0.4 ml) was added to the clear filtrate to obtain a milky white slurry. Upon trituration with ethyl acetate (10 ml), the monoester monoacid precipitated. The precipitate was collected, washed with additional ethyl acetate (2×5 ml), and dried in vacuo to give the desired product 5-octyl L-Glu (0.249 g, 96%) as a white solid.1H NMR (500 MHz, Acetic acid-d4): δ 4.12 (dd, J=6.6, 6.6 Hz, 1H), 4.11 (t, J=6.8 Hz, 2H), 2.64 (m, 2H), 2.26 (m, 2H), 1.64 (m, 2H), 1.30 (m, 10H), 0.89 (t, J=7.0 Hz, 3H).13C NMR (125 MHz, Acetic acid-d4): 175.0, 174.3, 66.3, 55.0, 32.7, 30.9, 30.11, 30.08, 29.3, 26.7, 26.3, 23.4, 14.4. Synthesis of 5-octyl D-Glu ((R)-2-amino-5-(octyloxy)-5-oxopentanoic acid) The synthesis of the opposite enantiomer, i.e., 5-octyl D-Glu, was carried out by the exact same procedure starting with D-glutamic acid. The spectroscopic data was identical to that of the enantiomeric compound. Synthesis of 5-octyl α-KG (5-(Octyloxy)-2,5-dioxopentanoic acid) 1-benzyl 5-octyl 2-oxopentanedioate: To a solution of 5-octyl L-Glu (0.249 g) in H2O (6.0 ml) and acetic acid (2.0 ml) cooled to 0° C. was added slowly a solution of aqueous sodium nitrite (0.207 g, 3.0 mmol in 4 ml H2O). The reaction mixture was allowed to warm slowly to room temperature and was stirred overnight. The mixture was concentrated. The resulting residue was dissolved in DMF (10 ml) and NaHCO3(0.42 g, 5.0 mmol) and benzyl bromide (0.242 ml, 2.0 mmol) were added to the mixture. The mixture was stirred at 21° C. overnight and then extracted with ethyl acetate (3×30 ml). The combined organic phase was washed with water and brine and dried over anhydrous MgSO4. Flash column chromatography on silica gel eluting with 7/1 hexanes/ethyl acetate gave the mixed diester 1-benzyl 5-octyl (S)-2-hydroxypentanedioate as a colorless oil. To this oil dissolved in dichloromethane (10.0 ml), were added NaHCO3(0.42 g, 5.0 mmol) and Dess-Martin periodinane (0.509 g, 1.2 mmol) and the mixture was stirred at room temperature for 1 hour and then extracted with ethyl acetate (3×ml). The combined organic phase was washed with water and brine and dried over anhydrous MgSO4.Flash column chromatography on silica gel eluting with 5/1 hexanes/ethyl acetate gave the desired 1-benzyl 5-octyl 2-oxopentanedioate (0.22 g, 66%) as a white solid.1H NMR (500 MHz, CDCl3): 7.38 (m, 5H), 5.27 (s, 2H), 4.05 (t, J=6.5 Hz, 2H), 3.14 (t, J=6.5 Hz, 2H), 2.64 (t, J=6.5 Hz, 2H), 1.59 (m, 2H), 1.28 (m, 10H), 0.87 (t, J=7.0 Hz, 3H).13C NMR (125 MHz, CDCl3): 192.2, 171.9, 160.1, 134.3, 128.7, 128.6, 128.5, 67.9, 65.0, 34.2, 31.7, 29.07, 29.05, 28.4, 27.5, 25.7, 22.5, 14.0. 5-octyl α-KG (5-(Octyloxy)-2,5-dioxopentanoic acid): To a solution of 1-benzyl 5-octyl 2-oxopentanedioate (0.12 g, 0.344 mmol) in ethyl acetate (15 ml) was added 5% Pd/C (80 mg). Over the mixture was passed a stream of argon and then the argon was replaced with hydrogen gas and the mixture was stirred vigorously for 15 minutes. The mixture was filtered through a thick pad of Celite to give the desired product 5-octyl α-KG (0.088 g, 99%) as white solid.1H NMR (500 MHz, CDCl3): 8.16 (br s, 1H), 4.06 (t, J=6.5 Hz, 2H), 3.18 (t, J=6.5 Hz, 2H), 2.69 (t, J=6.0 Hz, 2H), 1.59 (m, 2H), 1.26 (m, 10H), 0.85 (t, J=7.0 Hz, 3H).13C NMR (125 MHz, CDCl3): 193.8, 172.7, 160.5, 65.5, 33.0, 31.7, 29.08, 29.06, 28.4, 27.8, 25.8, 22.5, 14.0. Synthesis of 1-Octyl (S) 2-hydroxypentanedioate (Octyl (S)-2-HG) (S)-2-amino-5-(benzyloxy)-5-oxopentanoic acid: L-Glutamic acid (2.0 g, 13.6 mmol) and anhydrous sodium sulfate (2.0 g) was dissolved in benzyl alcohol (25 ml), and then tetrafluoroboric acid diethyl ether complex (3.7 ml, 27.2 mmol) was added. The suspended mixture was stirred at 21° C. overnight. Anhydrous THF (75 ml) was added to the mixture and it was filtered through a thick pad of activated charcoal. Anhydrous triethylamine (4.1 ml) was added to the clear filtrate to obtain a milky white slurry. Upon trituration with ethyl acetate (100 ml), the monoester monoacid precipitated. It was collected, washed with additional ethyl acetate (2×10 ml), and dried in vacuo to give the desired product (S)-2-amino-5-(benzyloxy)-5-oxopentanoic acid (3.07 g, 95%) as a white solid.1H NMR (500 MHz, Acetic acid-d4): δ 7.41-7.25 (m, 5H), 5.14 (s, 2H), 4.12 (m, 1H), 2.75-2.60 (m, 2H), 2.27 (m, 2H).13C NMR (125 MHz, Acetic acid-d4): δ 174.6, 174.4, 136.9, 129.5, 129.2, 129.1, 67.7, 55.0, 30.9, 26.3. (S)-5-benzyl 1-octyl 2-hydroxypentanedioate: