PHOTOELECTRIC CONVERSION ELEMENT, PRODUCTION METHOD FOR A PHOTOELECTRIC CONVERSION ELEMENT, SOLID-STATE IMAGE SENSOR, PRODUCTION METHOD FOR A SOLID-STATE IMAGE SENSOR, ELECTRONIC APPARATUS, PHOTOCONDUCTOR, PRODUCTION METHOD FOR A PHOTOCONDUCTOR AND MULTILAYER TRANSPARENT PHOTOELECTRIC CONVERSION ELEMENT
The present disclosure relates to a photoelectric conversion element containing a protein, a production method for the photoelectric conversion element, a solid-state image sensor, a production method for the solid-state image sensor, an electronic apparatus, a photoconductor, a production method for the photoconductor and a multilayer transparent photoelectric conversion element. Most known light-receiving elements function as photodiodes and the photodiodes containing the same operate, as a reverse bias voltage is applied thereto. Proposed as a photoelectric conversion element containing a protein was a photoelectric conversion element containing a protein-immobilized electrode having a zinc-substituted equine cardiac muscle cytochrome c (in which the central metal iron of the prosthetic group hem of equine cardiac muscle cytochrome c is substituted with zinc) immobilized on a gold electrode (see Japanese Patent Application Laid-open No. 2007-220445, hereinafter referred to as Patent Document 1). It was shown that photocurrent can be obtained by using the protein-immobilized electrode. However, in the light-receiving elements in the past described above, a fairly large part of the carriers excited by light disappeared by recombination before they contribute to photocurrent (CMOS type) or charge accumulation (CCD type), which in turn led to deterioration in photoelectric conversion efficiency. Thus, it is desired to provide a photoelectric conversion element which prevents recombination of optically excited carriers and disappearance thereof, and increases the photoelectric conversion efficiency and a production method thereof. It is also desired to provide a solid-state image sensor which prevents recombination of optically excited carriers and disappearance thereof, and increases the photoelectric conversion efficiency and a production method thereof. It is additionally desired to provide a photoconductor which prevents recombination of optically excited carriers and disappearance thereof, and increases the photoelectric conversion efficiency and a production method thereof. It is additionally desired to provide a high-performance electronic apparatus containing the favorable photoelectric conversion element or solid-state image sensor. It is additionally desired to provide a multilayer transparent photoelectric conversion element which prevents recombination of optically excited carriers and disappearance thereof, and increase the photoelectric conversion efficiency. It is additionally desired to provide a high-performance electronic apparatus containing the favorable multilayer transparent photoelectric conversion element. These and other objects, features and advantages of the present disclosure will become more apparent in light of the following detailed description of best mode embodiments thereof, as illustrated in the accompanying drawings. According to an embodiment of the present disclosure, there is provided a photoconductor, including the complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state. There is also provided a production method for the photoconductor, including the complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state. There is also provided a photoelectric conversion element, including a photoconductor, containing the complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state. There is also provided a production method for the photoelectric conversion element, including forming a photoconductor containing the complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state. There is also provided an electronic apparatus, including a photoelectric conversion element containing a photoconductor that contains the complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state. There is also provided a multilayer transparent photoelectric conversion element, including multiple mutually-laminated transparent photoelectric conversion elements containing a photoconductor that contains the complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state. There is also provided an electronic apparatus, including a multilayer transparent photoelectric conversion element, containing multiple mutually-laminated transparent photoelectric conversion elements containing a photoconductor that contains the complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state. Typically in the photoconductor described above, the conductive polymer and/or polymer semiconductor and the protein are bound to each other via non-covalent or covalent bonds. Typically, the conductive polymer and/or polymer semiconductor forms a network as a whole. The conductive polymer and/or polymer semiconductor is usually p-type, but it may be n-type. The term “extended-life” of the dye having a long-lived excited state contained in the protein is a value of the excitation lifetime common to fluorescent or phosphorescent dyes, and the life is typically tens of picoseconds or more, but is not limited thereto. The protein is at least one protein selected, for example, from the group consisting of electron transfer proteins, coenzyme-containing proteins, globins, fluorescent proteins and variants of the fluorescent proteins. Any known electron transfer protein may be used as the electron transfer protein. More specifically, the electron transfer protein for use may be a metal-containing electron transfer protein or a non-metal-containing (metal-free) electron transfer protein. The metal contained in the electron transfer protein is favorably a transition metal (e.g., zinc or iron) having electrons in the d or higher-energy orbital. A novel electron transfer protein described below may be used as the electron transfer protein. The complex of the conductive polymer and/or polymer semiconductor with the protein contains additionally another polymer higher in mechanical strength than the conductive polymer and/or polymer semiconductor, as necessary for increase in mechanical strength. In this way, it is not necessary to support the photoconductor with a substrate any more. Typically in the photoelectric conversion element above, the conductive polymer and/or polymer semiconductor is electrically connected to the first and second electrodes therebetween. The photoconductor and the first and second electrodes may be formed on a substrate for mechanical support, as necessary. The substrate may be transparent or non-transparent. For example to obtain a photoelectric conversion element transparent to visible light, the substrate and the first and second electrodes are made transparent to visible light. The photoelectric conversion element is, for example, a light-receiving element, but is not limited thereto. Typically in the production methods for the photoconductor and the photoelectric conversion element, the conductive polymer and/or polymer semiconductor and the protein are bound to each other via non-covalent or covalent bonds. The complex of the conductive polymer and/or polymer semiconductor and the protein can be prepared, for example, by using a solution containing the conductive polymer and/or polymer semiconductor and the protein. Alternatively, the complex can be prepared by adding a linker to the solution containing a conductive polymer and/or polymer semiconductor and a protein, thus binding the conductive polymer and/or polymer semiconductor and protein with the linker and then by using the resulting solution. Yet alternatively, the complex can be prepared by preparing a conductive polymer and/or polymer semiconductor from monomers by electrochemical polymerization of a solution containing the monomers for the conductive polymer and/or polymer semiconductor and a dye and forming a dye-containing protein by adding an apoprotein to the solution and then by using the solution. Typically in the production method for the photoelectric conversion element, the first and second electrodes are formed on a substrate, the photoconductor is