To a solution of (S)-2-amino-5-(benzyloxy)-5-oxopentanoic acid (1.187 g, 5.0 mmol) in H2O (25 ml) and acetic acid (10 ml) cooled to 0° C. was added slowly a solution of aqueous sodium nitrite (1.07 g in 15 ml H2O). The reaction mixture was allowed to warm slowly to room temperature and was stirred overnight. The mixture was concentrated. The resulting residue was dissolved in DMF (15 ml) and NaHCO3(1.26 g, 15 mmol) and 1-iodooctane (1.84 ml, 10 mmol) were added to the mixture. The mixture was stirred at 21° C. overnight and then extracted with ethyl acetate (3×50 ml). The combined organic phase was washed with water and brine and dried over anhydrous MgSO4. Flash column chromatography on silica gel eluting with 7/1 hexanes/ethyl acetate gave the desired mixed diester (S)-5-benzyl 1-octyl 2-hydroxypentanedioate (0.785 g, 45%) as a colorless oil.1H NMR (500 MHz, CDCl3): δ 7.37-7.28 (m, 5H), 5.12 (s, 2H), 4.26-4.19 (m, 1H), 4.16 (t, J=6.8 Hz, 2H), 3.11 (d, J=4.1 Hz, 1H), 2.61-2.46 (m, 2H), 2.26-2.14 (m, 1H), 1.95 (dtd, J=14.2, 8.3, 6.1 Hz, 1H), 1.71-1.57 (m, 2H), 1.39-1.20 (m, 10H), 0.88 (t, J=6.9 Hz, 3H).13C NMR (125 MHz, CDCl3): δ 174.6, 172.8, 135.8, 128.4, 128.1, 128.0, 69.3, 66.2, 65.8, 31.6, 29.6, 29.2, 29.0 (2C′s), 28.4, 25.6, 22.5, 13.9. 1-octyl (S) 2-hydroxypentanedioate (octyl (S)-2-hydroxyglutarate; octyl (S)-2-HG): To a solution of (S)-5-benzyl 1-octyl 2-hydroxypentanedioate (0.71 g, 2.0 mmol) in MeOH (50 ml) was added 5% Pd/C (80 mg). Over the mixture was passed argon condition and then the argon was replaced with hydrogen and the mixture was stirred vigorously for 1 hour. The mixture was filtered through a thick pad of Celite and the organic phase was evaporated. The residue was purified via flash column chromatography on silica gel eluting with 25/1 CH2Cl2/MeOH to give octyl (S)-2-HG (0.495 g, 48%) as white solid.1H NMR (500 MHz, CDCl3): δ 4.23 (dd, J=8.0, 4.2 Hz, 1H), 4.16 (t, J=6.8 Hz, 2H), 2.60-2.42 (m, 2H), 2.15 (m, 1H), 1.92 (dtd, J=14.2, 8.2, 6.1 Hz, 1H), 1.69-1.59 (m, 2H), 1.38-1.16 (m, 10H), 0.86 (t, J=7.0 Hz, 3H).13C NMR (125 MHz, CDCl3): δ 178.8, 174.8, 69.3, 66.1, 31.7, 29.4, 29.1 (2C's), 28.9, 28.4, 25.7, 22.5, 14.0. Synthesis of 1-Octyl (R) 2-hydroxypentanedioate (Octyl (R)-2-HG) The synthesis of the opposite enantiomer, i.e., octyl (R)-2-HG, was carried out by the exact same procedure starting with D-glutamic acid. The spectroscopic data was identical to that of the enantiomeric compounds. RNAi in RNAi in The RNAi knockdown of both ogdh-1 and atp-2 was validated by quantitative RT-PCR and atp-2 knockdown was also validated by Western blotting. Transcripts of ogdh-1 were reduced by 85%, and transcripts and protein levels of atp-2 were reduced by 52% and 83%, respectively, in larvae that were cultivated on bacteria that expressed the corresponding dsRNAs. In addition, RNAi of atp-2 was found to be associated with delayed post-embryonic development and larval arrest, which is consistent with the phenotypes of atp-2(ua2) animals. Analysis by qRT-PCR indicated a modest but significant decrease by 26% in transcripts of CeTOR in larvae undergoing RNAi; moreover, molecular markers for autophagy were induced in these animals, and the lifespan of adults was extended, which is consistent with partial inactivation of the kinase. In lifespan experiments, RNAi was used to inactivate atp-2, ogdh-1, and CeTOR in mature animals in the presence or absence of exogenous α-KG. The concentration of α-KG used in these experiments (8 mM) was empirically determined to be most beneficial for wild-type animals ( Lifespan assays were conducted at 20° C. on solid nematode growth media (NGM) using standard protocols and were replicated in at least two independent experiments. For lifespan experiments involving RNAi, the plates also contained 1 mM isopropyl β-D-1-thiogalactopyranoside (IPTG; Acros, CAS 367-93-1) and 50 μg/ml ampicillin (Fisher, BP1760-25). RNAi was accomplished by feeding N2 worms HT115(DE3) bacteria expressing target-gene dsRNA from pL4440 (Timmons & Fire, Nature 395, 854 (1998)); control RNAi was done in parallel for every experiment by feeding N2 worms HT115(DE3) bacteria expressing either GFP dsRNA or empty vector (which gave identical lifespan results). Lifespan experiments with oligomycin (Cell Signaling Technology, 9996) were performed as described for α-KG (NGM plates with 1.5% DMSO and 49.5 μM FUDR; N2 worms; OP50 bacteria). For lifespan experiments concerning