formed on the resulting substrate in such a manner that the conductive polymer and/or polymer semiconductor is electrically connected to the first and second electrodes therebetween. The electronic apparatus containing the photoelectric conversion element above may be, for example, an electronic apparatus having a light-receiving unit and the function or the application thereof is not limited. The electronic apparatus containing the multilayer transparent photoelectric conversion element is not particularly limited, if it can contain the multilayer transparent photoelectric conversion element, and typical examples thereof include 3D displays, 3D image sensors, cameras, optical recording and reproducing systems and the like. There is also provided a solid-state image sensor, including a photoconductor that contains the complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state, as a light-receiving unit. There is also provided a production method for a solid-state image sensor, including forming a light-receiving unit by using a photoconductor containing the complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state. There is also provided an electronic apparatus, including a solid-state image sensor containing a photoconductor that contains the complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state, as a light-receiving unit. The description above for the photoelectric conversion element, production method for photoelectric conversion element and electronic apparatus applies to the solid-state image sensor, production method for the solid-state image sensor and the electronic apparatus containing the solid-state image sensor, unless specified otherwise. In the present disclosure described above, when light enters into the photoconductor containing the complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state, the dye contained in the protein absorbs photons, generating electron-hole pairs. The electron-hole pair is charge-separated, and one of them is injected out of the protein into the conductive polymer and/or polymer semiconductor (photodoping), while the other is localized in the neighborhood of the protein. For example, the hole of the electron-hole pair is injected into the conductive polymer and/or polymer semiconductor, while the electron is localized in the neighborhood of the protein. The conductive polymer and/or polymer semiconductor is electrically connected to the first and second electrodes therebetween. When bias voltage is applied between the first and second electrodes, the electron or hole injected into the conductive polymer and/or polymer semiconductor transmits through the conductive polymer and/or polymer semiconductor, and photocurrent flows between the first and second electrodes. In this case, each polypeptide constituting the protein serves as a barrier to the electrons or holes, preventing disappearance of the electrons or holes generated by the dye contained in one protein and the holes or electrons generated by the dye contained in another protein by recombination. When no light enters into the photoconductor containing the complex of a conductive polymer and/or polymer semiconductor and a protein, the photoconductor behaves like an insulator. According an embodiment of the present disclosure, it is possible to provide a photoelectric conversion element, a solid-state image sensor and a multilayer transparent photoelectric conversion element which prevents recombination of optically excited carriers and disappearance thereof, and increases the photoelectric conversion efficiency. It is thus possible to provide a high-performance electronic apparatus by using the favorable photoelectric conversion element, solid-state image sensor or multilayer transparent photoelectric conversion element. These and other objects, features and advantages of the present disclosure will become more apparent in light of the following detailed description of best mode embodiments thereof, as illustrated in the accompanying drawings. Hereinafter, embodiments of the present disclosure will be described with reference to drawings. The embodiments will be described in the following order. 1. First embodiment (photoconductor and production method thereof)
As shown in The blending ratio (mass ratio or weight ratio) of the conductive polymer and/or polymer semiconductor 11 to the protein 12 is not particularly limited and selected properly according to the desired photoconductivity of the photoconductor. Generally, the presence of the protein 12 in a greater amount with respect to that of the conductive polymer and/or polymer semiconductor 11 leads to increase in photoconductivity. The conductive polymer and/or polymer semiconductor 11 may be a p-type or n-type polymer. Conductive polymers are grouped grossly to hydrocarbon-based conductive polymers and hetero atom-containing conductive polymers. Examples of the hydrocarbon-based conductive polymers include polyacetylene, polyphenylene, polyphenylene vinylene, polyacene, polyphenylacetylene, polydiacetylene, polynaphthalene and the like. Examples of the hetero atom-containing conductive polymers include polypyrrole, polyaniline, polythiophene, polythienylene vinylene, polyazulene, polyisothianaphthene and the like. Examples of the proteins 12 containing a dye 12 (1) Cytochrome c′s (Electron Transfer Proteins);
cytochrome b, cytochrome b1, cytochrome b2, cytochrome b3, cytochrome b4, cytochrome b5, cytochrome b6, cytochrome b7, cytochrome b8, cytochrome b9, cytochrome b550, cytochrome b551, cytochrome b552, cytochrome b553, cytochrome b554, cytochrome b555, cytochrome b556, cytochrome b557, cytochrome b558, cytochrome b559, cytochrome b560, cytochrome b561, cytochrome b562, cytochrome b563, cytochrome b564, cytochrome b565, cytochrome b566, cytochrome b567, cytochrome b568, cytochrome b569, cytochrome P450and the like.
ferredoxin, rubredoxin, plastocyanin, azurin, pseudoazurin, stellacyanin, thioredoxin and the like. nucleotide-based coenzymes: nicotinamide adenine dinucleotide (NADH), nicotinamide adenine dinucleotide phosphoric acid (NADPH), flavin adenine nucleotide (FADH), flavin mononucleotide (FMN) and the like;
myoglobin, hemoglobin, neuroglobin, cytoglobin and the like.
Examples of the fluorescent compounds include the following fluorescence dyes:
For example for mechanical support of the photoconductor, the photoconductor is formed on a substrate, as necessary. Any known substrate may be used as the substrate, as it is selected properly, as necessary, and it may be a transparent or opaque substrate. The material for transparent substrate is selected properly, as necessary, but it is, for example, a transparent inorganic material such as quartz or glass or a transparent plastic material. A transparent plastic substrate is used favorably as the flexible transparent substrate. Examples of the transparent plastics include polyethylene terephthalate, polyethylene naphthalate, polycarbonate; polystyrene, polyethylene, polypropylene, polyphenylene sulfide, polyvinylidene fluoride, acetylcellulose, brominated phenoxy resins, aramides, polyimides, polystyrenes, polyarylates, polysulfones, polyolefins and the like. For example, a silicon substrate is used as the opaque substrate. A known linker, which is selected properly according to the conductive polymer and/or polymer semiconductor 11 and the protein 12, may be used as the linker 13. Specifically, the following linkers can be used. (1) Those binding the conductive polymer and/or polymer semiconductor 11 to the protein 12 via amine-amine bonds Glutaric aldehyde (reactive group: aldehyde group) DSG (reactive group: NHS ester, molecular weight: 326.26, spacer arm length: 7.7 Å) BS (PEG)5, (reactive group: NHS ester, PEG spacer, molecular weight; 532.50) BS(PEG)9(reactive group: NHS ester, PEG spacer, molecular weight: 708.71) DSP (reactive group: NHS ester, thiol cleavable, molecular weight: 404.42, spacer arm length: 12.0 Å) DST (reactive group: NHS ester, misc cleavable, molecular weight: 344.24, spacer arm length: 6.4 Å) DMA (reactive group: imide ester, molecular weight: 245.15, spacer arm length: 8.6 Å) DTBP (reactive group: imide ester, thiol cleavable, molecular weight: 309.28, spacer arm length: 11.9 Å) HBVS (vinylsulfone) (molecular weight: 266.38, spacer arm length: 14.7 Å) (2) Those binding the conductive polymer and/or polymer semiconductor 11 to the protein 12 with amine-mercapto (or sulfhydryl) bonds BMPS (reactive group: NHS ester/maleimide, molecular weight: 266.21, spacer arm length: 5.9 Å) SM(PEG)n(reactive group: NHS ester/maleimide, PEG spacer) SM(PEG)2(reactive group: NHS ester/maleimide, PEG spacer, n=2, 4, 6, 8, 12 or 24) SMPT (reactive group: NHS ester/pyridyldithiol, cleavable, molecular weight: 388.46, spacer arm length: 20.0 Å) SIA (reactive group: NHS ester/haloacetyl, molecular weight: 283.02, spacer arm length: 1.5 Å) (3) Those binding the conductive polymer and/or polymer semiconductor 11 to the protein 12 via amine-carboxy bonds. EDC (reactive group: carbodiimide, molecular weight: 191.70 (4) Those binding the conductive polymer and/or polymer semiconductor 11 to the protein 12 with mercapto (or sulfhydryl)-carbohydrate bonds BMPH (reactive group: maleimide/hydrazide, molecular weight: 297.19, spacer arm length: 8.1 Å) (5) Those binding the polymer network 11 to the protein 12 with hydroxyl-mercapto (or sulfhydryl) bonds PMPI (reactive group: isocyanate/maleimide, molecular weight: 214.18, spacer arm length: 8.7 Å) For improvement of the mechanical strength of the entire photoconductor, the photoconductor may contain one or more other polymers superior in mechanical strength, as necessary, in addition to the conductive polymer and/or polymer semiconductor 11. In this way, it is not necessary any more to form the photoconductor on a substrate for mechanical support thereof, for improvement in the mechanical strength of the photoconductor. Alternatively in addition to the conductive polymer and/or polymer semiconductor 11, one or more other polymers for viscosity adjustment may be added to the photoconductor for adjustment of the viscosity of the solution or suspension used during preparation of the photoconductor. The polymer for viscosity adjustment should be transparent at any absorption wavelength to the light entering into the photoconductor, should not raise the viscosity of the solution or suspension for preparation of the photoconductor when the polymer for viscosity adjustment is added thereto and should be stable in its insulative property. Alternatively, one or more other polymers superior in oxidation and humidity resistances may be blended with the photoconductor, for improvement of the oxidation resistance and humidity resistance of the photoconductor. Examples of the other polymers used for these purposes include, but are not limited to, polyethylene terephthalate (PET), polymethyl methacrylate (PMMA), polystyrene (PS), poly-4-vinylphenol (PVP) and the like. The production method for the photoconductor will be described. For production of the photoconductor shown in For production of the photoconductor shown in The photoconductor shown in In the first embodiment, a novel photoconductor containing the complex of a conductive polymer and/or polymer semiconductor 11 and a protein 12 containing a dye 12 As shown in Examples of the conductive polymer and/or polymer semiconductor 11, the protein 12 and the substrate 16 are shown below: The conductive polymer and/or polymer semiconductor 11 is, for example, p-type polyanilinesulfonic acid (PASA) or
The n-type conductive polymer and/or polymer semiconductor for use may be, for example, poly(p-pyridyl vinylene)poly(isothianaphthene). An example of the protein 12 is zinc-substituted cytochrome c. An example of the substrate 16 is an indium-tin mixed oxide (ITO) substrate. The production method for the photoconductor will be described below. A polymer solution containing a conductive polymer and/or polymer semiconductor 11 in a solvent and a protein solution containing a protein 12 in the same solvent are prepared (for example, respectively at pH 5.0). The solvent for use may be, for example, water or an organic solvent and is selected properly, as necessary. First, a first layer of the protein 12 is formed on the substrate 16, as the substrate 16 is immersed in the protein solution or coated with the protein solution and then the solvent is removed. Subsequently, the substrate 16 carrying the first layer protein 12 is immersed in the polymer solution or applied with the polymer solution. Electrostatic attractive force is then formed between the surface charge on the first layer protein 12 and the charge on the conductive polymer and/or polymer semiconductor 11 in the region carrying the charge opposite in polarity to the first layer, and the protein 12 and the conductive polymer and/or polymer semiconductor 11 are bound to each other by the electrostatic attractive force. Subsequently after removal of the solvent, the substrate 16 having the first protein 12 layer and the conductive polymer and/or polymer semiconductor 11 layer formed thereon is additionally immersed in the protein solution, or applied with the protein solution. Electrostatic attractive force is generated then between the surface charge on the conductive polymer and/or polymer semiconductor 11 layer formed on the substrate 16 and the charge of the oppositely charged protein 12 layer, and the conductive polymer and/or polymer semiconductor 11 and the protein 12 thereon are bound to each other by the electrostatic attractive force. Subsequently after removal of the solvent, the conductive polymer and/or polymer semiconductor 11 is additionally formed similarly. The process is repeated for necessary times, forming a laminate having a desired number of the layers of the conductive polymer and/or polymer semiconductor 11 and the protein 12. Other processes in the second embodiment are the same as those in the first embodiment. The production method of the second embodiment has advantages similar to those of the production method of the first embodiment. As shown in For example for mechanical support of the photoelectric conversion element, the photoelectric conversion element is formed on a substrate, as necessary. Specifically, a photoconductor 17, a first electrode 18 and a second electrode 19 are formed on a substrate. Any known substrate may be used as the substrate, as it is selected as necessary, and it may be a transparent or opaque substrate. The material for transparent substrate is selected properly, as necessary, but it is, for example, a transparent inorganic material, such as quartz or glass, or a transparent plastic material. A transparent plastic substrate is used as the flexible transparent substrate. Examples of the transparent plastics include polyethylene terephthalate, polyethylene naphthalate, polycarbonate, polystyrene, polyethylene, polypropylene, polyphenylene sulfide, polyvinylidene fluoride, acetylcellulose, brominated phenoxy resins, aramides, polyimides, polystyrenes, polyarylates, polysulfones, polyolefins and the like. For example, a silicon substrate is used as the opaque substrate. The production method for the photoelectric conversion element will be described below. First, a first electrode 18 and a second electrode 19 are formed on a substrate 16. For example for preparation of the first electrode 18 and second electrode 19, a film of a conductive material is formed and patterned on the substrate 16 by lithography and etching. Then, a photoconductor 17 is formed on the substrate 16 carrying the first and second electrodes in a manner similar to the first embodiment, to give a desired photoelectric conversion element. Operation of the photoelectric conversion element will be described below with reference to In the photoelectric conversion element when it is not irradiated with light (in dark state), the conductive polymer and/or polymer semiconductor 11 and the protein 12 constituting the photoconductor 17 are both insulators, and thus the photoconductor 17 is an insulator. On the other hand, when the photoconductor 17 of the photoelectric conversion element is irradiated with light having photon energy sufficient for excitation of the dye 12 In this case, because the proteins 12 are insulated from each other by the shell polypeptides 12 A photoelectric conversion element was prepared for photocurrent generation test. The photoelectric conversion element