smg-1(cc546ts);pha-4(zu225) and smg-1(cc546ts) (Timmons & Fire, Nature 395, 854 (1998); and Gaudet & Mango, Science 295, 821-825 (2002)), the strains were grown from egg to L4 stage at 24° C., which inactivates the smg-1 temperature-sensitive allele, preventing mRNA surveillance-mediated degradation of the pha-4(zu225) mRNA, which contains a premature stop codon, and thus produces a truncated but fully functional PHA-4 transcription factor (Gaudet & Mango, Science 295, 821-825 (2002)). Then at the L4 stage the temperature was shifted to 20° C., which restores smg-1 function and thereby results in the degradation of pha-4(zu225) mRNA. Treatment with α-KG began at the L4 stage. Lifespan data is provided in A protocol adapted from Abada et al. (Mol Cells 28, 209-213 (2009)) was performed as follows. A 10 cm NGM plate was seeded with two spots of OP50 as shown in Target identification using DARTS was conducted in accordance with methods know in the art. See e.g., Lomenick, et al. PNAS USA 106, 21984-21989 (2009). For unbiased target ID ( For target verification by DARTS-Western blotting ( For DARTS using For 2-HG experiments, DARTS was performed as described above. Briefly, U87 cells were lysed in M-PER buffer (Thermo Scientific, 78501) with the addition of protease (Roche, 11836153001) and phosphatase (50 mM NaF, 2 mM Na3VO4) inhibitors. Chilled TNC buffer (50 mM Tris-HCl pH 8.0, 50 mM NaCl, 10 mM CaCl2) was added to the lysate, and protein concentration of the solution was measured on an aliquot by the BCA Protein Assay kit (Pierce, 23227). The remaining lysate was then incubated with vehicle control (H2O) or varying concentrations of 2-HG or α-KG for 0.5 hours at room temperature. The samples were then subjected to Pronase digestions (Roche, 10165921001, 5 minutes at room temperature) that were stopped by addition of SDS loading buffer and immediate heating (95° C., 5 minutes). Samples were subjected to SDS-PAGE on 4-12% Bis-Tris gradient gel (Invitrogen, NP0322BOX), and Western blotting was carried out with antibodies against ATP5B (Sigma, AV48185) or GAPDH (Santa Cruz, SC25778). Complex V activity was assayed using the MitoTox OXPHOS Complex V Activity Kit (Abcam, ab109907). Vehicle (H20) or α-KG was mixed with the enzyme prior to the addition of phospholipids. In experiments using octyl α-KG, vehicle (1% DMSO) or octyl α-KG was added with the phospholipids. Relative Complex V activity was compared to vehicle. Oligomycin (Sigma, O4876) was used as a positive control for the assay. Isolation of Mitochondria from Mouse Liver Animal studies were performed under approved UCLA animal research protocols. Mitochondria from 3-month-old C57BL/6 mice were isolated as described (Rogers, et al. PLoS One 6, e21746 (2011)). Briefly, livers were extracted, minced at 4° C. in MSHE+BSA (70 mM sucrose, 210 mM mannitol, 5 mM HEPES, 1 mM EGTA, and 0.5% fatty acid free BSA, pH 7.2), and rinsed several times to remove blood. All subsequent steps were performed on ice or at 4° C. The tissue was disrupted in 10 volumes of MSHE+BSA with a glass Dounce homogenizer (5-6 strokes) and the homogenate was centrifuged at 800×g for 10 minutes to remove tissue debris and nuclei. The supernatant was decanted through a cell strainer and centrifuged at 8,000×g for 10 minutes. The dark mitochondrial pellet was resuspended in MSHE+BSA and re-centrifuged at 8,000×g for 10 minutes. The final mitochondrial pellets were used for various assays as described below. ATP hydrolysis by ATP synthase was measured using submitochondrial particles (see Alberts, B. Molecular Biology of the Cell. 3rd edn, (Garland Pub., 1994) and references therein). Mitochondria were isolated from mouse liver as described above. The final mitochondrial pellet was resuspended in buffer A (250 mM sucrose, 10 mM Tris-HCl, 1 mM ATP, 5 mM MgCl2, and 0.1 mM EGTA, pH 7.4) at 10 μg/μl, subjected to sonication on ice (Fisher Scientific Model 550 Sonic Dismembrator; medium power, alternating between 10 second intervals of sonication and resting on ice for a total of 60 seconds of sonication), and then centrifuged at 18,000×g for 10 minutes at 4° C. The supernatant was collected and centrifuged at 100,000×g for 45 minutes at 4° C. The final pellet (submitochondrial particles) was resuspended in buffer B (250 mM sucrose, 10 mM Tris-HCl, and 0.02 mM EGTA, pH 7.4). The SMP ATPase activity was assayed using the Complex V Activity Buffer as above. The production of ADP is coupled to the oxidation of NADH to NAD+through pyruvate kinase and lactate dehydrogenase. The addition of α-KG (up to 10 mM) did not affect the activity of pyruvate kinase or lactate dehydrogenase when external ADP was added. The absorbance decrease of NADH at 340 nm correlates to ATPase activity. SMPs (2.18 ng/μl) were incubated with vehicle or α-KG for 90 minutes at room temperature prior to the addition of activity buffer, and then the absorbance decrease of NADH at 340 nm was measured every 1 minute for 1 hour. Oligomycin (Cell Signaling Technology, 9996) was used as a positive control for the assay. Normal human diploid fibroblast WI-38 (ATCC, CCL-75) cells were seeded in 96-well plates at 2×104cells per well. Cells were treated with either DMSO (vehicle control) or octyl α-KG at varying concentrations for 2 hours in triplicate. ATP levels were measured using the CellTiter-Glo luminescent ATP assay (Promega, G7572); luminescence was read using Analyst HT (Molecular Devices). In parallel, identically treated cells were lysed in M-PER (Thermo Scientific, 78501) to obtain protein concentration by BCA Protein Assay kit (Pierce, 23223). ATP levels were normalized to protein content. Statistical analysis was performed using GraphPad Prism (unpaired t-test). Assay for ATP levels in For 2-HG experiments, U87 cells were seeded in 96-well plates at 2×104cells per well and treated with indicated compound for 2 hours in triplicate. ATP levels were measured using the CellTiter-Glo luminescent ATP assay (Promega, G7572); luminescence was read using Analyst HT (Molecular Devices). To confirm that the number of cells was consistent between treatments, cell lysates were further subjected to dsDNA staining using QuantiFluor dsDNA system (Promega). Statistical analysis was performed using GraphPad Prism (unpaired t-test). OCR measurements were made using a Seahorse XF-24 analyzer (Seahorse Bioscience) (Wu, et al. Am J Physiol Cell Physiol 292, C125-136 (2007)). Cells were seeded in Seahorse XF-24 cell culture microplates at 50,000 cells/well in DMEM media supplemented with 10% FBS and 10 mM glucose, and incubated at 37° C. and 5% CO2for overnight. Treatment with octyl α-KG or DMSO (vehicle control) was for 1 hour. Cells were washed in unbuffered DMEM medium (pH 7.4, 10 mM glucose) just prior to measurement, and maintained in this buffer with indicated concentrations of octyl α-KG. Oxygen consumption rates were measured 3 times under basal conditions and normalized to protein concentration per well. Statistical analysis was performed using GraphPad Prism. Measurement of oxygen consumption rates (OCR) in living For 2-HG experiments, OCR and ECAR measurements were made using a Seahorse XF-24 analyzer (Seahorse Bioscience) (Wu, et al. Am J Physiol Cell Physiol 292, C125-136 (2007)). U87 cells were seeded in Seahorse XF-24 cell culture microplates at 50,000 cells per well in DMEM supplemented with 10% FBS and either 10 mM glucose or 10 mM galactose, and incubated O/N at 37° C. in 5% CO2. Treatment with octyl α-KG, octyl (R)-2-HG, octyl (S)-2-HG, or DMSO (vehicle control) was for 1 hour. Cells were washed in unbuffered DMEM (pH 7.4, 10 mM glucose) immediately prior to measurement, and maintained in this buffer with indicated concentrations of compound. OCR or ECAR were measured 3 times under basal conditions and normalized to protein concentration per well. Statistical analysis was performed using GraphPad Prism (unpaired t-test, two-tailed, two-sample unequal variance). Mitochondrial RCR was analyzed using isolated mouse liver mitochondria (see Brand, et al. Biochem J 435, 297-312 (2011) and references therein). Mitochondria were isolated from mouse liver as described above. The final mitochondrial pellet was resuspended in 30 μl of MAS buffer (70 mM sucrose, 220 mM mannitol, 10 mM KH2PO4, 5 mM MgCl2, 2 mM HEPES, 1 mM EGTA, and 0.2% fatty acid free BSA, pH 7.2). Isolated mitochondrial respiration was measured by running coupling and electron flow assays as described (Rogers, et al. PLoS One 6, e21746 (2011)). For the coupling assay, 20 μg of mitochondria in complete MAS buffer (MAS buffer supplemented with 10 mM succinate and 2 μM rotenone) were seeded into a XF24 Seahorse plate by centrifugation at 2,000×g for 20 minutes at 4° C. Just before the assay, the mitochondria were supplemented with complete MAS buffer for a total of 500 μl (with 1% DMSO, octanol, octyl α-KG, or octyl 2-HG), and warmed