was prepared in the following manner: As shown in The central metal iron of the equine cardiac muscle cytochrome c is substituted with zinc, to give a zinc-substituted cytochrome c. The zinc-substituted cytochrome c was dissolved in water, to give 0.73 mM protein solution. Separately, polyanilinesulfonic acid (PASA) was dissolved in water, to give 5.1 mg/mL PASA solution. The PASA solution thus prepared was neutralized with sodium hydroxide (NaOH), to give a PASA sodium salt solution. The PASA sodium salt is represented by the following Formula: The PASA sodium salt solution thus prepared was then added to the protein solution, to give an aqueous protein-polymer solution. The weight ratio of the zinc-substituted cytochrome c to PASA sodium salt in the aqueous protein-polymer solution is 10:1. The concentration of the zinc-substituted cytochrome c in the aqueous protein-polymer solution was approximately 0.6 mM. The aqueous protein-polymer solution thus prepared was then applied on the comb-shaped electrode regions 21 The photocurrent action spectrum of the photoelectric conversion element was determined at a wavelength of 380 to 600 nm at room temperature. The voltage applied between the ITO electrodes 21 and 22 was changed from −1000 mV to +1000 mV at an interval of 250 mV. The photocurrent action spectrum obtained is shown in Graph A of A comparative test was performed for examination of the advantages of using a dye 12 The sample 1 containing the complex of a conductive polymer and/or polymer semiconductor 11 and a dye 12 A dye 12 The sample 2 containing the complex of a conductive polymer and/or polymer semiconductor 11 and protein 12 formed on comb-shaped electrode regions 21 Zinc-substituted cytochrome c was dissolved in water, to give 0.73 mM protein solution. Separately, polyaniline (PANI) was dissolved in NMP, to give 2 mg/mL PANI solution. The PANI solution was then added to the protein solution, to give an aqueous protein-polymer solution. The weight ratio of the zinc-substituted cytochrome c to PANI in the aqueous protein-polymer solution is 10:1. The aqueous protein-polymer solution thus prepared was then diluted to a PANI concentration of 0.24 mg/mL and the resulting solution was applied on comb-shaped electrode regions 21 Photocurrent action spectra of the samples 1 and 2 were determined at room temperature at a wavelength of 380 to 600 nm. The voltage applied between the ITO electrodes 21 and 22 was changed at 100 mV, 200 mV, 400 mV, 800 mV or 1600 mV. The photocurrent action spectra obtained for samples 1 and 2 are shown respectively in Dependence of the photocurrent Ipobtained from the sample 1 or 2 on the bias voltage is shown in For examination of the behavior of the sample 2 containing a photoconductor 17 containing the complex of a conductive polymer and/or polymer semiconductor 11 and protein 12 when positive or negative bias voltage is applied thereto, a bias voltage of −800 mV to +800 mV was applied between the ITO electrodes 21 and 22. The photocurrent action spectrum obtained is shown in (Application to Photosensor Array) Examples of application of the photoelectric conversion element to photosensor array will be described. (Example of Adding Other Polymers, in Addition to the Conductive, Polymer and/or Polymer Semiconductor 11, to Photoconductor 17) For examination of the influence when other polymers are added in addition to the conductive polymer and/or polymer semiconductor 11, MEH-PPV was used as the conductive polymer and/or polymer semiconductor 11 and PMMA represented by the following structural formula was used as the other polymer. For convenience in experiment, [6,6]-phenyl-C61-butyric acid methyl ester (PCBM) was used, replacing the protein 12. A photoconductor was prepared by using these MEH-PPV, PMMA and PCBM. Because use of PCBM permits drying of the photoconductor at a temperature of 150° C. or higher during its production, it can shorten the period necessary for production of the photoconductor significantly. A photoelectric conversion element similar to that shown in As described above, it is possible in the third embodiment to obtain a novel photoelectric conversion element by using the novel photoconductor 17 described in the first embodiment. The photoelectric conversion element, which prevents recombination of electrons and holes between the proteins 12 in photoconductor 17 and disappearance thereof, has high photoelectric conversion efficiency, compared to photodiodes in the past. In addition, although photodiodes in the past have a photoelectric conversion efficiency of up to 100%, the photoelectric conversion element can have a photoelectric conversion efficiency of more than 100%. Further, although it was not possible to adjust the photoelectric conversion efficiency of photodiodes in the past, because they are operated under reverse bias, it is possible to adjust the photoelectric conversion efficiency of the photoelectric conversion element easily by the bias voltage applied between the first electrode 18 and the second electrode 19. It is also possible to reduce the dark current significantly in the photoelectric conversion element. Because it is possible to make the photoconductor 17 flexible, it is also possible to make the photoelectric conversion element flexible, and even when a substrate is used, it is possible to make the photoelectric conversion element flexible by using a flexible substrate. The shape and size of the photoconductor 17 may be selected arbitrarily; the shape and size of the photoelectric conversion element can also be determined arbitrarily; and thus, a large-area photoelectric conversion element can also be prepared easily. As shown in In In production of the multilayer transparent photoelectric conversion element, a desired number of transparent photoelectric conversion elements 31 are laminated and the transparent photoelectric conversion elements 31 are bonded to each other then, for example, with a transparent adhesive, as necessary. When light at a wavelength suitable for the dye 12 It is possible in the fourth embodiment to prepare a multilayer transparent photoelectric conversion element in which multiple novel transparent photoelectric conversion elements 31 each containing the photoconductor 17 are laminated. The multilayer transparent photoelectric conversion element can be used in various apparatuses and devices that use photoelectric conversion, specifically, for example, as electronic apparatuses having a light-receiving unit. Such an electronic apparatus is fundamentally arbitrary and may be portable or stationary. For example as will be described below, it is possible to provide a camera that can focus on multiple objects placed at different positions simultaneously by using a single lens. It means that it is possible to obtain information constituting an 3D image at once with a single lens and thus, the multilayer transparent photoelectric conversion element can provide a simpler and more compact stereo camera. In addition, such a multilayer transparent photoelectric conversion element, when used, permits multi-focusing and high-speed focusing with a single lens. It is also possible to read out a multilayer optical disk in parallel and to read out a holographic recording medium easily, by using the multilayer transparent photoelectric conversion element as a light-receiving element for optical disk systems using a multilayer optical disk and optical recording and reproducing systems using a holographic recording medium. The multilayer transparent photoelectric conversion element in the fifth embodiment has a configuration similar to that of the multilayer transparent photoelectric conversion element in the fourth embodiment, except that a novel electron transfer protein is used as the protein 12 of the transparent photoelectric conversion element 31. The novel electron transfer protein is a tin-substituted mammal cytochrome c in which the hem central metal iron of the mammal cytochrome c is replaced with tin or a tin-containing protein derived from mammal-derived cytochrome c in which one or more amino acids of the amino acid sequence are deleted, substituted or added. Examples of the mammal cytochrome c′s include equine and bovine cardiac