at 37° C. for 30 minutes before starting the oxygen consumption rate measurements. Mitochondrial respiration begins in a coupled State 2; State 3 is initiated by 2 mM ADP; State 4o (oligomycin-insensitive, i.e., Complex V-independent) is induced by 2.5 μM oligomycin and State 3u (FCCP uncoupled maximal respiratory capacity) by 4 μM FCCP. Finally, 1.5 μg/ml antimycin A was injected at the end of the assay. The State 3/State 4o ratio gives the respiratory control ratio (RCR). For the electron flow assay, the MAS buffer was supplemented with 10 mM sodium pyruvate (Complex I substrate), 2 mM malate (Complex II inhibitor), and 4 μM FCCP, and the mitochondria are seeded the same way as described for the coupling assay. After basal readings, the sequential injections were as follows: 2 μM rotenone (Complex I inhibitor), 10 mM succinate (Complex II substrate), 4 μM antimycin A (Complex III inhibitor), and 10 mM/100 μM ascorbate/tetramethylphenylenediamine (Complex IV substrate). ATP synthesis enzyme inhibition kinetic analysis was performed using isolated mitochondria. Mitochondria were isolated from mouse liver as described above. The final mitochondrial pellet was resuspended in MAS buffer supplemented with 5 mM sodium ascorbate (Sigma, A7631) and 5 mM TMPD (Sigma, T7394). The reaction was carried out in MAS buffer containing 5 mM sodium ascorbate, 5 mM TMPD, luciferase reagent (Roche, 11699695001), octanol or octyl α-KG, variable amounts of ADP (Sigma, A2754), and 3.75 ng/μl mitochondria. ATP synthesis was monitored by the increase in luminescence over time by a luminometer (Analyst HT, Molecular Devices). ATP synthase-independent ATP formation, derived from the oligomycin-insensitive luminescence, was subtracted as background. The initial velocity of ATP synthesis was calculated from the slope of the first 3 minutes of the reaction, before the velocity begins to decrease. Enzyme inhibition kinetics was analyzed by nonlinear regression least squares fit using GraphPad Prism. Assay for Mammalian TOR (mTOR) Pathway Activity mTOR pathway activity in cells treated with octyl α-KG, 2-HG, or oligomycin was determined by the levels of phosphorylation of known mTOR substrates, including S6K (T389), 4E-BP1 (S65), AKT (S473), and ULK1 (S757) (Pullen & Thomas, FEBS Lett 410, 78-82 (1997); Burnett, et al. PNAS USA 95, 1432-1437 (1998); Gingras, et al. Genes Dev 15, 2852-2864 (2001); Sarbassov, et al. Science 307, 1098-1101 (2005); and Kim, et al. Nat Cell Biol 13, 132-141 (2011)). Specific antibodies used: P-S6K T389 (Cell Signaling Technology, 9234), S6K (Cell Signaling Technology, 9202S), P-4E-BP1 S65 (Cell Signaling Technology, 9451S), 4E-BP1 (Cell Signaling Technology, 9452S), P-AKT S473 (Cell Signaling Technology, 4060S), AKT (Cell Signaling Technology, 4691S), P-ULK1 S757 (Cell Signaling Technology, 6888), ULK1 (Cell Signaling Technology, 4773S), and GAPDH (Santa Cruz Biotechnology, 25778). DA2123 animals carrying an integrated GFP::LGG-1 translational fusion gene (Kang, et al. Genes Dev 21, 2161-2171 (2007); Hansen, et al. PLoS Genet 4, e24 (2008); and Alberti, et al. Autophagy 6, 622-633 (2010)), were used to quantify levels of autophagy. To obtain a synchronized population of DA2123, an egg preparation of gravid adults was prepared (by lysing about 100 gravid worms in 70 μl M9 buffer, 25 μl bleach and 5 μl 10 N NaOH), and the eggs were allowed to hatch overnight in M9 causing starvation induced L1 diapause. L1 larvae were deposited onto NGM treatment plates containing vehicle, 8 mM α-KG, or 40 μM oligomycin, and seeded with either Assay for autophagy in mammalian cells. HEK-293 cells were seeded in 6-well plates at 2.5×105cells/well in DMEM media supplemented with 10% FBS and 10 mM glucose, and incubated overnight before treatment with either octanol (vehicle control) or octyl α-KG for 72 hours. Cells were lysed in M-PER buffer with protease and phosphatase inhibitors. Lysates were subjected to SDS-PAGE on a 4-12% Bis-Tris gradient gel with MES running buffer and Western blotted for LC3 (Novus, NB100-2220). LC3 is the mammalian homolog of worm LGG-1, and conversion of the soluble LC3-I to the lipidated LC3-II is activated in autophagy, e.g., upon starvation (Kabeya, et al. EMBO J 19, 5720-5728 (2000)). Pharyngeal Pumping Rates of The pharyngeal pumping rates of 20 wild-type N2 worms per condition were assessed. Pharyngeal contractions were recorded for 1 minute using a Zeiss M2BioDiscovery microscope and an attached Sony NDR-XR500V video camera at 12-fold optical zoom. The resulting videos were played back at 0.3× speed using MPlayerX and pharyngeal pumps were counted. Statistical analysis was performed using Microsoft Excel (t-test, two-tailed, two-sample unequal variance). Assay for α-KG Levels in Synchronized adult worms were collected from plates with vehicle (H2O) or 8 mM α-KG, washed 3 times with M9 buffer, and flash frozen. Worms were lysed in M9 using Lysing Matrix C tubes (MP Biomedicals, 6912-100) and the FastPrep-24 (MP Biomedicals) high-speed benchtop homogenizer in the 4° C. room (disrupt worms for 20 seconds at 6.5 m/s, rest on ice for 1 minute; repeat three times). Lysed animals were centrifuged at 14,000 rpm for 10 minutes at 4° C. to pellet worm debris, and the supernatant was saved. The protein concentration of the supernatant was determined by the BCA Protein Assay kit (Pierce, 23223); there was no difference in protein level per worm in α-KG treated and vehicle treated animals (data not shown). α-KG content was assessed as described previously (MacKenzie, et al. Mol Cell Biol 27, 3282-3289 (2007)) with modifications. Worm lysates were incubated at 37° C. in 100 mM KH2PO4(pH 7.2), 10 mM NH4Cl, 5 mM MgCl2, and 0.3 mM NADH for 10 minutes. Glutamate dehydrogenase (Sigma, G2501) was then added to reach a final concentration of 1.83 units/ml. Under these conditions glutamate dehydrogenase uses α-KG and NADH to make glutamate. The absorbance decrease was monitored at 340 nm. The intracellular level of α-KG was determined from the absorbance decrease in NADH. The approximate molarity of α-KG present inside the animals was estimated using average protein content (about 245 ng/worm, from BCA assay) and volume (about 3 nL for adult worms 1.1 mm in length and 60 μm in diameter (WorldWideWeb.wormatlasDOTORG/hermaphrodite/introduction/Introframeset.Hyper TextMarkupLanguage, wherein “WorldWideWeb” is “www”, “DOTORG” is “.org”, and “HyperTextMarkupLanguage” is “html”)). For quantitative analysis of α-KG in worms using UHPLC-ESI/MS/MS, synchronized day 1 adult worms were placed on vehicle plates with or without bacteria for 24 h, and then collected and lysed in the same manner as above. α-KG analysis by LC/MS/MS was carried out on an Agilent 1290 Infinity UHPLC system and 6460 Triple Quadrupole mass spectrometer (Agilent Technologies) using an electrospray ionization (ESI) source with Agilent Jet Stream technology. Data were acquired with Agilent MassHunter Data Acquisition software version B.06.00, and processed for precursor and product ions selection with MassHunter Qualitative Analysis software version B.06.00 and for calibration and quantification with MassHunter Quantitative Analysis for QQQ software version B.06.00. For UHPLC, 3 μl calibration standards and samples were injected onto the UHPLC system including a G4220A binary pump with a built-in vacuum degasser and a thermostatted G4226A high performance autosampler. An ACQUITY UPLC BEH Amide analytical column (2.1×50 mm, 1.7 μm) and a VanGuard BEH Amide Pre-column (2.1×5 mm, 1.7 μm) from Waters Corporation were used at the flow rate of 0.6 ml/min using 50/50/0.04 acetonitrile/water/ammonium hydroxide with 10 mM ammonium acetate as mobile phase A and 95/5/0.04 acetonitrile/water/ammonium hydroxide with 10 mM ammonium acetate as mobile phase B. The column was maintained at room temperature. The following gradient was applied: 0-0.41 min: 100% B isocratic; 0.41-5.30 min: 100-30% B; 5.3-5.35 min: 30-0% B; 5.35-7.35 min: 0% B isocratic; 7.35-7.55 min: 0-100%B; 7.55-9.55 min: 100% B isocratic. For the MS detection, the ESI mass spectra data were recorded on a negative ionization mode by MRM. MRM transitions of α-KG and its ISTD13C4-α-KG (Cambridge Isotope Laboratories) were determined using a 1-min 37% B isocratic UHPLC method through the column at flow rate of 0.6 ml/min. The precursor ion of [M—H]− and the product ion of [M—CO2—H]− were observed to have the highest signal to noise ratios. The precursor and product ions are respectively 145.0 and 100.9 for AKG, and 149.0 and 104.9 for ISTD13C4-α-KG. Nitrogen was used as the drying, sheath, and collision gas. All the source and analyzer parameters were optimized using Agilent MassHunter Source and iFunnel Optimizer and Optimizer software respectively. The source parameters are as follows: drying gas temperature 120° C., drying gas flow 13 L/min, nebulizer