muscle cytochrome c′s. These novel electron transfer proteins are highly stable to photoirradiation and retain their photoelectric conversion function over an extended period of time. Details and production method of the tin-substituted cytochrome c will be described below. Table 1 shows the amino acid sequences (in one-letter code) of equine cardiac muscle cytochrome c (referred to as CYC_HORSE) and bovine cardiac muscle cytochrome c (referred to as CYC_BOVIN). As shown in Table 1, the bovine and equine cardiac muscle cytochrome c′s are different from each other only by 3 residues in all 104 amino acid residues. Thr47, Lys60 and Thr89 in the equine cardiac muscle cytochrome c are replaced respectively with Ser47, Gly60 and Gly89 in bovine cardiac muscle cytochrome c. Bovine cardiac muscle cytochrome c is known to be high in stability of its protein region to heat and modifying agent (guanidine hydrochloride salt), compared to equine cardiac muscle cytochrome c (McLendon, G. and Smith, M. J. Biol. Chem. 253, 4004 (1978), and Moza, B. and 2 others, Biochim. Biophys. Acta 1646, 49 (2003), hereinafter referred to as Non-patent Documents 1 and 2, respectively). Table 2 shows the denaturation midpoint temperature T1/2and the denaturation midpoint concentration [Gdn-HCl]1/2of equine and bovine cardiac muscle cytochrome c′s. The denaturation midpoint temperature T1/2is a temperature at which the rate of the denatured protein in all proteins present in the system is ½. Alternatively, the denaturation midpoint concentration [Gdn-HCl]1/2is a concentration of guanidine hydrochloride salt (Gdn-HCl) at which the rate of the denatured protein in all proteins present in the system is ½. The cardiac muscle cytochrome c is higher in stability when the values of the T1/2and the [Gdn-HCl]1/2are higher. Tin-substituted equine and bovine cardiac muscle cytochrome c′s were prepared in the following manner: Zinc-substituted equine and bovine cardiac muscle cytochrome c′s were also prepared for comparative tests. Equine and bovine cardiac muscle cytochrome c′s produced by Sigma-Aldrich were used. Hereinafter, the method of producing tin-substituted equine cardiac muscle cytochrome c will be described mainly, but tin-substituted bovine cardiac muscle cytochrome c, zinc-substituted equine and bovine cardiac muscle cytochrome c′s are also prepared similarly. Tin-containing proteins having the amino acid sequence of equine or bovine cardiac muscle cytochrome c of which one or more amino acids are deleted, substituted or added can also be prepared similarly by using a technology such as random mutation or chemical modification, properly. Six mL of 70% hydrofluoric acid/pyridine is added to 100 mg of equine cardiac muscle cytochrome c powder, the mixture is incubated at room temperature for 10 minutes, for removal of iron, the central metal of the hem of equine cardiac muscle cytochrome c. 9 mL of 50 mM ammonium acetate buffer solution (pH 5.0) is added to the iron-depleted equine cardiac muscle cytochrome c for termination of the reaction, and the solution is processed by gel filtration column chromatography (column volume: 150 mL, resin: Sephadex G-50, developing solvent: 50 mM sodium acetate buffer solution (pH 5.0)), to give a central metal-depleted metal-free equine cardiac muscle cytochrome c. The metal free equine cardiac muscle cytochrome c solution is concentrated as much as possible and adjusted to pH 2.5 (±0.05) by addition of glacial acetic acid. Approximately 25 mg of tin chloride powder is added to the solution thus obtained and the mixture is incubated at 50° C. in a dark place for 30 minutes. Addition of zinc acetate or zinc chloride, replacing tin chloride, in the process gives a zinc-substituted derivative. The incubation is continued, while the ultraviolet-visible absorption spectrum is measured repeatedly at an interval of 10 minutes, until the ratio of the absorption peak of the protein at a wavelength of 280 nm to the absorption peak of the tin porphyrin at a wavelength of 408 nm becomes constant. The operation thereafter is carried out in a dark place. The solution finally obtained was adjusted to neutral (6.0<) by addition of saturated disodium hydrogen phosphate solution and buffer-exchanged with 10 mM sodium phosphate buffer solution (pH 7.0). The monomer fraction is then collected by cation-exchange column chromatography (column volume: 40 mL, resin: SP-Sephadex Fast Flow, elution: linear concentration gradient of 10 to 150 mM sodium phosphate buffer solution (pH 7.0)), to give tin-substituted equine cardiac muscle cytochrome c. Measurement results of the ultraviolet-visible absorption spectra of the tin-substituted equine and bovine cardiac muscle cytochrome c′s and zinc-substituted equine and bovine cardiac muscle cytochrome c′s thus prepared are shown in (Photoirradiation Decomposition Test of Metal-Substituted Cytochrome c′s) Photoirradiation decomposition test of the 4 kinds of metal-substituted cytochrome c′s, tin-substituted equine and bovine cardiac muscle cytochrome c′s and zinc-substituted equine and bovine cardiac muscle cytochrome c′s was carried out in the following manner: Approximately 4 μM of a metal-substituted cytochrome c (dissolved in 10 mM sodium phosphate buffer solution (pH 7.0)) was placed in a 1 mL cuvette; the zinc substituted derivative was irradiated with a light at a wavelength of 420 nm (intensity: 1255 μW) and the tin substituted derivative with a light at a wavelength of 408 nm (intensity: 1132 μW) in a dark room at room temperature. The ultraviolet-visible absorption spectrum at a wavelength of 240 to 700 nm was determined every 30 minutes. The results are shown in The photodecomposition rate constant k of the 4 kinds of metal-substituted cytochrome c′s was determined from the average of two tests. As a result, the photodecomposition rate constant k of tin-substituted equine cardiac muscle cytochrome c was 1.39±0.13 M−1s−1; that of tin-substituted bovine cardiac muscle cytochrome c was 0.90±0.20 M−1s−1; that of zinc-substituted equine cardiac muscle cytochrome c was 67.2±1.4 M−1s−1; and that of zinc-substituted bovine cardiac muscle cytochrome c was 56.1±1.0 M−1s−1. The results show that both tin-substituted equine and bovine cardiac muscle cytochrome c′s had a photodecomposition rate 50 to 60 times smaller than that of zinc-substituted equine and bovine cardiac muscle cytochrome c′s, indicating that they are quite stable against photoirradiation. In addition, bovine cardiac muscle cytochrome c′s, both zinc- and tin-substituted derivatives, had a photodecomposition rate 1.2 to 1.5 times smaller than equine cardiac muscle cytochrome c′s, indicating that they are stable against photoirradiation. In particular, tin-substituted bovine cardiac muscle cytochrome c is 75 times more stable against photoirradiation than the zinc-substituted equine cardiac muscle cytochrome c used in Patent Document 1. (Photocurrent-Generating Test of Metal-Substituted Cytochrome c′s) A protein-immobilized electrode for use in photocurrent-generating test was prepared in the following manner. As shown in The protein-immobilized electrode was immersed in 27 mL of 10 mM sodium phosphate buffer solution containing 0.25 mM potassium ferrocyanide (pH 7.0), and the photocurrent action spectrum at a wavelength of 380 to 600 nm was determined by using the photocurrent analyzer shown in FIG. 4 of Patent Document 1, by using a platinum mesh as the counter electrode and a silver/silver chloride electrode as the reference electrode, with an electric potential applied to the silver/silver chloride electrode at 120 mV. In the measurement, the standby time was 900 seconds; the measuring time, 60 second; the current range, 10 nA; the frequency of the filter, 30 Hz; and the time resolution, 50 ms. Five electrodes were prepared and measured for each of the four kinds of metal-substituted cytochrome c′s. The photocurrent action spectra obtained are shown in (Fluorescence Quantum Yield of Metal-Substituted Cytochrome c′s) Dilute solutions of metal-substituted cytochrome c′s at different concentrations were prepared and the ultraviolet-visible absorption spectra at a wavelength of 380 to 440 nm and the fluorescence spectra (excitation wavelength: 409 nm) at a wavelength of 500 to 700 nm were determined. The results are shown in As shown in As described above, both tin-substituted equine and bovine cardiac muscle cytochrome c′s have stability against photoirradiation extremely higher than that of zinc-substituted equine and bovine cardiac muscle cytochrome c′s. For that reason, it is possible by using the tin-substituted equine or bovine cardiac muscle cytochrome c to prepare a novel transparent photoelectric conversion element 31 that can be used for an extended period of time. The transparent photoelectric conversion element 31 can be used, for example, as an optical sensor or an image sensor. The multilayer transparent photoelectric conversion element can be prepared similarly to the method described in the fourth embodiment. Operation of the multilayer transparent photoelectric conversion element is similar to that described in the fourth embodiment. As described above, according to the fifth embodiment, by using the tin-substituted equine or bovine cardiac muscle cytochrome c highly stable against photoirradiation as the protein 12, it is possible to prepare a novel transparent photoelectric conversion element 31 and thus to prepare a multilayer transparent photoelectric conversion element, containing the protein 12 that does not decompose even after long-term photoirradiation and thus remaining stable after used for an extended period of time. The multilayer transparent photoelectric conversion element can be used in various apparatuses, devices and others using photoelectric conversion, specifically in electronic apparatuses containing a light-receiving unit, similarly to the multilayer transparent photoelectric conversion element in the fourth embodiment. For example, as will be described below, it can provide a camera that can focus on multiple objects placed at positions different from each other simultaneously by using a single lens. Use of the multilayer transparent photoelectric conversion element also enables multi-focusing and high speed focusing with a single lens. Further, use of the multilayer transparent photoelectric conversion element as the light-receiving element of an optical disk system using a multilayer optical disk or an optical recording and reproducing system using a holographic recording medium, enables easy parallel read out of multilayer optical disks and easy read out of holographic recording media. The multilayer transparent photoelectric conversion element in the sixth embodiment has a configuration similar to that of the multilayer transparent photoelectric conversion element in the fourth embodiment, except that a novel electron transfer protein is used as the protein 12 of the transparent photoelectric conversion element 31. The novel electron transfer protein is a metal-substituted cytochrome c having a fluorescence excitation life τ of 5.0×10−11s<τ≦8.0×10−10that was prepared by replacing the hem central metal iron of mammal cytochrome c with a metal other than zinc and tin, or a protein having a fluorescence excitation life τ of 5.0×10−11s<τ≦8.0×10−10s that has an amino acid sequence obtained by deleting, substituting or adding one or more amino acids to the amino acid sequence of mammal cytochrome c and contains a metal other than zinc and tin. Examples of the mammal cytochrome c′s include equine and bovine cardiac muscle cytochrome c′s. These novel electron transfer proteins are extremely stable against photoirradiation and can retain their photoelectric conversion function over an extended period of time. (Metal-Substituted Cytochrome c′s) Metal-substituted equine and bovine cardiac muscle cytochrome c′s in which the hem central metal iron of equine and bovine cardiac muscle cytochrome c′s is substituted with a metal other than tin and zinc will be described below. Examples of the metals used in these metal-substituted equine and bovine cardiac muscle cytochrome c′s are shown in Table 4. Porphyrins containing such a metal as the central metal are known to emit fluorescence (Gouterman M., Optical spectra and electronic structure of porphyrins and related rings, in “The Porphyrins” Vol. 3, Dolphin, D. ed., pp. 1-156, Academic Press (1978), hereinafter referred to as Non-patent Document 5). In Table 4, the subscription of each element symbol shows the phosphorescence lifetime of the corresponding metal octaethylporphyrin. Table 4 shows the phosphorescence lifetime of tin (Sn) porphyrin is 30 ms, and metal porphyrins having a phosphorescence lifetime equivalent to or shorter than it are considered to be resistant to the damage to the protein and the porphyrin ring region by photoirradiation. As Table 4 shows, these metals are beryllium (Be), strontium (Sr), niobium (Nb), barium (Ba), lutetium (Lu), hafnium (Hf), tantalum (Ta), cadmium (Cd), antimony (Sb), thorium (Th), lead (Pb) and the like. Thus, the hem central metal iron of equine and bovine cardiac muscle cytochrome c′s is substituted with one of these metals. The substitution may be carried out by a method similar to that described in the fifth embodiment. The metal-substituted equine and bovine cardiac muscle cytochrome c′s thus obtained are stable against photoirradiation to an extent similar to that of tin-substituted equine and bovine cardiac muscle cytochrome c′s and hardly show photodecomposition. Hereinafter, the range of the fluorescence excitation lifetime desirable for the metal-substituted equine and bovine cardiac muscle cytochrome c′s will be described. The intramolecular hole transfer rate of zinc-substituted equine cardiac muscle cytochrome c is as follows (Non-patent Document 4): When the molecular orbital (MO) number used in Non-patent Document 4 is used as the MO number, the hole transfer rate during transition between MO3272 and MO3271 is 1.5×1011s−1, while it is 2.0×1010s−1during transition between MO3268 and MO3270. The latter value 2.0×1010s−1is used as the lower limit of the intramolecular hole transfer rate. The fluorescence excitation lifetime of the tin-substituted equine cardiac muscle cytochrome c is 8.0×10−10s (Non-patent Document 3). The fluorescence excitation lifetime of the zinc-substituted equine cardiac muscle cytochrome c is 3.2×10−10s. The intramolecular hole transfer number during one electronic excitation of tin-substituted equine cardiac muscle cytochrome c is (1.5×1011s−1)×(8.0×10−10s)=120 during transition between MO3272 and MO3271, and (2.0×1010s−1)×(8.0×10−10s)=16 during transition between MO3268 and MO3270. Thus, the latter value 16 is used as the lower limit of the intramolecular hole transfer number during one electronic excitation. In this case, the fluorescence excitation lifetime necessary for at least one hole transfer is 8.0×10−10s/16=5.0×10−11s. Thus, the range of the fluorescence excitation lifetime (τ) of the metal-substituted equine and bovine cardiac muscle cytochrome c′s necessary for hole transfer without any damage on protein region or porphyrin by photoirradiation is 5.0×10−11s (fluorescence excitation lifetime necessary for at least one hole transfer)<τ≦8.0×10−10s (fluorescence excitation lifetime of tin-substituted equine cardiac muscle cytochrome c). According to the sixth embodiment, it is possible, by using a metal-substituted equine or bovine cardiac muscle cytochrome c as the protein 12 of the transparent photoelectric conversion element 31, to obtain advantages similar to those of the multilayer transparent photoelectric conversion element in the fifth embodiment, containing tin-substituted equine or bovine cardiac muscle cytochrome c. The multilayer transparent photoelectric conversion element in the seventh embodiment is identical with the multilayer transparent photoelectric conversion element in the fourth embodiment in that it has a multilayer configuration of N layers of transparent photoelectric conversion elements 31, but different from it in that many pixels of the transparent photoelectric conversion element 31 are formed, as accumulated, on the plane. Specifically as shown in Transmission and processing of the signal from the pixels 62 in the integrated multilayer transparent photoelectric conversion element are performed by using a known technology. For example, wires are formed in the line and row