pressure 55 psi, sheath gas temperature 400° C., sheath gas flow 12 L/min, capillary voltage 2000 V, and nozzle voltage 0 V. The analyzer parameters are as follows: fragmentor voltage 55 V, collision energy 2 V, and cell accelerator voltage 1 V. The UHPLC eluants before 1 minute and after 5.3 minutes were diverted to waste. Octyl α-KG, a membrane-permeable ester of α-KG (MacKenzie, et al. Mol Cell Biol 27, 3282-3289 (2007); Zhao, et al. Science 324, 261-265 (2009); Xu, et al. Cancer Cell 19, 17-30 (2011); and Jin, et al. Cancer Res 73, 496-501 (2013)), was used to deliver α-KG across lipid membranes in experiments using cells and mitochondria. Upon hydrolysis by cellular esterases, octyl α-KG yields α-KG and the byproduct octanol. It was found that, whereas octanol control has no effect ( Cells were seeded in 12-well plates and after overnight incubation were treated with indicated concentrations of each compound. After harvesting, cells were stained by Acridine Orange (AO) and DAPI. Cell number and viability were measured based on AO and DAPI fluorescence measured by NC3000 (Chemometec) following the manufacturer's instructions. Cells were cultured for 24 hours, rinsed with PBS, and medium containing [1,2-13C]glucose (1 g/L) added. After 24 hours culture, cells were rinsed with ice-cold 150 mM NH4AcO (pH 7.3) followed by addition of 400 ml cold methanol and 400 ml cold water. Cells were scraped off, transferred to an Eppendorf tube, and 10 nmol norvaline as well as 400 ml chloroform added to each sample. For the metabolite extraction, samples were vortexed for 5 minutes on ice, spun down, and the aqueous layer transferred into a glass vial and dried. Metabolites were resuspended in 70% ACN, and 5 ml sample loaded onto a Phenomenex Luna 3u NH2 100A (150×2.0 mm) column. The chromatographic separation was performed on an UltiMate 300RSLC (Thermo Scientific) with mobile phases A (5 mM NH4AcO, pH 9.9) and B (ACN) and a flow rate of 300 ml/minutes. The gradient ran from 15% A to 95% A over 18 minutes, 9 minutes isocratic at 95% A, and re-equilibration for 7 minutes. Metabolite detection was achieved with a Thermo Scientific Q Exactive mass spectrometer run in polarity switching mode (+3.0 kV/−2.25 kV). TraceFinder 3.1 (Thermo Scientific) was used to quantify metabolites as area under the curve using retention time and accurate mass measurements (≦3 ppm). Relative amounts of metabolites were calculated by summing up all isotopomers of a given metabolite. Freshly prepared mice liver mitochondria were suspended at 1 μg/μl in medium consisting of 220 mM mannitol, 70 mM sucrose, 2 mM HEPES, 2.74 μM antimycin A, 5 μM rotenone, 1 mM EGTA, and 10 mM potassium phosphate buffer, pH 7.4. The mitochondria suspension was incubated with designated drug for 30 minutes in 37° C. After incubation, the suspension was transferred to ice for 10 minutes incubation. Afterwards, 100 μM [3H]ADP (specific radioactivity, 185 kBq/pmol) was added, and the mixture was immediately vortexed and incubated for 20 seconds on ice. The reaction was terminated by addition of 10 μM carboxyatractyloside, and the mixture was centrifuged at 10,000 g for 10 minutes at 4° C. After centrifuge, the supernatant was collected for reading and the pellet was washed twice with the same medium supplemented with 10 μM carboxyatractyloside. After washing, the pellet was lysed by the addition of 0.2 ml of 1% SDS. The radioactivity of the lysate and supernatant was determined by TRI-CARB 2300 TR liquid scintillation analyzer. The ADP-ATP translocation rate was determined by the ratio of the pellet versus the sum reading of the pellet and supernatant. All experiments were repeated at least two times with identical or similar results. Data represent biological replicates. Appropriate statistical tests were used for every figure. Data meet the assumptions of the statistical tests described for each figure. Mean±s.d. is plotted in all figures unless stated otherwise. As shown in As shown in As shown in As shown in As shown in As shown in 144IMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLL193(SEQ ID NO:7) that has 90% identity to the As shown in As shown in As shown in As shown in As shown in As shown in As shown in As shown in In experiments similar to those conducted for α-KG and 2-HG compounds, both D-glutamate and L-glutamate administration increases the lifespan of subjects (data not shown). To the extent necessary to understand or complete the disclosure of the present invention, all publications, patents, and patent applications mentioned herein are expressly incorporated by reference therein to the same extent as though each were individually so incorporated. Having thus described exemplary embodiments of the present invention, it should be noted by those skilled in the art that the within disclosures are exemplary only and that various other alternatives, adaptations, and modifications may be made within the scope of the present invention. Accordingly, the present invention is not limited to the specific embodiments as illustrated herein, but is only limited by the following claims. Disclosed herein are methods for (a) inhibiting, reducing, slowing, or preventing, the aging of a subject, (b) for treating, inhibiting, reducing, or preventing an age-related disease in the subject, and/or (c) for increasing the lifespan of the subject which comprise administering to the subject one or more glutamate compounds, such as α-ketoglutate, and/or one or more glutamate compounds, such as 2-hydroxypentanedioate, and compositions thereof. 1-20. (canceled) 21. A method of treating, inhibiting, reducing, or preventing an age-related disease in a subject, comprising administering a compound of formula I: wherein:
Ra and Rb are each independently H, a straight or branched C1-C10 alkyl, or a straight or branched C1-C10 alkenyl, and Rc is optionally present, and if present, Rc is H, a straight or branched C 1-C 10 alkyl, or a straight or branched C1-C10 alkenyl, and if absent, Z is a double bond, or pharmaceutically acceptable solvates, salts, prodrugs, and metabolites thereof, and wherein a level of alpha-ketoglutarate in the subject is increased by at least 30% after the administration. 22. The method of 23. The method of 24. The method of 25. The method of 26. The method of 27. The method of 28. The method of 29. The method of 30. The method of 31. The method of 32. The method of 33. The method of 34. The method of 35. The method of 36. The method of 37. The method of 38. The method of 39. A method of inhibiting, reducing, slowing, or preventing the aging of a subject, comprising administering a compound of formula II: wherein:
Ra and Rb are each independently a negative charge, H, a straight or branched C1-C10 alkyl, or a straight or branched C1-C10 alkenyl, or pharmaceutically acceptable solvates, salts, prodrugs, and metabolites thereof. 40. The method of 41. A method of inhibiting, reducing, slowing, or preventing the aging of a subject, comprising administering a 2-HG compound, wherein a 2-HG compound is selected from 2-hydroxyglutaric acid, 2-hydroxypentanedioate, 1-octyl-(S)-hydroxypentanedioate, 1-octyl-(R)-hydroxypentanedioate, 5-octyl-(S)-hydroxypentanedioate, and 5-octyl-(R)-hydroxypentanedioate.CROSS-REFERENCE TO RELATED APPLICATIONS
ACKNOWLEDGEMENT OF GOVERNMENT SUPPORT
REFERENCE TO A SEQUENCE LISTING SUBMITTED VIA EFS-WEB
BACKGROUND OF THE INVENTION
1. Field of the Invention
2. Description of the Related Art
SUMMARY OF THE INVENTION
DESCRIPTION OF THE DRAWINGS
DETAILED DESCRIPTION OF THE INVENTION
EXAMPLES
Bristol N2 wild-type Center (CGC), University of Minnesota DA1116 eat-2(ad1116)II CGC CB1370 daf-2(e1370)III CGC CF1038 daf-16(mu86)I CGC PD8120 smg-1(cc546ts)I CGC SM190 smg-1(cc546ts)I; CGC pha-4(zu225)V RB754 aak-2(ok524)X CGC ZG31 hif-1(ia4)V CGC ZG596 hif-1(ia7)V CGC JT307 egl-9(sa307)V CGC CB5602 vhl-1(ok161)X CGC DA2123 adls2122[lgg-1::GFP + CGC rol-6(su1006)] Cell Culture
Compounds
(SEQ ID NO: 1) atp-2 forward: TGACAACATTTTCCGTTTCACC (SEQ ID NO: 2) atp-2 reverse: AAATAGCCTGGACGGATGTGAT (SEQ ID NO: 3) let-363/CeTOR forward: GATCCGAGACAAGATGAACGTG (SEQ ID NO: 4) let-363/CeTOR reverse: ACAATTTGGAACCCAACCAATC (SEQ ID NO: 5) ogdh-1 forward: TGATTTGGACCGAGAATTCCTT (SEQ ID NO: 6) ogdh-1 reverse: GGATCAGACGTTTGAACAGCAC Lifespan Analysis
Food Preference Assay
Target Identification Using Drug Affinity Responsive Target Stability (DARTS)
Complex V Activity Assay
Submitochondrial Particle (SMP) ATPase Assay
Assay for ATP Levels
Measurement of Oxygen Consumption Rates (OCR) and Extracellular Acidification Rates (ECAR)
Measurement of Mitochondrial Respiratory Control Ratio (RCR)
ATP Synthase Enzyme Inhibition Kinetics
Assay for Autophagy
Membrane Permeable Esters of α-KG
Cell Growth and Viability Assays
Metabolic Profile Analysis
Assay for ADP Import
Statistical Analyses
Results


