directions, in such a manner that they are in contact with upper and lower electrodes of the pixels 62 of m rows and n columns aligned in a two-dimensional matrix shape. For example for read out of the signals from m pixels 62 in a selected column, a particular bias voltage is applied only to the wire connected to the electrodes corresponding to the pixels 62 in the column and then the photocurrent flowing in the wire connected to the other electrodes corresponding to the pixels 62 in m rows is detected. It is possible in the seventh embodiment to obtain advantages similar to those obtained in the fourth embodiment. In addition, the integrated multilayer transparent photoelectric conversion element has applications similar to the multilayer transparent photoelectric conversion element described in the fourth embodiment. As shown in Transmission and processing of the signal of the pixels 62 in the integrated multilayer transparent photoelectric conversion element are performed by using a known technology. It is possible according to the eighth embodiment to obtain advantages similar to those obtained in the fourth embodiment. In addition, the integrated multilayer photoelectric conversion element has applications similar to those of the multilayer transparent photoelectric conversion element in the fourth embodiment. The 3D imaging system of the ninth embodiment uses a camera containing the integrated multilayer transparent photoelectric conversion element of the seventh or eighth embodiment as its optical sensor. The camera is, for example, a digital camera or a video camcorder. The camera has a configuration in which the optical-axis direction of the imaging optical system of the camera is in parallel with the lamination direction of the pixels 62 of the transparent photoelectric conversion elements 31 in the integrated multilayer transparent photoelectric conversion element. In this way, the camera permits use of each of the N light-receiving faces in the integrated multilayer transparent photoelectric conversion element, in focusing during imaging of an object. Thus, it is possible to image objects placed at positions at different distances from the camera by focusing thereon. For example as shown in Reproduction of the image taken by the camera 71 on a display will be described. In a first example, a real 3D image taken by a camera 71 is reproduced on a display. It is possible, for example, to reproduce a real 3D image in which the flower 71 is shown closer and the mountain 72 far behind. In a second example, a region of particular interest in a 3D image taken by the camera 71 is represented as emphasized. For example in the example of Use of each of N light-receiving faces in the integrated multilayer transparent photoelectric conversion element for focusing during imaging of an object will be described below in detail once again. Change of the position on image plane in the integrated multilayer transparent photoelectric conversion element according to the distance of the object from lens L, i.e., change of focal point, will be described. As shown in As obvious from Table 5 and When the image plane of the image of the object obtained by lens L does not agree with the light-receiving face of the integrated multilayer transparent photoelectric conversion element, in other words when the focal point do not reside on the light-receiving face, the image of the object can be reproduced by the software algorithm from the signal obtained on each light-receiving face. As shown in For example when an image is taken by a television camera in a broadcasting station by using the technology and the image is reproduced on a 3D television set by using the image signal distributed from a broadcasting station, it is possible arbitrarily to zoom in or zoom out the region of particular interest for the user of an image shown according to the output signal from the light-receiving face of the integrated multilayer transparent photoelectric conversion element. It is possible by using a camera 71 to obtain clear images of multiple objects placed at positions at distances mutually different to each other from the camera 71. For example, as shown in It is possible by using the camera 71 to focus on the desired object at high speed. For example, as shown in As shown in It is possible by using the camera 71 to correct chromatic aberration without use of an expensive achromat lens. Specifically as shown in In the 3D imaging system of the tenth embodiment, a camera containing the integrated multilayer transparent photoelectric conversion element of the eighth embodiment is used as the optical sensor. As shown in In the 3D imaging system of the eleventh embodiment, a camera containing the integrated multilayer transparent photoelectric conversion element of the eighth embodiment is used as the light-receiving element. As shown in As shown in As shown in As shown in The configuration of the CCD image sensor except that described above is similar to that of interline-transmission CCD image sensors in the past. In the CCD image sensor, the first electrode 18 is biased to positive voltage with respect to the second electrode 19 of the photoelectric conversion element. When light enters into the photoconductor 17 in the light-receiving unit 176, electrons generated by photoexcitation flow into the n-type layer 174. Then, an n-type channel is formed in the p-type Si substrate 171 immediately below the read-out gate electrode 173, as a positive voltage is applied to the read-out gate electrode 173 under the state that a voltage higher than that of the n-type layer 174 is applied to the n-type layer 175 serving as vertical register, and the electrons in the n-type layer 174 are read out through the n-type channel into the n-type layer 175. The charges thus read out are transmitted then in the vertical register and additionally in the horizontal register, and electrical signals corresponding to the captured image are withdrawn out of the output terminal. It is possible according to the fourteenth embodiment to provide a novel CCD image sensor containing a photoelectric conversion element that contains a photoconductor 17 of the complex of a conductive polymer and/or polymer semiconductor 11 and a protein 12 as its light-receiving unit 176. Embodiments and examples of the present disclosure have been described, but the technology is not limited to those described above in the embodiments and examples, and various modifications are possible within the technological scope of the present technology. For example, the numerical values, structures, configurations, shapes and materials described above in embodiments and examples are nothing but examples and numerical values, structures, configurations, shapes, materials and others different from them may be used, as necessary. It is possible to form a conductor with the conductive polymer and/or polymer semiconductor, inject carriers into the conductive polymer and/or polymer semiconductor for example by optical doping, chemical doping, electrochemical doping, charge injection doping or non-redox doping, and thus, to increase the conductivity of the conductor. Examples of the conductive polymers and/or polymer semiconductors for use in such a conductor include, but are not limited to, trans-(CH)x's, polyaniline, derivatives of polyaniline having additional branched chains such as of sulfonic acid and the like. The present disclosure contains subject matter related to that disclosed in Japanese Priority Patent Application JP 2011-048510 filed in the Japan Patent Office on Mar. 7, 2011, the entire content of which is hereby incorporated by reference. It should be understood by those skilled in the art that various modifications, combinations, sub-combinations and alterations may occur depending on design requirements and other factors insofar as they are within the scope of the appended claims or the equivalents thereof. Provided is a photoelectric conversion element including a photoconductor containing a complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state. 1. A photoelectric conversion element, comprising a photoconductor containing a complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state. 2. The photoelectric conversion element according to 3. The photoelectric conversion element according to 4. The photoelectric conversion element according to 5. The photoelectric conversion element according to 6. The photoelectric conversion element according to 7. The photoelectric conversion element according to 8. The photoelectric conversion element according to 9. The photoelectric conversion element according to 10. The photoelectric conversion element according to 11. A method of producing a photoelectric conversion element, comprising forming a photoconductor containing a complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state. 12. The method of producing a photoelectric conversion element according to 13. The method of producing a photoelectric conversion element according to 14. The method of producing a photoelectric conversion element according to 15. The method of producing a photoelectric conversion element according to 16. The method of producing a photoelectric conversion element according to the conductive polymer and/or polymer semiconductor is formed from a monomer by electrochemical polymerization method by using a solution containing the monomer for preparation of the conductive polymer and/or polymer semiconductor and the dye, the protein containing the dye is formed by addition of an apoprotein to the solution, and the complex is formed by using the solution. 17. A solid-state image sensor, comprising a photoconductor containing a complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state, as a light-receiving unit. 18. A method of producing a solid-state image sensor, comprising forming a light-receiving unit by using a photoconductor containing a complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state. 19. An electronic apparatus, comprising a photoelectric conversion element containing a photoconductor that contains a complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state. 20. An electronic apparatus, comprising a solid-state image sensor containing a photoconductor that contains a complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state, as a light-receiving unit. 21. A photoconductor, comprising a complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state. 22. A method of producing a photoconductor, comprising forming a complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state. 23. A multilayer transparent photoelectric conversion element, comprising multiple mutually-laminated transparent photoelectric conversion elements containing a photoconductor that contains a complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state. 24. An electronic apparatus, comprising a multilayer transparent photoelectric conversion element containing multiple mutually-laminated transparent photoelectric conversion elements containing a photoconductor that contains a complex of a conductive polymer and/or polymer semiconductor and a protein containing at least one dye having a long-lived excited state. 25. The electronic apparatus according to BACKGROUND
SUMMARY
BRIEF DESCRIPTION OF DRAWINGS
DETAILED DESCRIPTION OF EMBODIMENTS
2. Second embodiment (photoconductor and production method thereof)
3. Third embodiment (photoelectric conversion element and production method thereof)
4. Fourth embodiment (multilayer transparent photoelectric conversion element and production method thereof)
5. Fifth embodiment (multilayer transparent photoelectric conversion element and production method thereof)
6. Sixth embodiment (multilayer transparent photoelectric conversion element)
7. Seventh embodiment (multilayer transparent photoelectric conversion element)
8. Eighth embodiment (multilayer transparent photoelectric conversion element)
9. Ninth embodiment (3D imaging system)
10. Tenth embodiment (3D imaging system)
11. Eleventh embodiment (3D imaging system)
12. Twelfth embodiment (optical disk system)
13. Thirteenth embodiment (optical recording and reproducing system)
14. Fourteenth embodiment (CCD image sensor)
1. First Embodiment
[Photoconductor]
cytochrome c, cytochrome c1, cytochrome c2, cytochrome c3, cytochrome c4, cytochrome c5, cytochrome c6, cytochrome c7, cytochrome c8, cytochrome c′, cytochrome c″, cytochrome cL, cytochrome cM, cytochrome cS, cytochrome c544, cytochrome c545, cytochrome c546, cytochrome c547, cytochrome c548, cytochrome c549, cytochrome c550, cytochrome c551, cytochrome c551.5, cytochrome c552, cytochrome c553, cytochrome c554, cytochrome c555, cytochrome c556, cytochrome c557, cytochrome c558, cytochrome c559, cytochrome c560, cytochrome c561, cytochrome c562, cytochrome c563and the like.
(2) Cytochrome b's (Electron Transfer Proteins):
(3) Cytochrome a′s (Electron Transfer Proteins):
cytochrome a, cytochrome a1, cytochrome a2, cytochrome a3, cytochrome o, cytochrome o3and the like.
(4) Other Electron Transfer Proteins:
(5) Proteins Containing the Following Coenzymes:
quinone-based coenzymes: ubiquinone, plastoquinone, menaquinone, caldariellaquinone, coenzyme F420, rhodoquinone and the like; and
porphyrin-based coenzymes: hem, chlorophyll, pheophytin, chlorin and the like.
(6) Globins:
(7) Fluorescent proteins and the variants:
green fluorescent protein (GFP), DsRed, Kusabira orange, TagBFP (from Evrogen), fruit fluorescent protein from Clontech (http://catalog.takara-bio.co.jp/clontech/product/basic_info.asp?unitid=U100005040), CoralHue series products from MBL (https://ruo.mbl.co.jp/product/flprotein/) and the like.
In addition to the compounds above, other fluorescent dyes known to those who are skilled in the art, such as those available from Molecular Probes (Eugene, Oreg., US) and Excitors (Dayton, Ohio, US) or the combinations thereof may be used.
[Production Method for Photoconductor]
2. Second Embodiment
[Photoconductor]
[Production Method for Photoconductor]
3. Third Embodiment
[Photoelectric Conversion Element]
[Production Method for Photoelectric Conversion Element]
[Operation of Photoelectric Conversion Element]
Example
4. Fourth Embodiment
[Multilayer Transparent Photoelectric Conversion Element]
[Production Method for Multilayer Transparent Photoelectric Conversion Element]
[Operation of Multilayer Transparent Photoelectric Conversion Element]
5. Fifth Embodiment
[Multilayer Transparent Photoelectric Conversion Element]
(Tin-Substituted Cytochrome c)
sp: CYC_HORSE_001 GDVEKGKKIFVQKCAQCHTVEKGGKHKTGP sp: CYC_BOVIN_001 GDVEKGKKIFVQKCAQCHTVEKGGKHKTGP 47 60 sp: CYC_HORSE_031 NLHGLFGRKTGQAPGFTYTDANKNKGITWK sp: CYC_BOVIN_031 NLHGLFGRKTGQAPGFSYTDANKNKGITWG 89 sp: CYC_HORSE_061 EETLMEYLENPKKYIPGTKMIFAGIKKKTE sp: CYC_BOVIN_061 EETLMEYLENPKKYIPGTKMIFAGIKKKGE sp: CYC_HORSE_091 REDLIAYLKKATNE 104 sp: CYC_BOVIN_091 REDLIAYLKKATNE 104 Equine cardiac muscle cytochrome c 85 2.50 Bovine cardiac muscle cytochrome c 88 2.61 (Preparation of Tin-Substituted Cytochrome c)
Zinc-substituted equine 1.0 cardiac muscle cytochrome c Zinc-substituted bovine 0.97 cardiac muscle cytochrome c Tin-substituted equine 0.13 cardiac muscle cytochrome c Tin-substituted bovine 0.13 cardiac muscle cytochrome c [Production Method for Multilayer Transparent Photoelectric Conversion Element]
[Operation of Multilayer Transparent Photoelectric Conversion Element]
6. Sixth Embodiment
[Multilayer Transparent Photoelectric Conversion Element]
Be(II) 12 ms Na(I) Mg(II) ~50 ms 130 ms K(I) Ca(II) Sc(III) Ti(IV) Al(III) Si(IV) ~50 ms 63 ms 400 ms 41 ms 115 ms 95 ms Sr(II) Y(III) Zr(IV) Nb(V) Zn(II) Ge(IV) As(V) 7 ms 55 ms 65 ms 14.5 ms 75 ms 42 ms 86 ms Ba(II) Lu(III) Hf(IV) Ta(V) Cd(II) Sn(IV) Sb(V) 8 ms 7.8 ms 8.4 ms 2.5 ms 7 ms 30 ms 26 ms Th(IV) Pb(IV) 0.43 ms 2.8 ms 7. Seventh Embodiment
[Multilayer Transparent Photoelectric Conversion Element]
8. Eighth Embodiment
[Multilayer Transparent Photoelectric Conversion Element]
9. Ninth Embodiment
[3D Imaging System]
1 5.263158 5.623413 5.044856 10 5.025126 20.53525 5.012204 56.23413 5.00445 100 5.002501 205.3525 5.001218 562.3413 5.000445 1000 5.00025 10000 5.000025 10. Tenth Embodiment
[3D Imaging System]
11. Eleventh Embodiment
[3D Imaging System]
12. Twelfth Embodiment
[Optical Disk System]
13. Thirteenth Embodiment
[Optical Recording and Reproducing System]
14. Fourteenth Embodiment
[CCD Image Sensor]



















































